Error loading sequence information for PPTG_10183 - InterProScan visuals disabled

Ph. parasitica: PPTG_10183

Location

scaffold_19

40528 - 45947 (-)

Protein Sequence

>PPTG_10183
MSSEAAATALKSRAEVQLLNSLNQKKASSMSSEAAATALKSRAEVQLLNSLNQKKASSTS
LYLKEEQLKAEDEEDSQQTQARNRISFEAMSACSEEARMISEVRQLEDDFFIVGAENNQK
LLQTQPEGPSQIELNAVRRRDRHMEAQMQYGEEVKAISEDVEVAIIRAADHVKEVLATVD
LAIQEAKSALTNNELLLASDNYKILRMWSELDAVCQRRTDEIAQFAAQLEEIEQSRINRI
RMGLQRLTCVLMETAHALPPEVERIIEAEAYEVNTVVISNRRVYADLVARMETANVDVFL
NARLAWEQGQIRWRHLRHEDVIAKFQATLNSPLFTDPEERQQLLEQIRVFQERIHDEQRL
AVLKQLKDAGASLTSDQAKRFLEELSCTQQFEEEKNQSFFSELRGLHESKDDAAKGLREA
LRLELHGFGAMAKEGAIAEAKKTLLTLLSDDSMEDFFRAAGGLKVELDTLAKQLCIADLI
YNSNLEPVVSSVGILLSSLPLANVMEKQGKEAERKAVQSTLDKVRKATKGEIMSLLPSLQ
TQISMLMNLEEMSDKFKAELGDIAAQLDTIIREYGSIQDNEASNSSAISTITSLMGASND
KRPPSVAAPASVKSTTKIPATITTTSLSKGKTIDISQNNGNAVDLQAIRKVQRSLGTLLY
ASELGLPWQEHLHFIADQLQLQTNANRIVDEVITKECNALIETRQQESRLLVEEMGKRME
QQSAQLHDHVEKLARFFLRVVLCLEESVDKVQYVNLSVMDLLDTLKDNDEDALADLETKL
TQSSARLRHSPNSNVLREEFQRSSDLLMHIEGEYRTYDKRVSLAADNNVVAIDKQRLLYL
QRLCDFFGLHQTNQPQGDDSFNLDYFLSAQHIDIPISVVNPVPQEKTSNSIVEAWTGEPP
PASDEPEPPEKEIFRTTSGLEMVVVLSLTGLAQNILIQSEEEDTEQQLVEEVGPTDPSSS
EQNTPRDDKLSSRTNEENTTEFEPQSSRSLEQTVLEKVQTEFLVLSVPSNTVESLLATFR
DAILSKYDSDATTTATQTEETRDERHASSSMLLEERLRVHWPRKGRLDVQFYQPRMGELL
NHQQRQERHLRGVWLKVDEQQAAFAKKVEEALAHVEQTRVTQINFQAQLPLQQSLAALQG
LEVKTKKRLGVFKGEAMEILAALQAMTASDINSLLSSCQDYIRACSSQLFPDLTSTEIIT
GCDYHPEEISAIKEKLAAVEAQTRDQISEREKQIDEISSKQGQILDMWEAFKTRSQMCMQ
SLAMKEGLGQKFGLPRRTAQERYRSEMTRCEARSAAINTLLASLVSLVDEGKSGGHSESL
LNEQDLTRDVLSKLMQLRAKIYHRGMYFGFLRSPSQLELKPAEFNPATGREEEMIRDHEV
VDEEDRVLAVPFLEFAGQVSAKCQEETKALYQHEGKNEELPPSGVPAVLEEYLSGQLEKA
RAFVMLQEMSYREQVDLFADLLTLAPGVVARNLAEQAKLEMRRKISEMVSAFESQYQSWM
DLKNRHTLELRPHLCSPNNVHLLKELEEREKARSTSTQVALYNLRSQFLAEQIQISLAFE
ARLIGLCQCLMLLLDSSVLSLDDLKPFSGEELPKRKRKSLKRLRKVARVNEFGDSREVKR
TAAELQKLTQGGETPRFPLRSWTGIPSFGVQSLWEEVKADIQAKDLARQSPESVVQHDTS
VQDLICLPLASNDGACVALLTPAHRALIRARDSAYTDYMIFCREETRRFLDNLHERIEDE
VKWMLSWEKGISNMRQQLPI

