Error loading sequence information for PPTG_09252 - InterProScan visuals disabled

Ph. parasitica: PPTG_09252

Location

scaffold_17

717636 - 717953 (+)

Protein Sequence

>PPTG_09252
MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI
TELSMYASLHPSLPNWSVEVGRDAIQPPPVHGGVNAKIISGGKKE

Gene Sequence

>PPTG_09252
ATGGCGGAGACAAAGGAGGTGTTGCGCCTGTACCGGCGTATCCTCAAGCTGGCGCAGCGC
TACCCGAGCGTCAAGCGCGAGTCGATCATCCGCGACATTAAGACGGAGTTCCACGCCAAC
AAGAACCTCACGGACGCACAGAAAATCCGCGAAGAGTTGGCGTCAGTACGGGCAGGAATT
ACAGAGCTGTCCATGTATGCGAGTCTGCACCCATCGCTGCCCAACTGGAGCGTTGAGGTG
GGTCGGGATGCGATTCAGCCGCCGCCCGTGCATGGAGGCGTGAATGCAAAGATCATCAGT
GGTGGCAAGAAGGAGTGA

Amino Acid Properties