Error loading sequence information for PYAP_24883 - InterProScan visuals disabled

Py. aphanidermatum: PYAP_24883

Location

scaffold_1234

2185 - 5242 (-)

Protein Sequence

>PYAP_24883
MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD
ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL
QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLLQPAGQF
PVTGLSFTSKPISNTVAHVFLYASTRRGLTCYHCNHDDPALVKAAGAAGLPSRTVVLDER
GVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRG
RHQVNVYDLQNKFIAFNWSLTQTASRNGGMRRPPLPTNNRAPGARFGLDDMEEIRHVVCC
VYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSL
RQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVK
KLDNFIQLDENTDKLNGETKGIAAVANGGTSNDKAHENGGKTGMNFDIETAISVLWENYP
QHALILAKKHEEHSWYLKIQLDRISYVESEDSVGLSASEQERVADALEYIQHLSFSEADA
NLRKYGRTLVTHLPGPTTDLLKRLCTGKFVPGNPSLKSDPADFLHLFVSHREQLKEFLQY
IVEVETVTNPLIGNTLLEMVLSDDGDTKLSDAEREDAVMAILDNPRVRYDEDHALIHLQM
RGMKKGKRYLYNKLHLYHMLVQFHIEENDDQAIIDEVRKHGEKDPNLWSLALKYFAERGP
LPKGVKAGEEWKDLKQLLALIDTNPVIPPLQVVHVLSQSRELPVSVVKQYIVNQLVSDEK
KIEEDEEKIKTYKADTKQMKEEIAQLNSRAVVFQATKCELCNHDLDLPAVHFMCKHSFHL
NCISETERECITCSLDHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFGKGIF
KTDIAAEDDSAFDARFSAEF

