Error loading sequence information for PPTG_09255 - InterProScan visuals disabled

Ph. parasitica: PPTG_09255

Location

scaffold_17

721424 - 724758 (-)

Protein Sequence

>PPTG_09255
MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ
AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRSPNAEEMYTSKPSGKS
TAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
RSDLKRRADRPPHLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDDP
ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPMRKPPLASNA
RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKSDSDSGDLT
PRNGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDSAAL
SESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTTELLKRLCTGKFVPGNPS
LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSDDDEEEGGTRSVE
EKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQS
ILEEVRKHGEKDPNLWSLALKYFAERGPLPKGATGGEEWKELKQLLALIDTNPAIPPLQV
VQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRAVV
FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAG
NHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVVLDEGSFETRFSAEF

Gene Sequence

>PPTG_09255
ATGGCGCAGTGGAGACGCTTCGCGTTCTTCGACAAGGAGGTTCTCAAGGATGCAAATGGG
CCATGGATGAAGGGAGTCGACATCACGAGTATGAGTGCCAATCGAGGGCTCATCTGCGTA
GGAGACGCTGACGGTTTCGTGCACTTGGCCAACCGCTCACTGGAGGCCCGTAAGTTCCAA
GCACACGAGCTGTTCGTGTCACACGTCGTCATGATGAAACGCAGCAACGTCCTAGTGACA
ATCGGTGACGGCATTGACCCGCGACCGGATGAGCTGCGCGAACAGTCCAAGGCCATCGCT
GAAGCTGGCCGATCACCGAACGCCGAAGAAATGTACACTTCCAAACCATCAGGGAAGAGT
ACAGCAGTGGTGCGTTTCTGGCGCACAGACCAGCAAGACCGAGAGGGCAAGCCCAAGTTA
TTGCAACAGATTCCTGTTTTCGCCAAGAAATACCCGGAGGAGGCAGTCACAGCGTTCGCA
GTGAACGACGACTTGAGTCAATTTGCAGTAGGACTGAAGAACGGCGCCGTGATCTTGTTC
CGCAGCGACTTAAAGCGTCGTGCTGACCGTCCCCCTCATCTCCTGCAACCTGCTGGCCAG
TATCCAGTCACTGGACTGTCCTTCACCAGTAAACCGGTCACGGCGACTGTATCTCACGTG
TTTTTGTATGCCTCTACTCGACGAGGACTCACGTGTTACCACTGCTCGCACGACGACCCT
GCCTTGGTGAAGAGTGCTGGTGGAGCTGCGGCTCTCCCACCACGTACGACGGTGCTGGAT
GAACGTGGCGTGGATATGAACTGCTCGTGTGTGAACGAGGAAGGAGAGATCGCTGTGGGC
CAGACAGATGCTGTGTACTTCTACACAACTGAAGATCGCTCGGTGTGTTTCGGCTTTGAA
GGCGAGAAGAAGTATTTATGCTTCTTCAAGCATTATCTTCTGGTAGCACACGTGGATCCG
CGTGGACGACATCAAGTGAATGTGTACGATCTGCAGAACAAGTTCATTGCGTTTAACTGG
ACTTTAACCAGCACAAACCCCAAGGGGCCGATGCGTAAGCCACCGCTCGCATCAAACGCC
AGAGCCCCCGGTGCACGTTTCGGATTGGATGAAATGGAAGAAGTTCGTCACGTGGTGTGT
GAATTCGGCGCTATCTTCGTGGTGTCTTCTATGGGTCATGTATACCGCTTAAGCGAGAAG
GATACGACGTCCAAGTTGGAGATTTTATTCCGCAAGAACCTGTATTCGATCGCTATTTCG
TTGGCCTTCAGCTCCAACTACGATGTCAACAGTATCATCGACATCTTCCGCATGTATGGA
GACCATTTGTACCAGAAAGGAGACTACGATGGATCGTTGCGTCAATATGTGCGTACAATT
GGTCATGTCGAGCCATCGTACGTGATTCGTCGCTTCCTGGACGCACAACGTATCCATAAC
CTCACAGCTTATCTCGAAGCTCTTCACGAGAAGGCTTTCGCTAACGCCGAGCACACGACG
CTATTGCTGAACTGCTACACGAAGCTGAAGGATGTCAAGAAGCTGGATAAATTCATCCAA
CTGGACGAGGTGATCGACGCCAAGAAAACGAAAAGTGACAGTGATTCCGGTGATTTAACG
CCCAGGAACGGAGCCGCAGCCAATCTGAACTTCGACGTGGAGACTGCCATCAGTGTGTTA
TGGGAGAATTATCCGCAACACGCGTTGACGCTGGCGAAGAAACATGAAGAACACAGTTGG
TACTTGAAGATTCAACTGGATCATATCAGCTACGTCGACTCAGAGGACTCTGCTGCGTTG
TCAGAGAGCGAGAAGGAACGTGTGGCTGATGCATTGGAGTACATCGAGCATCTGAGCTTT
TCGGAAGCCGATTCGAACTTAAGGAAGTATGGACGTACTTTGGTTACACACATGCCAGCC
CCCACGACGGAGCTGTTGAAGCGTCTATGTACTGGGAAGTTCGTGCCGGGTAACCCGTCG
TTGAAGTCGGACCCGGGCGATTTCCTCCACTTGTTTGTGTCGCATCGCGCTCAACTCAAG
GAATTCCTGCAGTATATTGTGGAGGTGGAGACGGTGAGCAACACATCGATCGGTAACACG
TTACTGGAGATGGTTTTGAGTGACGATGACGAGGAAGAAGGCGGAACTCGCTCGGTGGAG
GAGAAGGAAGAAGCGGTGCTGCGTATTCTGGACAACCCTCGCGTTAAGTACGATGAAGAC
CATGCGCTGATTCACTTGCAGATGCACGGCATGAAGAAGGGCAAGCGCTATCTGTACAAC
AAGCTGCACATGTACCACATGTTAGTGCAGTTCCACATCGAGGAGAATGATGATCAGAGT
ATTCTTGAAGAGGTCCGTAAACACGGAGAGAAGGACCCAAATCTCTGGTCGTTGGCCTTG
AAATACTTCGCAGAACGAGGACCTTTACCCAAGGGAGCTACCGGTGGAGAAGAGTGGAAG
GAACTGAAGCAATTGCTGGCTCTTATTGACACGAACCCAGCGATTCCTCCACTTCAAGTT
GTGCAGGTGTTGAGTCAGTCCAGGGAGCTGCCGGTGTCGGTGATCAAGCAGTATGTGGTG
AACCAGCTGGCTAGTGACGAGAAGAAAATTGAAGAAGACGAGGAGAAGATCAAGGCGTTT
AAGGGTGACACGAAGCAGATGAAGGAGGAGATTGCCCAACTCAGTAGTCGCGCTGTGGTC
TTCCAGGCCACAAAGTGCGATCTGTGCAACCACGACTTGGATCTCCCAGCAGTGCACTTC
ATGTGTCAACACAGTTTCCACTTGAACTGCATCTCCGAGACGGACCGGGAGTGTATCACG
TGCTCAATGGACCATCGTCACATTCTGGGGCTCAAGACGCAGCTTGAACAGAAGGCTGGG
AACCACGAACAGTTCTACAACCAATTGGAGACCGCGGCGGATGGCTTCCACACCATCGCA
GAGTACTTTGGCAAGGGAATCTTCAAGAGCAACGAGGTCGTGCTGGACGAGGGATCCTTC
GAGACGCGCTTCAGTGCCGAGTTTTAG

Amino Acid Properties