Error loading sequence information for PHYRA_81674 - InterProScan visuals disabled

Ph. ramorum: PHYRA_81674

Location

scaffold_62

157507 - 159745 (-)

Protein Sequence

>PHYRA_81674
MRNNSSRNNSNGGSARRGPRREQKKNMDYEERVTRNGVSANHLLNFTLPERERHVYHHQK
KKKSSAPRTQSEYLHANYRFVISPLEPDAVVPTWDLEALTEWSSVEQVLLWYDVESPQTC
PICMDTFRAPKITKCGHIFCWPCILRYLSMTDKYWRRCPMCFESVQKGHLRSVQLHQLQI
PPHVDSDATFQFLERPKSSMFPQLRALPSAEVEATSRSAIPPPEASAFAERKRSRKLPSI
NDVDATYSRILEATPAYLRELLYSEMRDLQSMDAEFRSSGDVDNLPFVEEAMRNTSGRLA
KSDDFSHGTYGSSHTYNMNSNTPVAKEKPHENASGEAYSFYQIADGTYVVLHPLNMKCLL
REYSDEHQHELEGRHEEDARQKEMEAAWTQEANSSASSELLPADRYHLLPERIHGRVLDI
EHVVMDEEVLKRYRFLSHLPRFCDFYICELDLTSQLSPSTLNLFRNELKKRTKQRKQKQR
QQNATTPSSPIFKSNAAAFSLEQEGMTWPSPYEQAIAESLEEFHLSNSELDSAAVSPDVE
SSFARVTENSGYFPALGGEPRTPVADPIAFGSPAAWGNASTSPPAAAWGSGKGGKKKGAG
KKGVSVFSTTQRRSYR*

Gene Sequence

>PHYRA_81674
ATGAGGAATAACAGTAGTCGCAACAACAGCAATGGCGGCTCTGCGCGTCGCGGTCCTCGT
CGAGAGCAGAAGAAGAACATGGACTACGAAGAGCGCGTCACCCGCAACGGAGTGTCGGCC
AATCACCTGCTCAACTTTACACTGCCGGAGCGTGAGAGGCACGTGTACCACCACCAGAAG
AAGAAAAAGAGCTCGGCACCGCGCACTCAGAGCGAGTATCTCCATGCCAACTATCGCTTC
GTGATTTCACCGCTGGAACCGGATGCCGTTGTGCCGACGTGGGATCTTGAAGCGCTCACC
GAATGGTCCTCGGTTGAACAGGTGCTGCTGTGGTATGACGTCGAAAGCCCGCAGACCTGC
CCGATCTGTATGGACACTTTTCGCGCGCCGAAAATCACCAAGTGCGGCCATATCTTCTGC
TGGCCGTGTATTTTGCGATACCTATCGATGACGGACAAGTACTGGCGTCGCTGTCCGATG
TGCTTCGAATCCGTCCAAAAGGGACATTTGCGCAGTGTGCAGCTTCATCAGCTGCAAATT
CCTCCGCATGTGGACTCGGATGCAACTTTTCAGTTTCTGGAACGTCCGAAATCGAGCATG
TTTCCGCAGCTTCGTGCTCTCCCATCTGCAGAAGTCGAGGCGACTTCCCGCTCTGCAATA
CCGCCCCCTGAGGCTTCTGCGTTCGCCGAACGGAAGCGCTCTCGGAAGCTACCAAGTATA
AATGATGTCGATGCAACGTATTCGCGCATCTTGGAAGCAACGCCCGCGTACTTACGGGAG
CTTTTGTACTCGGAGATGCGCGATTTGCAGTCCATGGATGCCGAGTTCCGAAGCAGTGGC
GACGTAGACAACCTCCCGTTCGTGGAGGAGGCTATGCGGAACACGTCAGGGCGGCTTGCC
AAGAGTGACGACTTTAGTCACGGCACTTATGGCTCTAGCCACACTTACAATATGAACAGC
AACACCCCTGTCGCGAAGGAGAAACCGCATGAAAACGCAAGTGGCGAGGCGTACTCGTTC
TACCAGATCGCGGACGGAACATACGTGGTTCTCCACCCGTTGAACATGAAATGTCTGCTG
AGGGAGTACTCAGATGAGCACCAGCACGAGCTAGAAGGCCGACACGAAGAGGACGCTCGC
CAAAAGGAGATGGAGGCAGCATGGACTCAAGAGGCAAATTCTTCAGCCAGCTCGGAGCTG
TTGCCTGCTGACCGCTACCACTTGCTGCCCGAACGAATCCACGGTCGTGTGCTGGATATC
GAGCATGTGGTCATGGATGAAGAAGTGCTCAAGCGTTATCGCTTCTTGAGCCACTTGCCG
CGTTTCTGCGACTTTTACATTTGCGAGCTCGATCTGACGTCCCAGTTGTCCCCTTCGACG
CTCAACTTGTTCCGAAACGAGCTCAAGAAGCGCACCAAGCAGCGAAAGCAGAAGCAAAGG
CAGCAGAACGCTACGACTCCGTCGTCTCCGATCTTCAAGAGCAACGCAGCAGCGTTTTCG
CTGGAGCAGGAAGGAATGACGTGGCCGTCGCCTTACGAACAAGCGATTGCCGAGTCGCTC
GAGGAGTTTCATCTCTCGAATTCCGAGCTGGACAGTGCAGCAGTCTCCCCAGACGTCGAG
AGTTCGTTTGCTCGGGTAACGGAGAATTCTGGGTACTTCCCAGCTCTCGGAGGCGAGCCC
AGGACCCCCGTTGCCGACCCCATAGCGTTTGGCTCGCCGGCTGCATGGGGAAATGCGTCG
ACCAGTCCCCCCGCAGCGGCCTGGGGCTCCGGCAAGGGCGGCAAGAAGAAAGGAGCAGGC
AAGAAGGGCGTCTCCGTCTTCTCGACCACGCAGCGTCGCTCGTATCGCTAG

Amino Acid Properties