Error loading sequence information for PYAP_22844 - InterProScan visuals disabled

Py. aphanidermatum: PYAP_22844

Location

scaffold_641

2116 - 2745 (+)

Protein Sequence

>PYAP_22844
MVRVKVRVFTFPSNPREQNSYIGGLLPTVGALKLENDELTSITFSQLRPRIELRDDDGMI
RRSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIEVCSTSIFAPLTKY
LATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQGCERCPPVTKNP

Gene Sequence

>PYAP_22844
ATGGTCCGTGTCAAGGTCCGAGTGTTCACGTTCCCGTCCAACCCGCGCGAGCAAAACTCA
TACATCGGCGGATTGTTACCCACAGTAGGCGCGCTCAAGCTTGAGAATGATGAGCTCACT
AGCATTACGTTCTCACAATTGCGTCCTCGTATCGAATTACGTGATGATGACGGCATGATC
CGTCGTAGCCCCATGTTTCAAGAAGTCTTATCAATCATTTCGGCGTCACCCAATCCGCAT
CGATGGCCCGCAAGTGCACTGCAGACGTACTGGTTTGGCTACTTTACCGACATGGATCAG
ACTGTGCCACATTCCATCGAAGTATGCTCCACTTCGATCTTTGCTCCACTTACTAAGTAT
CTGGCAACTGACGAGTATCCTAATGAGGAAGATGCTCCGATCAGCAAGTACCTTGATATG
ACCACGTCCAAGCTAACGGGCGACCTCATTTTGATCCCGCAGACGCAGTTCGGTCCCGTG
TGCGAGGCGTGCTGCCAGGGCTGCGAGCGCTGCCCGCCTGTGACCAAGAACCCG

Amino Acid Properties