Error loading sequence information for PYU1_G005965 - InterProScan visuals disabled

Py. ultimum: PYU1_G005965

Location

scaffold_2028

857247 - 857682 (-)

Protein Sequence

>PYU1_G005965
MAMMQGGGAESFAIGKVRALVRRPRRDDAQKLLEQIAAHVLPILTQRCFRVRRLQEFFPT
NPHLLGMNVNKGVKIYIRLRPANAPGTFFPFEALLETMLHELTHMVRVGIEWQEHVY

Gene Sequence

>PYU1_G005965
ATGGCGATGATGCAGGGCGGTGGCGCGGAGTCGTTTGCCATCGGCAAGGTCCGAGCGCTC
GTGCGGCGTCCGCGGCGAGATGACGCGCAGAAGCTGCTGGAGCAGATCGCGGCCCACGTG
CTGCCGATCCTCACGCAGCGGTGCTTCCGCGTGCGGCGGCTGCAGGAGTTTTTCCCCACG
AACCCGCACCTGCTCGGCATGAACGTCAACAAGGGCGTCAAGATCTACATTCGGCTGCGG
CCAGCCAATGCGCCTGGCACGTTCTTCCCCTTCGAAGCGCTGCTGGAGACGATGCTGCAC
GAGCTCACACACATGGTTCGTGTCGGTATTGAGTGGCAAGAACACGTTTATTAG

Amino Acid Properties