Error loading sequence information for PHYSO_315015 - InterProScan visuals disabled

Ph. sojae: PHYSO_315015

Location

scaffold_4

4054303 - 4055119 (-)

Protein Sequence

>PHYSO_315015
MSTSFAIPEVKALVRQPQPQRARAQQLLERLAAAVLPILTKRRFRVRWLLEFFPKDGCLL
GMNVNRGAKIYVRLRPQRSPQSFLPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEM
ESLMVRGLVGEEGAKFADAGAGQRLGGNSAGVPIRVAAVLAAKRREQYHSLLGGETSRRL
GSNTSNGTTSKGAGGCRETTSRQQAL*

Gene Sequence

>PHYSO_315015
ATGTCAACGTCCTTCGCCATCCCCGAGGTCAAGGCGCTGGTCCGGCAGCCACAGCCGCAG
CGCGCGCGGGCCCAGCAGCTCCTGGAGCGCCTCGCCGCCGCCGTCCTGCCCATCCTGACC
AAGAGGCGCTTCCGAGTGCGATGGCTGCTCGAGTTCTTCCCCAAGGATGGCTGCCTGCTC
GGGATGAACGTGAACCGCGGCGCCAAAATCTACGTGCGCTTGAGACCCCAGCGATCGCCC
CAGTCGTTCCTGCCCTATGAGGCGCTGCTGGAGACGCTGCTGCACGAGCTCACGCACATG
GTGCACGGGCCGCACAACCAAGCGTTCTACCAGTATCTGGACGAGCTGAAGCAAGAGATG
GAGTCGCTCATGGTGCGCGGCCTCGTGGGCGAAGAAGGCGCCAAGTTCGCAGACGCTGGG
GCAGGCCAGAGACTTGGTGGGAACAGTGCAGGCGTCCCCATTCGAGTTGCGGCCGTGTTG
GCGGCGAAGCGGAGAGAGCAGTATCACTCGCTGCTTGGAGGCGAGACAAGTCGGCGGCTT
GGGTCGAATACATCGAATGGCACTACGTCGAAAGGTGCTGGAGGCTGCCGAGAGACGACG
TCGAGACAACAAGCACTGTAG

Amino Acid Properties