Error loading sequence information for PHYKE_10818 - InterProScan visuals disabled

Ph. kernoviae: PHYKE_10818

Location

scaffold_95

7140 - 8384 (-)

Protein Sequence

>PHYKE_10818
MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVISDVGLCITLYDFVSIGDAFVH
PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
DSAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAENEG
VVTAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWTS

Gene Sequence

>PHYKE_10818
ATGTTCGTGCTGACACGCATCTCGGACGTGATTCCGGTGGCCCCGGAGCTATTCGACGCC
GACTACACGCAGGTTCTGGTGGAGGAGATCGACCGCAAGTACGCCAACAAGGTCATATCA
GACGTAGGGCTCTGCATCACGCTCTACGACTTCGTGAGCATCGGCGACGCCTTCGTGCAT
CCGTCCGATGGTACATCGCACTCCCAAGTGGAGTTCCGTATGGTGGTTTTCAGGCCGTTC
GTGGGTGAGGTGCTCAAAGGACGCATCGTGAGCTGCACGGAGGAGCACATCCGAGTGTCC
ATGGACTTTGTACAGGACATCATCATCCCATCCTACGCGCTCCAGACGCCGTCCTATTTT
GATTCTGCGGAGCGGCTGTGGGTATGGAAATACTCGGAGGGACAAGAGAAATTCTACATG
GACCTGCACGAGGAGATTCGCTTTCGCGTGACGAATATCAACTTCACGCGCGTGACCAAA
ACGGCTAAAGGCATTCAAGCCACGACGACGGAGGCCACAGACAAGGCAGAGAACGAGGGT
GTTGTGACTGCCGGTGACATGCGGCAGTCTCTTGCCCGCCGACGGTCATCAAGTGTGGAT
CTATCAGACAATGACCCGACACCGTCGGCTATTCACATTCTCGGAACAATCGATGAGGAC
GGCCTGGGCTTGTCGTCTTGGTGGACGAGTTAA

Amino Acid Properties