Gene Sequence

>PYAP_24883
ATGAGCGCCAACCGAGGCATGCTCTGTGTGGGTGATGCCGATGGCTTCGTCCATCTCGCC
AACCGACAGCTTGAAGCGCGCAAGTTCCGTGCACACGAGCACTTTGTGTCGCACATCGTT
ATGATGAAACGCAGCAACGTTCTGGTAACCATTGGTGACGGCATTGATCCCCGTAGCGAC
GAGCTGCGTGAACAATCACGTGCTATAGCGGAGGCGGGGCGGGCAGCTGGAGCCGCGGGT
GCTGGAGCCGCGACGGCCGATGATATGTTCACGCGAAGTGCTGACAGCGGCAAGAGCACA
GCAGTTGTGCGCATCTGGCGTACAGACCAGCAAGACCGTGACGGACGGCCGAAGCTTCTT
CAGCAGGTGCCAGTCTTTGCGAAGAAATACCCGGAGGAGGCCGTCACAGCCTTCGCTGTG
AGCGATGACATTGGTCAGTTCGCCGTTGGTCTTCGCAATGGTGCTGTTATCCTTTTTAGA
ATTGACTTGAAGCGACGTGCTGAGCGGCCACCACAGCTCCTCCAGCCTGCTGGTCAGTTT
CCTGTCACTGGCCTGTCGTTTACAAGCAAGCCTATCAGCAACACGGTTGCACACGTATTC
TTGTATGCGTCCACACGACGAGGGCTCACCTGTTACCACTGCAACCACGATGATCCTGCA
CTCGTAAAGGCTGCCGGCGCCGCTGGGTTGCCATCTCGTACTGTTGTACTGGATGAACGT
GGGGTGGATCATCACTGCTCGTGTGTGAATGACGAAGGCGAGATTGCAGTTGGTCAAGTG
GACGCAGTATACTTTTACAATAATGAAGACCGCTCTGTTTGTTTTGGTTTTGAAGGCGAA
AAGAAGTATTTGCAGTTCTTCAAGCATTATCTTCTTGTTGCACACGTTGATCCACGAGGC
CGGCACCAAGTTAATGTGTACGATCTTCAAAACAAGTTCATTGCGTTCAACTGGTCGCTC
ACACAAACTGCGAGCCGTAACGGAGGAATGCGTCGTCCACCACTCCCAACGAACAACCGA
GCACCTGGTGCGCGTTTCGGCCTCGACGACATGGAAGAGATTCGACATGTGGTTTGCTGT
GTGTATCGACTCACTGAGAAGGATACCACTTCGAAACTCGAGATCTTGTTCCGTAAAAAC
CTCTATTCGATCGCCATCTCGTTGGCATTCAGCTCAAACTACGACATCAACAGCATCATG
GACATCTTCCGTATGTACGGCGATCATTTGTACGAAAAAGGCGATTTCGATGGTTCACTG
CGTCAGTATGCTCGTACGATCGGTCATGTCGAACCGTCTTATGTGATTCGCCGATTCTTG
GATGCGCAGCGAATCCACAACCTCACTGCCTATCTTGAAGCTCTTCACGAAAAGGCCTTC
GCTAATGCTGAACACACGACGTTGCTTCTCAACTGTTACACCAAGCTCAAAGATGTCAAG
AAACTGGACAACTTCATTCAATTGGATGAAAACACGGACAAGCTGAATGGTGAAACGAAG
GGTATTGCCGCTGTTGCGAATGGTGGTACGTCCAATGACAAAGCGCATGAAAATGGCGGC
AAGACAGGAATGAACTTTGATATTGAAACTGCCATCTCGGTTCTTTGGGAGAACTACCCG
CAGCACGCTTTGATCCTGGCGAAAAAGCACGAAGAGCACAGCTGGTATCTGAAGATCCAA
CTTGATCGTATCAGCTATGTCGAGTCTGAAGATTCTGTTGGCCTCTCTGCGAGTGAACAA
GAACGTGTTGCTGATGCTCTCGAGTATATCCAGCATCTGAGTTTCTCTGAAGCGGATGCC
AACTTGCGCAAATATGGTCGAACTCTCGTTACGCACTTACCCGGCCCCACTACAGACCTC
CTAAAGCGCCTGTGCACGGGCAAGTTTGTGCCAGGCAACCCATCGCTTAAGTCGGATCCA
GCAGATTTCCTGCATCTCTTCGTCTCTCATCGTGAACAGTTGAAAGAATTCCTTCAGTAC
ATTGTCGAAGTCGAGACTGTCACGAATCCTTTGATTGGCAACACGCTGTTAGAAATGGTA
TTGAGTGACGATGGTGACACTAAGCTGAGTGATGCTGAGCGTGAAGATGCTGTCATGGCT
ATTCTCGACAATCCTCGTGTTCGCTACGACGAAGACCACGCGCTGATTCACCTGCAGATG
CGAGGCATGAAGAAGGGCAAACGCTACTTGTACAACAAACTGCATCTATATCACATGTTG
GTACAGTTCCACATCGAAGAGAACGACGATCAGGCGATTATCGACGAAGTCCGAAAGCAT
GGCGAGAAGGACCCAAATCTTTGGTCGCTTGCTCTAAAGTACTTTGCCGAGCGTGGGCCA
CTCCCCAAGGGTGTCAAGGCTGGAGAAGAGTGGAAAGACCTGAAACAACTACTTGCCTTG
ATCGACACCAATCCCGTCATTCCACCGCTGCAAGTTGTTCATGTCTTGAGCCAATCGCGG
GAGTTGCCTGTTTCTGTGGTTAAGCAGTATATTGTGAATCAGCTTGTGAGCGATGAGAAG
AAGATCGAAGAAGATGAAGAGAAAATAAAAACATACAAGGCTGACACGAAGCAAATGAAA
GAAGAGATTGCCCAGCTCAATAGCCGGGCAGTGGTCTTCCAGGCGACAAAATGCGAGCTT
TGCAACCACGACCTCGATCTTCCAGCCGTTCATTTCATGTGCAAGCACAGTTTCCACCTC
AACTGTATCTCCGAGACTGAACGCGAATGCATCACATGCTCACTGGATCACCGCCACATC
ATGGGACTGAAGACTCAGTTGGAGCAGAAGGCAGGGAACCACGAACAGTTCTACAACCAA
CTTGAGACGGCTGCTGATGGTTTCCAAACCATCGCGGAGTACTTCGGAAAAGGCATTTTC
AAGACCGACATTGCAGCAGAAGATGACAGTGCTTTCGATGCACGTTTCAGTGCCGAGTTC
TAA

Amino Acid Properties