Error loading sequence information for PHALS_11795 - InterProScan visuals disabled

Pl. halstedii: PHALS_11795

Location

NW_020187475.1

1349329 - 1349880 (+)

Protein Sequence

>PHALS_11795
MAESVKSGVESVDGVTAEIYQVEETLSDETLSKMHAPSKKDHPIATPDVLKEANGILFGI
PTRFGLVPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTMGGGQETTAFTTLTFLTHQG
MTFVPLGYRSKHLLNMDEIHGGSPWGAGTFAGPSGARQPTQLELDVAKAQGESFAVVAKK
LSA

Gene Sequence

>PHALS_11795
ATGGCGGAGTCCGTGAAATCCGGCGTCGAGTCGGTTGACGGCGTCACAGCCGAGATTTAC
CAAGTTGAGGAAACGCTTTCTGACGAGACCCTTAGCAAAATGCATGCCCCGTCCAAAAAA
GACCACCCTATTGCTACCCCGGATGTACTAAAGGAGGCAAACGGTATCCTTTTCGGCATT
CCTACACGCTTCGGTTTGGTTCCTGCACAGGTAAAGGCCTTATTTGACGCTTGTGGAGGT
CTTTGGGCCGCTGGCGCACTAGTTGGCAAGCCTGCGGGGATCTTTTTCAGCACGGGCACC
ATGGGTGGCGGTCAAGAAACTACTGCTTTTACTACATTGACCTTCCTCACACACCAGGGC
ATGACATTCGTTCCGCTGGGCTACCGCAGCAAACATCTCTTGAACATGGATGAGATTCAT
GGTGGTTCCCCATGGGGTGCTGGTACATTTGCCGGTCCATCTGGTGCTCGCCAACCTACT
CAGCTTGAGCTTGACGTGGCGAAAGCGCAAGGTGAGTCTTTTGCTGTCGTAGCCAAGAAG
CTATCGGCTTAG

Amino Acid Properties