Error loading sequence information for PHALS_11564 - InterProScan visuals disabled

Pl. halstedii: PHALS_11564

Location

NW_020187475.1

144948 - 145271 (+)

Protein Sequence

>PHALS_11564
MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI
KELSMYASLHPSQPNWSVEVGRDAIQSQLREGSQVKVVRDGNKAVKK

Gene Sequence

>PHALS_11564
ATGGCGGAAACCAAACAGGTGCTGCGTGTGTACCGGCGTCTGCTTAAGCTAGCGCAGCAT
TATCCGAGCATCAAGCGCGAGGCGATTATTCGTGATATCAAGGAAGAATTTCATGCTAAC
GCGATAATCACAGACGCGCAAAAAATCTGCGAGGCAATGGCATCGGCACATGCAGGCATC
AAGGAGCTGTCAATGTACGCTAGTTTACATCCCTCGCAGCCTAATTGGAGCGTTGAGGTA
GGACGCGATGCGATACAGTCGCAATTGCGTGAAGGATCACAAGTAAAGGTCGTTCGCGAC
GGCAACAAAGCAGTTAAAAAATAA

Amino Acid Properties