Error loading sequence information for SPRG_03281 - InterProScan visuals disabled

Sa. parasitica: SPRG_03281

Location

scaffold_8

447055 - 447709 (+)

Protein Sequence

>SPRG_03281
MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV
NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM
AQGLIGGLASLARSSKTLAKDMCVALYSVRKYI

Gene Sequence

>SPRG_03281
ATGGAGTGGCAGATCCCGACGATCCGCGCGCTGAAGCGACAGCCGCAGGTTGACGAAGCG
CAGCGCATCCTCGAGAGGATAGCATCCTACGTGCTTCCGATCATGTCCAAGCGACAGTAC
CGCGTGCAGCAGCTCCTCGAGTTCTTCCCGAAGAATGCCAACTTGCTCGGGATGAACGTC
AACCATGGATGGAAAATCTACGTCCGCCTGCGTCCGGCGGCGCGGCCCACGAGCTTCCTG
CCGTTCGAGGACCTTCTCGGGACGATGCTCCACGAGCTGGTGCATATGAAGATCGGACCG
CACAACGCAGCCTTCTACAAGTTGTTGGACGAGCTGACGTCCGAGATGGAAACCCTCATG
GCCCAAGGCCTCATCGGTGGGCTTGCATCACTGGCGCGCAGTTCCAAGACGCTGGCCAAG
GACATGTGCGTCGCCCTTTACAGCGTCCGTAAGTACATCTGA

Amino Acid Properties