Error loading sequence information for PHYSO_300766 - InterProScan visuals disabled

Ph. sojae: PHYSO_300766

Location

scaffold_4

4055338 - 4056020 (-)

Protein Sequence

>PHYSO_300766
MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ
TKDVIRRSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIAAADEDCPI
SQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIESSSNQ*

Gene Sequence

>PHYSO_300766
ATGGTACGGGTGAAGGTGCGCGTGTTCACGTTCCCGTCGGACCCGAGGAAGCAGAACTCG
TACGTCGTCGGCACCATCGAGGGCGGACTGCTGCCCGTTGTGGGCACGCTCAACCTCGAC
GACAAGGAGGTCGCGACCGTCACCTTCGCGCAGCTGCGGCCGCGCATCGAGCTGCTGCAG
ACCAAAGACGTGATCCGGCGCAGCGTCATGTTCCAGGAGGTCTTGGCGCTCATCGCGACG
TCCGCGAACCCGCACGGCTGGCCGCCCAACGCCATGCAGACGTACTGTTTCGGACACTTC
GCCGACGAGAACGAGGACGTGCCGCACGTCATTGCGGCTGCCGACGAGGACTGCCCCATC
AGCCAGTTCCTGAACATGACGACGTCCAAGCAAACAGGAGACCTCGTCCTCATCCCTCAG
ACGCAGCTCGGTCCTGTGTGCGAGCGCTGCTGCGAAGGCTGCGAGCTCTGTCCGCCCATC
GAAAGCAGCAGCAACCAGTGA

Amino Acid Properties