Gene Sequence

>PPTG_10183
ATGTCGTCGGAAGCAGCTGCCACGGCGCTCAAGTCTCGAGCAGAGGTGCAGCTCCTGAAC
TCTCTTAACCAGAAGAAAGCGAGCTCCATGTCGTCGGAAGCAGCTGCCACGGCGCTCAAG
TCTCGAGCAGAGGTGCAGCTCCTGAACTCTCTTAACCAGAAGAAAGCGAGCTCCACGTCG
CTGTATCTCAAGGAAGAGCAGCTGAAAGCAGAAGATGAAGAGGATTCACAACAAACTCAA
GCGCGGAATCGAATCTCCTTCGAGGCAATGTCAGCGTGTAGCGAGGAAGCCCGGATGATC
TCGGAGGTCCGGCAGCTGGAGGACGATTTCTTCATCGTAGGCGCCGAGAACAACCAGAAG
CTGCTTCAAACCCAGCCAGAAGGTCCCAGTCAGATCGAATTGAACGCTGTTCGTCGTCGT
GATCGCCACATGGAGGCTCAGATGCAGTACGGAGAAGAAGTTAAGGCCATTAGCGAGGAC
GTGGAAGTCGCGATCATCCGAGCAGCTGATCACGTCAAGGAAGTACTTGCCACAGTCGAT
TTGGCGATCCAGGAGGCAAAATCAGCGCTTACGAACAACGAGCTGTTGCTGGCGTCTGAC
AATTACAAAATCCTGCGGATGTGGAGCGAGTTGGACGCTGTTTGCCAGCGGAGAACGGAC
GAGATCGCACAGTTCGCTGCTCAACTAGAAGAAATTGAGCAATCTCGCATCAATCGGATA
CGCATGGGCCTGCAACGATTGACGTGTGTGTTGATGGAGACAGCACACGCTCTGCCGCCT
GAAGTGGAGCGTATCATCGAAGCCGAGGCGTATGAAGTGAATACCGTAGTGATCTCTAAT
CGCAGAGTGTATGCAGATCTGGTGGCCAGGATGGAGACGGCCAATGTCGATGTCTTCCTG
AACGCCAGACTCGCGTGGGAACAGGGTCAGATACGCTGGCGTCACTTACGGCACGAAGAT
GTGATTGCCAAGTTCCAAGCCACACTCAACTCCCCTCTGTTCACAGACCCAGAGGAGCGA
CAGCAGTTACTTGAGCAGATTCGAGTTTTCCAAGAGAGAATTCACGACGAGCAGCGTCTA
GCGGTTCTGAAGCAGTTGAAGGATGCTGGAGCTTCTCTCACTTCGGACCAAGCGAAACGT
TTCTTGGAGGAGTTGAGTTGTACGCAGCAGTTTGAAGAAGAGAAGAACCAGTCCTTCTTT
TCTGAGTTGAGAGGACTCCATGAGTCCAAAGATGACGCTGCTAAGGGCCTAAGAGAGGCT
CTGCGCTTGGAACTTCACGGCTTTGGAGCTATGGCGAAGGAAGGAGCGATTGCAGAGGCC
AAGAAAACTCTACTCACGCTGCTCAGTGACGACTCGATGGAAGACTTTTTTCGTGCTGCT
GGCGGCTTGAAAGTCGAGCTCGATACTCTGGCGAAGCAGCTTTGCATCGCAGACCTCATT
TACAACTCAAACCTGGAGCCAGTCGTGAGTTCTGTGGGAATCCTGTTGAGTTCGCTACCA
CTGGCAAATGTGATGGAGAAGCAAGGCAAAGAGGCGGAGCGGAAGGCAGTGCAGTCAACA
CTCGATAAGGTCCGCAAGGCCACCAAAGGCGAGATTATGTCGCTGTTACCCAGTCTGCAG
ACTCAAATCTCGATGCTCATGAACCTCGAGGAAATGAGCGACAAGTTTAAAGCTGAACTT
GGTGACATTGCAGCCCAATTGGACACAATTATCCGCGAGTACGGCTCTATTCAAGACAAT
