Error loading sequence information for PYU1_G005966 - InterProScan visuals disabled

Py. ultimum: PYU1_G005966

Location

scaffold_2028

852745 - 856170 (+)

Protein Sequence

>PYU1_G005966
MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ
AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSANSAEEMFASKQTGK
TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGAVIL
FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVFLYASTRRGLTCYHCTHDD
PALVKSAGASGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGFE
GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTSKGPAGGRKPPIAP
NSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA
ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI
HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIVDGKKNDLSGGDAL
SAVNGTGAAGDKLAKRDSSAGAETAQKGPGTAALNFDVETAISVLWENYPQHALTLAKKH
EEHSWYLKIQLDRISYVESEDSVALSTHEKERVADALEYIKHLSFSEADSNLRKYGRTLV
THLPEPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNT
SIGNTLLEMVLSETADEKRTEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRYL
YNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATTGEE
WRELKQLLALIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDEEKIK
AFKSDTKQMKEEITQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETEREC
ITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPIDDG
SFDARFSNEF

Gene Sequence

>PYU1_G005966
ATGGCGCAATGGAGACGCTTCGCGTTCTTCGACAAGGAGACGCTCAAGGACGGCAATGGC
CTCTGGCTCAAGGGAGTTGACATCACAAGCATGAGTGCGAATCGTGGCATGATCTGCGTC
GGCGATGGCGACGGATTCATCCACTTGGCCAACCGTCAGCTGGAGACGCGCAAGTTTCAG
GCCCACGAGAACTTTGTGTCCCATGTCGTCATGATGAAACGCAGTAACATCCTGGTGTCC
ATTGGCGATGGCATCGATCCACGTAGCGCTGAGCTGCGCGCACAGTCGAAAGCGGTCGCA
GACGCCGGCAGGTCGGCAAACTCGGCTGAAGAAATGTTCGCGAGCAAGCAGACAGGAAAG
ACGACTGCGGTAGTGCGCCTGTGGCGAACGGACCAGCAAGATCGCGACGGCAAGCCCAAG
CTCTTGCAGCAAATCCCCGTATTTGCCAAGAAGTACCCCGAAGAAGCCGTGACTGCGTTT
GCTGTGAACGACGACATCTCGCAACTCGCCGTGGGTCTGAAGAACGGAGCCGTGATTCTG
TTTCGAACGGATCTCAAGCGCCGCTCGGACCGTCCGCCTCATCTACTTCAGCCTGCTGGT
CAGTACCCTGTCACAGGTCTGGAGTTTACGAGCAAGCCCGTCACCAATACGGTCTCGCAC
GTGTTTCTCTACGCGTCGACGCGACGAGGACTCACGTGTTACCACTGCACTCACGACGAC
CCGGCGCTGGTCAAATCCGCTGGCGCTTCAGGACTTCCACCTCGAACGGTTGTTCTTGAT
GAACGTGGCGTCGACACGAACTGCTCGTGCGTGAACGACGAAGGCGAGATCGCAGTTGGG
CAGACGGATGCAGTGTACTTTTACACAACCGAAGATCGCTCGGTGTGCTTTGGCTTTGAA
