Error loading sequence information for PHYKE_6407 - InterProScan visuals disabled

Ph. kernoviae: PHYKE_6407

Location

scaffold_349

33865 - 37140 (+)

Protein Sequence

>PHYKE_6407
MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ
AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPNAEDMYTSKPSGKS
TAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVILF
RSDLKRRTDRPPHLLQPAGQYPVTGLSFTSKPVTASVSHVFLYASTRRGLTCYHCSHDDP
ALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
GEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTSSKAGMRKPPLAANA
RAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSIAIS
LAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHN
LTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKSGSDSG
MTTPRGAGASNLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDHISYVDSEDS
VALSENEKERVADALEYIEHLSFSEADSNLRNDDDEDGENGKRSIEEKEEAVLRILDNPR
VKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPN
LWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSV
IKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLD
LPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAAD
GFHTIAEYFGKGIFKSNEVLLDEGSFEARFSAEF

Gene Sequence

>PHYKE_6407
ATGGCGCAGTGGAGACGCTTCGCCTTCTTCGACAAGGAAGTGCTCAAGGATGCGAATGGG
CCTTGGATGAAGGGCGTGGATATCACGAGCATGAGCGCGAATCGAGGCCTCATCTGCGTG
GGAGACGCCGACGGTTTCGTACATCTGTCTAATCGATCTCTAGAGGCGCGCAAGTTCCAG
GCCCACGAGCTCTTTGTGTCGCACGTCGTCATGATGCAACGCAGTAATGTTTTGGTGACT
ATTGGTGACGGCATTGACCCGCGCTCGGAGGAGCTGCGAGCGCAGTCCAAAGCTATTGCT
GAAGCAGGAAGAGCGCCGAATGCTGAAGATATGTACACGTCCAAGCCTTCAGGAAAGAGC
ACGGCGGTGGTGCGCTTCTGGCGCACGGATCAGCAGGATAGAGAGGGCAAGCCGAAGCTG
CTGCAGCAGATCCCGATCTTTGCCAAGAAATACCCCGAGGAGGCAGTGACAGCCTTTGCT
GTGAACGACGATCTGAGTCAGTTTGCAGTGGGACTGAAGAACGGTGCTGTGATCCTGTTC
CGTAGCGACTTAAAGCGGCGTACAGACCGGCCGCCCCATTTGCTGCAGCCTGCGGGACAG
TACCCTGTTACGGGACTTTCGTTTACCAGTAAACCAGTTACAGCGTCAGTGTCGCATGTG
TTTTTGTATGCGTCCACCCGGCGTGGACTCACGTGCTACCACTGCTCGCATGATGACCCG
GCGCTAGTGAAGAGTGCTGGCGGTGCGGCGGCACTTCCACCGCGTACTACCGTACTTGAC
GAACGTGGCGTGGACATGAATTGCTCATGTGTGAATGAGGAGGGTGAAATTGCTGTGGGG
CAGACCGACGCCGTATATTTCTACACAACGGAGGATCGTTCTGTTTGCTTTGGCTTCGAA
GGCGAAAAGAAATACCTTTGCTTCTTCAAACACTACCTACTGGTGGCGCACGTGGACCCA
CGTGGGCGACACCAGGTGAACGTGTACGACCTGCAGAACAAGTTTATCGCCTTCAACTGG
ACGCTAACAAACACGAGCTCCAAGGCTGGTATGCGCAAGCCGCCGCTTGCAGCAAACGCT
CGTGCACCCGGCGCACGGTTTGGACTGGACGAAATGGAGGAGGTCCGTCATGTGGTATGC
GAATTTGGCGCCATCTTCGTTGTCTCTTCAATGGGACACGTATACAGATTGAGCGAGAAG
GACACGACGTCCAAGCTGGAGATCCTATTCCGCAAGAACTTGTACTCAATCGCCATCTCG
CTAGCCTTCAGCTCCAACTACGACGTCAACAGCATCATCGATATTTTCCGTATGTATGGA
GATCACCTGTATCAGAAGGGAGACTACGATGGGTCATTACGACAATATGTTCGAACGATT
GGTCATGTCGAGCCGTCATATGTGATCCGCCGCTTCCTGGATGCGCAGCGCATTCACAAC
CTTACGGCTTACCTTGAGGCTCTCCACGAGAAGGCATTCGCGAATGCTGAACACACCACG
CTGTTGTTGAACTGTTACACGAAGCTCAAGGATGTCAAAAAGCTGGACAAATTTATTCAG
CTGGATGAGGTCATCGATGCAAAGAAGACCAATGGTACTAAGAGTGGTAGTGATTCTGGT
ATGACGACACCCAGAGGTGCAGGAGCTTCCAACTTGAACTTTGACGTCGAGACTGCTATT
AGCGTGTTGTGGGAGAACTATCCACAGCATGCGCTAACGTTGGCGAAGAAGCATGAGGAG
CACAGCTGGTACTTGAAGATTCAACTGGATCACATCAGTTACGTGGACTCGGAGGACTCT
GTTGCGCTGTCAGAGAATGAAAAGGAACGTGTGGCTGACGCACTCGAATACATTGAGCAT
CTGAGTTTCTCGGAGGCCGATTCGAACTTGCGAAACGATGACGACGAAGACGGTGAAAAC
GGCAAACGCTCGATCGAGGAGAAGGAAGAAGCCGTGCTACGCATCCTTGACAACCCGCGT
GTGAAGTATGACGAAGACCATGCACTGATTCATTTGCAGATGCATGGCATGAAGAAGGGT
AAACGTTACCTGTACAACAAGTTGCACATGTATCACATGCTGGTGCAGTTTCACATCGAG
GAGAACGACGACCAGAGTATCTTAGAGGAGGTGCGCAAACACGGTGATAAGGACCCGAAC
CTGTGGTCACTGGCACTTAAATACTTTGCGGAGCGTGGTCCACTCCCCAAGGGTGCAACC
AGCGGCGAGGAATGGAAAGAGCTTAAGCAGCTGCTTGCTTTGATCGACACAAACCCGGCG
ATCCCTCCGCTGCAGGTGGTTCAGGTGCTGAGCCAGTCACGCGAGCTACCTGTGTCAGTG
ATCAAGCAGTATGTCGTGAACCAGCTGGCAAGTGATGAAAAGAAGATTGAGGAGGACGAG
GAGAAGATCAAGGCTTTCAAGGGCGACACGAAGCAAATGAAGGAGGAAATTGCACAGCTG
AGCAGCCGTGCCGTGGTTTTCCAGGCGACGAAGTGCGACCTGTGCAACCATGACTTGGAC
CTGCCAGCTGTGCACTTCATGTGTCAGCACAGTTTCCACCTCAACTGCATTTCAGAGACG
GACCGCGAGTGTATCACGTGCTCCATGGACCACCGTCACATCCTTGGACTCAAGACACAG
CTTGAGCAGAAGGCTGGAAACCACGAACAATTCTACAATCAACTTGAAACTGCTGCCGAT
GGGTTCCACACCATCGCCGAGTACTTCGGTAAGGGAATTTTCAAGAGCAACGAGGTGCTA
TTGGACGAAGGCTCCTTCGAGGCGCGTTTCAGCGCTGAGTTTTAG

Amino Acid Properties