Error loading sequence information for PHYSO_300767 - InterProScan visuals disabled

Ph. sojae: PHYSO_300767

Location

scaffold_4

4061221 - 4061903 (+)

Protein Sequence

>PHYSO_300767
MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ
TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI
SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ*

Gene Sequence

>PHYSO_300767
ATGGTACGGGTGAAGGTGCGCGTGTTCACGTTCCCGTCGGACCCGAGGAAGCAGAACTCG
TACGTCGTCGGCACCATCGAGGGCGGACTGCTGCCCGTTGTGGGCACGCTCAACCTCGAC
GACAAGGAGGTCGCGACCGTCACCTTCGCGCAGCTGCGGCCGCGCATCGAGCTGCTGCAG
ACCAAAGACGTGATCCGGCGCAGCGTCATGTTCCAGGAGGTCTTGGCGCTCATCGCGACG
TCCGCGAACCCGCACGGCTGGCCGCCCAACGCCATGCAGACGTACTGTTTCGGACACTTC
GCCGACGAGAACGAGGACGTGCCGCACGTCATTGCGGCTGCCGACGAGGACTGCCCCATC
AGCCAGTTCCTGAACATGACGACGTCCAAGCAAACAGGAGACCTCGTCCTCATCCCTCAG
ACGCAGCTCGGTCCTGTGTGCGAGCGCTGCTGCGAAGGCTGCGAGCTCTGTCCGCCCATC
GAAAGCAGCAGCAACCAGTGA

Amino Acid Properties