GAAGCATCAAATTCATCAGCAATTAGCACGATCACTTCATTAATGGGAGCTTCAAATGAC
AAGCGTCCTCCGTCCGTAGCTGCCCCAGCGAGTGTCAAGAGTACGACAAAGATCCCTGCA
ACAATCACTACGACATCGCTTTCTAAGGGCAAGACAATTGATATATCTCAAAACAATGGT
AACGCTGTTGATCTCCAGGCGATTCGAAAGGTGCAACGAAGTCTCGGTACGCTTCTGTAT
GCGTCTGAACTGGGCTTACCCTGGCAGGAGCATTTGCATTTCATCGCCGACCAGCTCCAG
TTGCAGACTAATGCTAATCGTATCGTGGATGAAGTCATTACTAAAGAATGTAACGCTCTA
ATTGAAACGCGACAACAAGAGAGTCGACTGCTAGTGGAGGAAATGGGGAAGCGGATGGAG
CAGCAGAGCGCACAGCTGCACGATCATGTCGAGAAGCTCGCAAGGTTTTTCCTTCGAGTG
GTGCTTTGTCTCGAGGAAAGTGTTGATAAGGTTCAGTACGTCAACTTGAGTGTGATGGAT
CTCCTGGACACACTTAAAGACAACGATGAAGACGCTCTGGCTGATCTGGAGACCAAGTTA
ACGCAGAGCTCCGCACGTCTTCGACACTCGCCAAATAGCAACGTTTTACGTGAGGAATTC
CAGCGTTCGTCGGATCTCTTGATGCACATTGAAGGAGAGTATCGGACCTATGACAAGCGC
GTGTCTCTGGCTGCAGATAACAATGTCGTCGCGATCGACAAACAGCGACTGCTGTATCTT
CAGCGTCTCTGCGACTTCTTTGGGTTACATCAGACAAATCAACCCCAGGGTGATGACTCG
TTTAACCTAGACTACTTCCTCAGCGCGCAACATATTGATATCCCCATATCGGTGGTTAAT
CCAGTTCCTCAAGAGAAAACGAGCAACAGCATTGTCGAGGCTTGGACTGGAGAGCCCCCG
CCTGCGTCTGATGAGCCAGAGCCCCCAGAAAAGGAAATATTTCGAACGACATCGGGCCTC
GAGATGGTTGTCGTTCTCTCTCTTACCGGCCTTGCTCAGAACATCTTAATACAAAGTGAA
GAGGAGGACACGGAGCAACAATTGGTAGAGGAAGTTGGACCAACTGACCCTTCTTCTAGT
GAGCAAAACACACCCCGTGATGATAAACTAAGTTCACGTACGAATGAAGAGAACACGACG
GAATTTGAGCCACAAAGTTCACGATCGCTAGAGCAAACTGTACTGGAGAAAGTTCAAACG
GAGTTCTTGGTACTGAGTGTCCCCAGTAACACTGTTGAGAGCCTGCTAGCCACTTTTCGA
GACGCTATTTTATCCAAGTATGACTCGGACGCGACAACTACTGCCACTCAGACGGAAGAA
ACTCGTGATGAACGCCACGCGAGCTCTTCAATGCTCCTCGAGGAGAGACTGCGTGTTCAC
TGGCCACGCAAAGGAAGACTGGACGTGCAGTTCTACCAGCCTCGAATGGGGGAGCTTTTG
AATCACCAGCAACGACAAGAGCGGCATCTGCGTGGAGTCTGGTTAAAGGTGGATGAACAG
CAAGCAGCATTCGCGAAGAAAGTGGAGGAAGCTCTTGCACACGTGGAGCAGACCCGAGTG
ACGCAGATCAACTTTCAAGCTCAGCTTCCCCTTCAACAAAGCCTGGCAGCTCTTCAGGGC
CTGGAAGTGAAGACCAAGAAGCGTCTCGGAGTCTTTAAAGGCGAAGCGATGGAGATCCTG
GCTGCACTTCAAGCAATGACAGCTAGTGATATCAACAGCTTATTATCGTCGTGTCAAGAC
