Error loading sequence information for PHYCA_60964 - InterProScan visuals disabled

Ph. capsici: PHYCA_60964

Location

scaffold_35

207555 - 208153 (+)

Protein Sequence

>PHYCA_60964
TSYAITEIKALVRQPQREDAQRLLERLAAAVLPIMTRRRFRVRRLLEFFPKDGALLGMNV
NRGAKIYVRLRPQRNPESFYSYEELLGTLLHELTHMVHGPHNQAFYKYLDELKHDMESLM
VRGLVGEEGAKFSEAGEGHRLGGSSVGVPIRVAAVLAAKRREQYHSLLGGETSRRLG

Gene Sequence

>PHYCA_60964
ACATCCTACGCCATCACCGAGATTAAGGCGCTAGTCCGACAACCGCAGCGTGAGGATGCC
CAGCGGCTCCTGGAGCGCCTGGCCGCCGCCGTTTTGCCTATCATGACACGTAGACGCTTC
CGCGTGCGGCGATTGCTCGAGTTCTTCCCCAAAGATGGCGCTTTGTTAGGCATGAACGTG
AATCGAGGCGCCAAAATCTACGTGCGCTTGAGGCCGCAGCGAAATCCCGAGTCCTTTTAC
TCCTATGAAGAACTTCTAGGGACGCTACTGCATGAACTCACACACATGGTGCACGGACCG
CACAACCAGGCCTTCTACAAGTACCTGGACGAGCTCAAACACGATATGGAGTCGCTTATG
GTGCGTGGCTTGGTTGGAGAAGAAGGTGCCAAGTTTTCAGAGGCTGGAGAGGGCCATAGA
CTTGGTGGCTCCAGTGTCGGCGTCCCGATTCGAGTCGCGGCAGTGCTGGCAGCCAAACGC
AGAGAACAGTACCATTCGCTGCTTGGGGGTGAAACTAGTCGCCGTCTTGGT

Amino Acid Properties