Error loading sequence information for PPTG_10245 - InterProScan visuals disabled

Ph. parasitica: PPTG_10245

Location

scaffold_19

240753 - 243194 (-)

Protein Sequence

>PPTG_10245
MEVESTQVRPDGKKLIDVTLRRQGMPPQQAPLVVPQFDDDDDSSSSDDEPAIESLFQSSL
SKKQYTSGSSNNNDEDNHDENTGEQQKLFQGEIQWDRVQEIQELTNADTTLTSEIRDLRQ
QVKALQIQLEAQAPVPGLDVDAVQDILLEKDNLDHDVRDVKIVHQAKTLRSLKRQLQREK
QLAMDATKQSQALQAANKQLEEEVDTLKLKLQRFQARVAAEKANNNGAVNQPQLPESPSS
DTNSDGGSLKKLVDELKSKNTALQQELKKTQRALVREVGEDVPLEEIVGNTDNAASGASR
RGRAQQIIMLKTKVKKLQTRLATMRPGTTSPDPHDLGNVLDVDQRAQQDLSGQQMHRQKL
LDQLTTQRDELQERLHRLTRNYDALKARAQILDREKHETRDKFQVLVDKSRTDDALVDAL
QRQLETWKTKLHDARRARTADSSKCTSQDERVELERLRKIVAEHKSRGGDRSTGAMPQPS
EISQYRAIAVEKERLTEVVRSLKAQVEDKDKQLRSLQESHSSSDLLQATPPSPSLPPIGD
ESVSRLPRRPSRIPLPSGGPPPPSAVIMEQQQQQLKHEMETLCKTFRETVREKDERIAEL
EQHRQSTAQSSTTGTDVNAMSQQLRELQEENDFLRQEFDKLKTRYEALTKPPASVSRKKS
RSKEK

Gene Sequence

>PPTG_10245
ATGGAAGTGGAGAGCACCCAAGTGCGTCCCGATGGCAAAAAGTTGATTGACGTCACCCTG
AGACGACAAGGGATGCCACCTCAACAGGCACCACTGGTTGTTCCTCAATTCGATGATGAC
GACGACAGCAGTAGCTCTGACGACGAGCCAGCGATTGAATCTTTATTTCAGAGCTCGCTA
AGCAAGAAGCAGTACACGAGTGGAAGCAGCAACAACAATGACGAGGACAATCATGACGAG
AACACTGGAGAACAGCAGAAACTTTTCCAGGGCGAAATTCAGTGGGACCGTGTGCAAGAG
ATCCAGGAACTAACAAATGCCGACACGACGTTGACTTCGGAAATACGTGACCTTCGGCAA
CAAGTGAAAGCCCTGCAGATCCAGCTAGAGGCACAAGCACCAGTGCCAGGACTAGACGTC
GACGCAGTTCAAGACATTCTGCTTGAGAAAGACAACCTTGATCATGATGTTCGAGACGTG
AAGATCGTCCATCAGGCTAAGACTCTGCGGTCTTTAAAGCGTCAGTTACAGCGTGAAAAA
CAACTAGCAATGGATGCAACCAAGCAGTCCCAAGCACTTCAAGCAGCCAATAAACAGCTT
GAGGAAGAGGTTGACACACTTAAGCTGAAGTTGCAGCGTTTCCAGGCTCGAGTTGCCGCA
GAAAAGGCCAATAACAATGGTGCAGTTAACCAACCTCAGCTACCCGAGTCCCCGTCCAGT
GATACCAACAGTGACGGTGGATCGTTGAAGAAACTCGTTGACGAACTAAAGTCGAAAAAC
ACTGCGTTGCAACAGGAACTCAAAAAAACTCAACGTGCATTGGTGCGAGAGGTTGGAGAA
GACGTGCCACTTGAAGAAATTGTTGGAAATACAGACAACGCCGCTAGCGGAGCAAGTCGA
CGTGGCCGCGCCCAGCAGATTATCATGCTCAAAACTAAAGTGAAAAAGCTGCAGACTCGA
CTCGCTACCATGAGACCTGGAACCACTTCACCGGATCCACATGATTTAGGAAACGTACTG
GATGTTGATCAACGTGCACAGCAAGATCTGTCCGGTCAGCAAATGCACCGACAGAAACTG
TTGGACCAGCTCACAACTCAACGTGATGAACTACAGGAGCGTCTCCACCGTTTAACTCGA
AACTACGACGCACTCAAGGCACGCGCACAGATTCTTGATCGAGAAAAGCATGAAACACGT
GACAAGTTCCAGGTATTGGTGGATAAATCACGCACCGACGACGCCCTTGTTGACGCTCTT
CAACGCCAACTGGAGACGTGGAAGACGAAGTTGCATGATGCGAGACGCGCTCGGACTGCA
GACAGCTCCAAATGTACCAGCCAAGACGAGCGGGTTGAGCTGGAAAGACTCCGCAAAATC
GTCGCTGAACACAAAAGCAGAGGCGGTGACAGATCAACTGGTGCAATGCCACAGCCAAGC
GAGATTTCACAGTACCGCGCAATAGCCGTGGAAAAGGAGCGCCTGACTGAGGTAGTTCGC
AGCTTGAAAGCGCAAGTCGAAGATAAGGATAAACAGCTACGAAGCCTGCAGGAATCGCAC
AGCAGCTCTGATCTACTGCAAGCTACGCCGCCATCTCCGTCGTTGCCACCTATCGGAGAT
GAAAGCGTTTCGCGTCTTCCGCGGCGGCCTAGTAGAATCCCATTGCCAAGCGGGGGCCCC
CCTCCTCCATCTGCAGTTATAATGGAGCAACAACAGCAACAACTCAAACACGAAATGGAG
ACACTTTGCAAAACATTTCGAGAGACCGTGCGGGAAAAGGACGAGCGCATCGCTGAACTC
GAGCAGCATCGACAATCTACGGCTCAATCCAGCACTACCGGTACGGATGTGAATGCGATG
AGCCAACAACTACGGGAGCTTCAAGAAGAGAACGACTTCCTACGACAGGAGTTTGACAAG
CTGAAGACCCGCTACGAAGCTCTAACAAAACCTCCTGCCTCAGTTAGCAGGAAGAAAAGC
AGATCGAAAGAGAAGTGA

Amino Acid Properties