TATATCCGCGCTTGTTCGTCTCAACTTTTCCCCGACTTGACGAGCACTGAGATTATCACT
GGATGCGATTACCACCCCGAGGAGATCAGTGCGATCAAGGAAAAACTCGCTGCTGTTGAA
GCTCAGACTCGGGATCAAATATCCGAGCGAGAGAAGCAAATTGATGAGATTAGTAGCAAG
CAGGGCCAAATTCTGGACATGTGGGAAGCGTTCAAGACGAGGTCTCAGATGTGTATGCAG
AGTTTGGCTATGAAAGAAGGACTTGGGCAGAAGTTCGGCCTTCCTCGGAGAACAGCTCAA
GAGCGCTATCGGTCTGAAATGACGAGGTGTGAAGCACGTTCTGCTGCGATTAATACGCTC
TTAGCGTCACTTGTATCGTTAGTCGACGAAGGGAAAAGTGGCGGACATTCGGAATCACTG
CTCAATGAGCAGGACCTTACACGTGATGTGTTATCTAAGCTGATGCAGCTCCGTGCGAAG
ATTTATCATCGAGGAATGTACTTTGGATTCTTACGATCTCCTAGCCAACTGGAACTCAAG
CCAGCTGAGTTTAATCCAGCAACAGGGAGAGAAGAGGAAATGATACGTGACCACGAAGTA
GTGGACGAAGAGGATCGAGTGCTAGCGGTTCCTTTCTTAGAGTTTGCCGGTCAAGTGAGC
GCTAAATGCCAAGAAGAAACGAAGGCATTGTACCAGCACGAAGGGAAAAATGAAGAGCTC
CCGCCGTCGGGTGTACCCGCAGTTTTGGAGGAATATCTGTCCGGTCAACTGGAAAAGGCT
CGGGCGTTCGTGATGCTACAAGAAATGTCGTATCGAGAGCAAGTGGATTTGTTCGCAGAT
CTGTTGACTCTTGCACCGGGAGTCGTTGCGAGAAACTTGGCGGAGCAGGCAAAGCTAGAA
ATGCGGCGAAAGATTTCCGAAATGGTCTCAGCGTTTGAGTCTCAATATCAGTCGTGGATG
GATCTCAAAAACCGTCATACATTAGAGCTGCGACCGCATCTCTGCAGTCCTAACAACGTT
CACCTTCTAAAAGAGCTGGAAGAGCGTGAAAAAGCGCGCTCGACGTCAACTCAAGTTGCT
CTGTACAACCTTCGAAGCCAGTTCTTGGCGGAGCAGATTCAGATCTCGTTGGCGTTCGAA
GCGAGACTGATTGGACTCTGTCAGTGCCTGATGCTGCTGCTGGACTCGTCGGTGCTGTCG
CTGGACGATCTGAAGCCATTTTCAGGCGAGGAACTGCCGAAGCGTAAGCGCAAGTCACTG
AAACGACTGCGCAAAGTGGCTCGAGTGAATGAATTCGGCGATTCTCGCGAAGTGAAACGA
ACTGCTGCCGAGCTGCAGAAATTGACTCAAGGCGGCGAGACTCCGCGCTTTCCGCTGCGG
TCGTGGACTGGCATTCCTTCGTTTGGAGTGCAGTCACTCTGGGAAGAGGTGAAGGCGGAT
ATTCAGGCCAAGGATTTGGCAAGACAGTCCCCTGAATCTGTTGTACAACATGACACTTCC
GTCCAAGATTTGATCTGTTTACCTCTGGCATCCAACGACGGCGCATGTGTTGCCCTTCTC
ACCCCTGCACACCGAGCACTCATTCGAGCACGAGATTCTGCCTACACCGATTACATGATC
TTCTGTCGCGAGGAAACGAGACGGTTTCTAGACAATCTCCACGAACGAATTGAGGACGAA
GTCAAGTGGATGCTGAGCTGGGAAAAAGGGATATCGAACATGAGACAGCAATTGCCAATA
TGA

Amino Acid Properties