Error loading sequence information for PHYCA_535380 - InterProScan visuals disabled

Ph. capsici: PHYCA_535380

Location

scaffold_35

204718 - 205044 (+)

Protein Sequence

>PHYCA_535380
MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI
KELSMYANLHPSLPNWSVEVGRDAIQPPPPVHGGVSAKVVGDGKKESS

Gene Sequence

>PHYCA_535380
ATGGCGGAGACAAAGGAAGTGTTGCGTATGTATCGGCGAATCCTCAAGCTGGCGCATCGC
TACCCGAGCATCAAGCGCGAGTCGATCATCCGCGACATCAAGACGGAATTTCACGCAAAC
AAGAGTCTCACAGACGCACAGAGAATCCGCGAGGAGCTGGCGTCAGTGCGCGCAGGTATC
AAGGAGCTGTCCATGTACGCGAATCTGCACCCGTCGTTGCCCAATTGGAGCGTTGAGGTG
GGGCGTGATGCAATCCAGCCACCGCCGCCTGTTCATGGCGGTGTAAGTGCAAAGGTTGTC
GGTGACGGCAAGAAGGAGAGCAGCTAA

Amino Acid Properties