Error loading sequence information for PYAR_24297 - InterProScan visuals disabled

Py. arrhenomanes: PYAR_24297

Location

scaffold_3711

487 - 1857 (+)

Protein Sequence

>PYAR_24297
MADALVTLKRNDRKTSCSPSPHNYGSITNTNGNNQHKNDHRVEVLRDADAGNKGSRRDRR
SQVAHALLRNQSATELQHMAPAASAKVQTAIRASLVINVILAVAKTYAAFASGSLAVLSS
LVDSILDLTSQWLFWYSDKHMHTPNVNYPAGRRRLEPIAVVISATLMGMAAIEVVQKSIE
TLVTGYNGSLPDLDMTPLTIGVLVFAIAIKLVLWSICARIAANSSSADALAQDHRNDVFS
NSVAVTTSLIAHYRRDLWYTDSLGAIAISVYIGFSWLATGKEQVERLIGLGAEPDFIERI
RALVDLHHPLMQSDIVRAYHFGNNYLVELEVILPATMCVREAHDISLALQNKVEELDNVE
RAFVHVDYLARDYDEHKDPTIRRDSR

Gene Sequence

>PYAR_24297
ATGGCCGACGCGCTCGTCACGCTGAAACGCAACGACCGCAAAACGAGCTGCTCGCCGAGC
CCGCACAACTATGGCTCAATCACCAACACCAATGGTAACAACCAGCACAAGAACGACCAC
CGCGTCGAGGTTCTCCGCGACGCCGATGCCGGCAATAAGGGATCGCGCCGCGACCGCCGC
TCGCAGGTCGCCCACGCGCTGCTGCGTAACCAGAGCGCGACAGAGCTGCAGCACATGGCG
CCAGCGGCATCCGCCAAAGTGCAGACCGCAATTCGTGCCTCACTCGTGATCAACGTGATC
CTCGCCGTGGCCAAAACGTACGCGGCCTTTGCGAGTGGCTCCCTGGCCGTCCTCTCGTCG
CTCGTGGATTCAATTCTCGACCTCACGTCGCAGTGGCTCTTCTGGTACTCAGACAAGCAC
ATGCACACGCCCAACGTCAACTACCCCGCCGGACGGCGCCGTCTCGAGCCCATCGCCGTC
GTCATCTCGGCAACGCTGATGGGCATGGCCGCTATTGAAGTAGTCCAAAAGTCTATTGAG
ACGCTGGTCACGGGCTACAATGGGTCGCTGCCGGATCTCGACATGACGCCGCTCACGATC
GGCGTGCTGGTGTTTGCGATCGCGATCAAGCTCGTGCTGTGGTCCATCTGCGCGCGCATC
GCGGCCAACTCTTCGTCGGCCGATGCGCTCGCACAGGACCACCGCAACGACGTCTTTAGC
AATTCGGTCGCCGTCACGACGTCGCTCATCGCCCACTACCGGCGCGACCTATGGTATACC
GACTCGCTGGGTGCGATCGCCATCTCGGTGTACATTGGCTTTAGCTGGCTCGCCACGGGG
AAGGAGCAGGTCGAGCGGCTCATCGGCTTGGGTGCGGAGCCCGACTTTATCGAGCGGATC
CGAGCGCTTGTGGATCTCCACCACCCGCTCATGCAGTCGGATATCGTGCGCGCGTACCAT
TTCGGCAACAACTACCTCGTGGAGCTCGAGGTCATTTTGCCCGCGACCATGTGTGTGCGC
GAGGCCCACGACATTAGCTTGGCGCTCCAGAACAAAGTCGAAGAGCTCGACAATGTCGAG
CGTGCGTTTGTCCACGTCGACTACTTGGCGCGCGACTACGACGAGCACAAGGACCCGACG
ATCCGTCGCGATTCCAGGTAG

Amino Acid Properties