Error loading sequence information for PHYSO_331766 - InterProScan visuals disabled

Ph. sojae: PHYSO_331766

Location

scaffold_4

4068944 - 4071138 (+)

Protein Sequence

>PHYSO_331766
MRVTRPIIPLTSLAIPTRRIPSRDISWVLFHIRPAATHAHSPGGCAVAELFSHPSRPALS
KPLLSLCIAVAPLKSMVCREDVRAADIEVVDDELDTEDLEAAGCAVCASEAHRPRPPARF
PENRTLRAQYELVSVNNAGLAAHASVLHDRNLALLHRAREDYQAGLVMLEQALLSRARTE
QANVDLEDRVRGLRDQAGRVDAAETQLRVFKASSVEDYHALQDQLAASQAQRDDARAERD
DLCTRLAAAEAALVPVQAQLDAAVTQRDRVRQSVARRERQRDGALAERDQARRDLVALEQ
ERNAVVGERDQARQESLTLEQGRDAAVRERDQARRAQAGVEQQRDALVENLRVTRNSLAQ
SQAETESTRRLNDPLHADIRRVNALLVAHAEELQRETARIRELEETAAAASTTRVVAEAE
TARDQANELQAASRSGQYRTGWLAMRRRSLQRGDTAGAHIRRLSVRVADLADERDLAVRE
RDERAVVWRRMLRDALRSRELAQRVRDDLAGKLANSVSSVGGTIDTADLIRHLEATYAAE
VNAAIPLPPADLAGATPVAVSVASPPVVVAGSSGSAPSSGTVPSSSVLAQQPSSSVGTPA
PVQVPVSPSASSLAPGDLHVEFFATASEPAGFYKG*

Gene Sequence

>PHYSO_331766
ATGCGTGTCACACGGCCCATCATCCCGTTAACCTCTCTGGCCATTCCGACGCGTCGTATT
CCATCCCGCGACATCTCGTGGGTGCTATTCCACATCCGTCCCGCTGCCACGCACGCGCAC
TCCCCAGGTGGGTGTGCCGTTGCAGAACTTTTCTCGCACCCGTCGCGCCCCGCCCTGTCG
AAGCCTCTCCTGTCGCTGTGCATCGCCGTCGCTCCTCTCAAGTCCATGGTTTGTCGCGAA
GACGTACGGGCTGCCGACATAGAGGTGGTCGACGACGAACTCGACACCGAAGACCTCGAA
GCTGCCGGCTGTGCCGTCTGCGCGAGTGAGGCGCACCGCCCTCGTCCCCCTGCGCGTTTT
CCCGAGAATCGGACGCTCCGGGCTCAGTATGAGCTTGTGTCGGTGAACAATGCCGGCTTG
GCTGCTCACGCTTCCGTGTTGCACGATCGGAACCTCGCTCTCCTTCACCGCGCCCGCGAA
GATTATCAGGCGGGTTTGGTGATGCTTGAGCAGGCGCTCTTGTCTCGCGCGCGCACGGAG
CAGGCTAACGTCGACCTCGAAGACCGCGTACGCGGCCTCCGCGATCAGGCCGGACGCGTG
GATGCGGCCGAGACCCAGCTCCGGGTGTTCAAGGCTTCGTCGGTTGAGGATTACCACGCC
CTCCAGGACCAGCTCGCCGCCTCTCAAGCGCAGCGGGACGACGCGCGTGCTGAGCGCGAC
GACCTGTGTACTCGGCTAGCTGCTGCGGAAGCTGCCCTCGTCCCTGTCCAGGCTCAGCTC
GACGCTGCCGTAACGCAGCGAGATCGGGTGCGACAGTCTGTCGCCCGTCGAGAGCGACAA
CGTGACGGCGCCCTCGCCGAACGTGACCAAGCACGTCGGGATCTCGTTGCGCTCGAGCAG
GAGCGTAACGCGGTCGTCGGGGAGCGCGATCAGGCTCGGCAGGAGTCCCTCACTCTGGAG
CAAGGTCGTGACGCTGCAGTCCGTGAGCGCGACCAGGCACGTCGAGCCCAGGCGGGAGTG
GAACAGCAGCGCGACGCTCTGGTTGAGAATCTGCGCGTCACTCGCAACTCGCTTGCTCAG
AGTCAAGCTGAGACTGAGTCCACCCGGCGGCTGAACGACCCGCTGCATGCCGACATCCGG
CGCGTGAATGCGTTGCTGGTTGCCCACGCCGAGGAGCTCCAGCGCGAGACGGCTCGCATA
CGCGAGCTGGAGGAGACAGCCGCGGCTGCCTCGACTACACGCGTGGTCGCAGAGGCAGAG
ACGGCCCGCGACCAGGCTAATGAGCTGCAGGCTGCCTCGCGATCCGGGCAGTATCGCACC
GGCTGGTTGGCCATGCGGCGTCGGTCGCTGCAGCGAGGAGATACGGCCGGCGCGCACATC
CGCCGTCTGAGCGTCCGCGTCGCCGACCTGGCTGACGAACGCGATCTAGCGGTCCGGGAG
CGTGACGAGCGTGCGGTGGTCTGGAGGCGCATGCTTCGAGACGCGCTCCGGAGCCGAGAG
TTGGCTCAGCGCGTGCGCGACGACCTGGCCGGTAAACTGGCCAACTCCGTTTCGTCGGTA
GGCGGTACCATCGACACCGCCGACTTGATCCGCCACCTCGAAGCTACCTACGCAGCGGAA
GTGAACGCTGCCATTCCCCTTCCTCCTGCCGATCTCGCCGGGGCCACGCCTGTGGCTGTG
TCCGTCGCGTCGCCTCCTGTTGTTGTCGCTGGGTCGTCCGGGTCAGCCCCCAGCTCTGGC
ACCGTACCTTCGTCGAGTGTTTTGGCTCAGCAGCCGTCTTCCTCTGTCGGTACTCCGGCC
CCTGTTCAGGTTCCGGTGTCTCCCTCGGCTTCGTCATTGGCTCCCGGCGACCTCCACGTC
GAGTTCTTCGCCACGGCGTCGGAGCCAGCGGGCTTCTACAAGGGCTGA

Amino Acid Properties