Error loading sequence information for PHYRA_81678 - InterProScan visuals disabled

Ph. ramorum: PHYRA_81678

Location

scaffold_62

163894 - 167172 (-)

Protein Sequence

>PHYRA_81678
MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ
AHELFVSHVVMMYTSKPTGKTTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAF
AVNDDLSQFAVGLKNGAVILFRSDLKRRTDRPPHLLQPAGQYPVTGLEFTSKPVTATVAH
VFLYASTRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAV
GQTDAVYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFN
WTLTSTNPKGPMRKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSE
KDTTSKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRT
IGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFI
QLDEVIDARKANGTKSGSDSGDTTPRNGGGGAAANLNFDVETAISVLWENYPQHALTLAK
KHEEHSWYLKIQLDHISYVDSEDSVALSENEKERVADALEYIEHLSFSEADSNLRKYGRT
LVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS
NTSIGNTLLEMVLSDDDEGENGARSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKK
GKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDLNLWSLALKYFAERGPLPKGA
TSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEED
EEKIKAFKGDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE
TDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV
VLDEGSFETRFSAEF*

Gene Sequence

>PHYRA_81678
ATGGCGCAGTGGAGACGCTTCGCCTTCTTCGACAAGGAGGTGCTCAAGGATGCAAGCGGT
CCGTGGATGAAGGGCGTAGACATCACCAGCATGAGCGCCAATCGAGGCCTCATCTGCGTG
GGAGACGCCGACGGGTTCGTGCACTTGGCTAACCGCTCGCTGGAGGCTCGAAAGTTCCAG
GCGCACGAACTGTTCGTGTCGCACGTCGTCATGATGTACACGTCCAAGCCGACGGGCAAG
ACCACAGCAGTGGTGCGCTTCTGGCGCACGGACCAACAGGATAGAGAGGGCAAGCCCAAG
CTGCTGCAGCAGATCCCGGTTTTCGCCAAGAAGTACCCGGAGGAAGCAGTGACGGCGTTC
GCAGTGAACGACGACTTGAGTCAGTTCGCGGTGGGACTGAAGAACGGCGCTGTGATTCTC
TTTCGCAGTGACTTGAAGCGGCGTACGGACCGGCCGCCGCATCTGCTTCAACCTGCAGGC
CAGTACCCCGTGACGGGACTGGAATTCACGAGCAAGCCTGTTACGGCGACGGTCGCGCAT
GTGTTTTTGTATGCGTCCACACGGCGTGGGCTCACGTGCTACCACTGCTCGCACGACGAC
CCCGCGTTGGTGAAGAGCGCCGGCGGTGCTGCTGCACTTCCTCCACGCACGACGGTTCTG
GACGAACGTGGTGTGGACATGAACTGTTCGTGCGTGAACGAGGAAGGCGAGATAGCAGTG
GGCCAAACCGATGCTGTGTACTTTTACACGACTGAAGATCGCTCTGTGTGTTTCGGATTT
GAAGGTGAAAAGAAGTACCTGCGCTTCTTCAAGCACTACCTGTTGGTGGCGCACGTAGAC
