Error loading sequence information for PHYSO_315018 - InterProScan visuals disabled

Ph. sojae: PHYSO_315018

Location

scaffold_4

4062550 - 4064834 (+)

Protein Sequence

>PHYSO_315018
MRNNSSRNNSNGGSGRRGPRREQKKNMDYEARVTRNGVSANHLLNFSMPERERHVHHHQK
KKKSSAPRTQSEYLHANYRFVIAPLDPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTC
PICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLQQLQV
PPHVGDDVAFQFLERPKSSMFPQLRVLPPAEAKGDLAGIEATSHSALPSPDAPAFAKRKR
SRKLPRVDDVDATYSRILEATPDYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMR
NTSGRLAKSDDFSHGTYGSNHANNAIGSGSATGVKGKPHQNEGGDAYSFYQIANGTYVVL
HPLNMKCLLKEYSDEHQHELEGDHGDDAHQKELEAAWTPSASSEPLPVDRYHLLPEQIRG
RVLDIEHVVMDEEAQKRYRFLSHLPRFCDFYICELDLTSQLSPSTLNSFRNDLKKRAKQR
KQKQRQQNAPSPSSPIFKSNAAAFSLEQEGMMWPSPYEQALAESLEEFHLTNASSVEFEG
EVHAAATPASPYSDDVGRSFARVTENSGYFPVLGGGPSETRAHVTDPIAFGSPAAWGNPS
TSPPAVAWSSGKGGKKKGAGKKGVSVFSTTQRRSYR*

Gene Sequence

>PHYSO_315018
ATGAGAAATAATAGCAGTCGCAACAACAGCAATGGCGGCTCTGGACGCCGTGGTCCACGT
AGAGAGCAGAAGAAGAACATGGACTACGAGGCTCGTGTCACGCGTAATGGAGTCTCCGCC
AACCACCTGCTCAACTTCTCCATGCCTGAACGCGAGAGACACGTGCACCACCACCAGAAG
AAAAAAAAGAGCTCGGCGCCTCGCACGCAGAGCGAGTATCTGCACGCCAACTACCGGTTC
GTGATCGCACCACTTGATCCGGACGCGGTCGTTCCAACGTGGGATCTGGAGGCACTGACG
GAATGGTCTTCGGTTGAGCAGGTATTGCTGTGGTATGACGTCGAAAGCCCGCAGACCTGC
CCGATTTGTATGGACACGTTCCGTGCACCGAAAATTACCAAGTGCGGCCATATCTTCTGT
TGGCCATGCATCCTGCGCTACCTGTCTATGACGGACAAGTACTGGCGTCGATGCCCGATG
TGCTTTGAGTCCGTTCAAAAGGGGCATCTGCGCAGTGTGCAGCTCCAGCAACTGCAAGTT
CCCCCTCACGTGGGCGATGACGTAGCTTTCCAGTTTCTGGAACGCCCCAAGTCCAGCATG
TTCCCCCAGCTTCGTGTCCTCCCTCCCGCTGAAGCTAAAGGGGATCTAGCCGGGATCGAA
GCTACTTCGCACTCTGCGTTGCCTTCTCCAGACGCTCCTGCATTTGCAAAGCGTAAACGC
TCCCGGAAGCTGCCGCGTGTGGATGATGTCGATGCGACGTACTCGCGCATTCTGGAGGCA
ACGCCTGATTATCTTCGGGAGCTCCTGTACTCGGAGATGCGCGATCTCCAGTCGATGGAT
GCCGAGTTTCGAAGTAGTGGGGACGTTGACAACCTCCCTTTCGTGGAAGAGGCTATGCGG
AATACCTCGGGGCGGCTTGCCAAGAGTGACGACTTCAGTCACGGCACTTATGGCTCCAAC
CATGCCAACAACGCTATCGGTAGCGGTTCAGCTACAGGCGTGAAAGGAAAGCCGCATCAA
AACGAAGGTGGCGACGCGTATTCCTTCTACCAGATCGCGAATGGGACATACGTGGTTCTC
CACCCGCTGAACATGAAGTGCCTGCTGAAGGAGTACTCGGACGAGCACCAGCACGAGTTA
GAAGGCGATCACGGAGATGACGCACACCAAAAGGAGCTGGAAGCTGCGTGGACCCCGTCA
GCGAGCTCGGAGCCGTTACCTGTTGATCGCTACCATTTGCTACCCGAGCAAATCCGCGGA
CGTGTACTGGACATCGAGCACGTGGTCATGGACGAGGAAGCGCAGAAGCGCTACCGTTTC
TTGAGCCACTTGCCGCGCTTCTGCGACTTCTACATCTGCGAGCTCGATCTAACGTCGCAG
CTGTCTCCGTCGACGCTCAACTCGTTCCGCAACGACCTCAAGAAGCGCGCCAAGCAGCGG
AAGCAGAAGCAGAGGCAGCAGAACGCGCCGTCTCCGTCGTCTCCGATCTTCAAGAGCAAT
GCAGCGGCGTTCTCGCTGGAGCAGGAAGGAATGATGTGGCCGTCGCCCTACGAGCAGGCG
CTGGCCGAGTCACTAGAGGAGTTCCATCTCACTAATGCATCGAGCGTCGAGTTCGAGGGT
GAAGTCCACGCAGCGGCCACTCCGGCCTCGCCGTACTCCGACGACGTGGGGAGGTCGTTC
GCCAGAGTGACGGAGAACTCGGGGTACTTCCCCGTGCTGGGGGGCGGACCGAGCGAGACC
AGGGCCCACGTGACGGACCCCATTGCATTTGGATCGCCCGCTGCCTGGGGAAACCCGTCC
ACCAGTCCGCCCGCAGTCGCCTGGAGCTCGGGCAAGGGCGGCAAGAAGAAGGGCGCAGGC
AAGAAGGGCGTCTCCGTGTTCTCGACCACGCAGCGCCGCTCGTACCGCTGA

Amino Acid Properties