GGCGAGAAGAAGTATTTGCATTTTTTCAAGCACTACCTGCTCGTAGCTCACGTGGATCCT
CGTGGCCGCCACCAAGTGAACGTGTACGACCTGCAGAATAAATTTATTGCGTTCAACTGG
ACGCTGACGAACACGACGTCAAAAGGACCAGCTGGTGGCCGAAAACCTCCGATTGCACCA
AACTCGCGGGCACCCGGCGCTCGCTTCGGGCTGGACGAAATGGAGGAGATCCGTCACGTG
GTGTGCGAGTTTGGTGCCATTTTCGTCGTGTCGTCTGTCGGCCACGTGTATCGTTTGACG
GAAAAGGACACAACGTCCAAGTTGGAGATCCTGTTCCGTAAAAACCTCTACTCGATCGCG
ATCTCGCTGGCATTCAGCTCCAACTACGATATCAACAGTATCATGGATATCTTCAGAATG
TATGGAGACCACTTGTACCAGAAGGGCGATTACGATGGGTCCCTGCGGCAATACGCGAGA
ACAATCGGTCATGTAGAACCTTCGTACGTGATTCGACGCTTCCTGGATGCTCAGCGCATC
CACAATTTGACTGCTTACCTTGAGGCATTGCATGAGAAAGCATTCGCAAATGCAGAGCAC
ACAACGCTGTTGCTCAACTGCTACACGAAGCTGAAGGACGTGAAGAAACTCGACAAATTC
ATTCAATTAGATGAGATTGTTGACGGCAAGAAGAATGATCTGAGTGGTGGAGATGCACTG
AGTGCTGTGAACGGCACTGGCGCTGCAGGAGACAAGTTAGCGAAACGAGACAGCTCGGCC
GGCGCTGAAACTGCTCAGAAAGGACCGGGCACCGCTGCGTTGAACTTCGATGTCGAAACT
GCAATTAGTGTGCTATGGGAGAACTACCCGCAACATGCGCTGACGCTCGCGAAAAAGCAC
GAGGAGCACAGCTGGTACTTGAAGATCCAACTGGATCGCATTAGTTACGTGGAATCCGAA
GACTCTGTTGCGCTTTCTACTCACGAAAAGGAGCGCGTGGCGGATGCACTCGAGTACATC
AAGCACCTGAGTTTCTCCGAAGCGGATTCGAATCTTCGCAAGTATGGTCGTACTCTCGTG
ACACACTTGCCGGAGCCGACGACGGAGTTGTTGAAACAGCTTTGCACAGGGAAATTTGTG
CCAGACAACTCGAAGCTGAAGTCCGATCCTGGCGATTTCTTGCATCTTTTTGTATCGCAT
CGCGCTCAACTGAAGGAGTTTTTGCAATACATTGTGGAAGTCGAGACTGTAAGCAACACG
TCAATTGGAAACACGCTTCTGGAAATGGTTTTGAGTGAAACGGCCGACGAAAAAAGAACT
GAAGAAGAGGTTGAAGATGCGGTCATGGCGATTTTGGACAATCCACGTGTGAAGTATGAC
GAAGACCACGCTCTGATTCATTTGCAGATGCGTGGCGTGAAGAAGGGCAAGCGCTACTTG
TACAACAAACTGCACATGTACCACATGCTCGTGCAATTCCACATCGAAGAGAATGACGAC
CAAAGCATTATCGACGAGGTGCGGAAACACGGCGAAAAAGACCCAAATCTGTGGTCGTTG
GCACTGAAATACTTTGCTGAGCGCGGACCGCTCCCCAAGGGAGCTACGACTGGTGAGGAG
TGGAGAGAACTCAAACAGTTGCTAGCGTTGATTGACAGCAACCCGGTCATCCCTCCATTG
CAGGTCGTTCAAGTGCTTAGTCAGTCCCGTGAACTTCCTGTCTCGGTGCTGAAGCAGTAT
ATTGTGAACCAGCTTTTGAATGATGAAAAGAAAATCGAAGAGGATGAAGAGAAAATCAAA
GCGTTCAAGAGCGACACCAAGCAGATGAAGGAAGAGATCACGCAACTCAGCGGCAAAGCA
GTGGTCTTCCAGGCGACGAAATGCGACTTGTGTAACCATGATTTGGACCTCCCGGCCGTT
CACTTTATGTGTCAGCACAGTTTCCACCTCAACTGTATCTCGGAGACCGAGCGCGAATGT
ATCACGTGCTCCATGGACCATCGTCACATTATGGGACTGAAGACACAATTGGAACAAAAA
GCGGGGAACCACGAACAGTTTTTCAACCAGCTTGAGACGGCAGCCGACGGTTTCCACACG
ATCGCCGAGTATTTCGGCAAGGGCATCTTCAAGAGCAACGAAGTTCCCATCGACGACGGA
TCATTTGACGCACGCTTCAGCAACGAATTCTAG

Amino Acid Properties