CCGCGTGGACGGCATCAGGTGAACGTGTACGACCTGCAGAACAAGTTCATCGCGTTTAAC
TGGACGCTTACAAGTACCAATCCTAAAGGTCCTATGCGCAAGCCGCCGCTTGCGTCGAAT
GCTCGAGCCCCTGGTGCACGCTTTGGACTGGATGAAATGGAAGAGGTCCGTCATGTGGTG
TGCGAGTTTGGTGCCATCTTCGTTGTGTCCTCTATGGGCCATGTGTACCGCTTGAGTGAA
AAGGATACGACGTCCAAGCTGGAGATTTTGTTCCGGAAGAACCTGTACTCGATTGCCATT
TCGCTGGCCTTCAGCTCCAACTACGATGTCAACAGCATCATTGATATCTTCCGCATGTAC
GGAGACCACCTATATCAGAAGGGAGACTTCGACGGATCGTTGCGCCAATACGTTCGAACT
ATTGGTCATGTCGAGCCATCGTACGTGATTCGCCGGTTTCTTGATGCACAGCGTATTCAC
AATCTCACGGCTTACCTTGAGGCCCTCCACGAGAAGGCGTTTGCCAATGCGGAGCACACG
ACGCTGCTTCTCAACTGTTACACAAAGCTCAAGGATGTAAAGAAACTGGACAAGTTCATT
CAGTTGGACGAGGTTATTGACGCCAGGAAGGCAAATGGCACGAAGAGTGGCAGCGATTCT
GGTGATACGACGCCCAGAAACGGTGGAGGTGGCGCGGCTGCTAACCTCAACTTCGATGTC
GAGACGGCAATCAGCGTGTTGTGGGAAAACTACCCGCAGCACGCTCTGACCCTTGCAAAG
AAGCACGAGGAGCACAGTTGGTACTTGAAGATCCAGCTAGACCACATCAGCTACGTTGAC
TCGGAGGACTCGGTTGCGCTGTCGGAGAATGAAAAGGAACGAGTGGCCGATGCTCTTGAG
TACATCGAGCACCTGAGCTTTTCCGAGGCCGACTCGAATCTGCGCAAGTATGGTCGCACC
CTGGTTACTCACATGCCGGGGCCGACAACGGAGCTGCTGAAGCGACTGTGTACAGGAAAG
TTTGTTCCTGGTAACCCGTCGTTGAAATCGGATCCGGGTGACTTCTTGCACCTGTTTGTG
TCGCACCGTGCGCAGCTCAAGGAGTTCCTGCAGTATATTGTCGAGGTGGAGACTGTGAGC
AATACGTCGATCGGCAATACACTGCTGGAAATGGTGCTCAGTGACGATGATGAGGGCGAA
AATGGAGCCCGATCGATCGAGGAGAAGGAAGAAGCTGTGCTGCGCATTCTTGACAACCCA
CGCGTGAAGTACGACGAGGACCATGCGCTTATCCACTTGCAGATGCATGGCATGAAGAAG
GGCAAGCGCTACCTGTACAACAAGCTCCATATGTACCACATGCTGGTGCAGTTCCACATC
GAGGAAAACGACGACCAGAGCATTTTAGAGGAGGTGCGCAAGCACGGCGAGAAGGACCTG
AACCTGTGGTCACTGGCGCTGAAGTACTTCGCAGAGCGAGGACCTCTGCCCAAGGGCGCT
ACGAGCGGTGAGGAGTGGAAGGAGCTCAAGCAACTGCTTGCTCTCATCGATACGAACCCA
GCTATCCCTCCGCTACAGGTGGTGCAAGTGCTGAGCCAGTCACGTGAGCTGCCCGTGTCA
GTGATTAAGCAGTACGTAGTGAACCAGCTGGCCAGCGACGAGAAAAAGATCGAGGAGGAC
GAGGAGAAGATCAAGGCCTTCAAGGGCGACACAAAGCAAATGAAGGAAGAGATTGCGCAG
CTGAGCAGTCGTGCGGTGGTTTTCCAGGCAACAAAGTGCGACCTGTGCAACCACGACCTG
GACCTTCCTGCGGTGCACTTCATGTGCCAGCACAGTTTCCACCTCAACTGCATTTCGGAG
ACGGACCGCGAGTGCATCACGTGCTCTATGGACCACCGCCACATCCTCGGACTCAAAACG
CAGCTCGAGCAGAAGGCTGGCAACCACGAACAGTTCTACAACCAGCTCGAAACCGCTGCA
GACGGGTTCCACACCATCGCGGAGTACTTTGGCAAGGGCATCTTCAAGAGCAACGAGGTC
GTCCTGGATGAGGGCTCCTTTGAGACGCGCTTCAGTGCCGAATTTTAG

Amino Acid Properties