Error loading sequence information for HYAP_08501 - InterProScan visuals disabled

Hy. arabidopsidis: HYAP_08501

Location

scaffold_82

17301 - 18359 (+)

Protein Sequence

>HYAP_08501
MRDLQSMDAEFRSSGDIENLPFVEEALQCTSERLAKSADARKNETHRSITIPRVKGELEE
GGSGDAYSFYQIANGTYVILHPLNVKCLLKEFSDQKQPQQQGESINDAHKTDLEAVWIQE
VASSETIRPNRYHLLPERISGRVLDIEHMVMNDEALKRYRFLSHLPRFCDFYICELDLTS
QLSPPTLNAFQNELKKRSKQRKQKLKLHSATTPLSPIAKRDASAFSLEQEGTMWPSPYEQ
ALIESMEDIALDEFSLDTAEQESQSYASVVEEEQQSFERVTENSGLFPALGGASTSDARP
FGSNSIVFGSPSAWGSASSSPPAVAWTPGKKKKGAGKKGVSLFSTTQRRSYR

Gene Sequence

>HYAP_08501
ATGCGCGATCTTCAGTCCATGGATGCTGAATTTCGCAGCAGCGGCGACATTGAAAACCTT
CCGTTTGTGGAAGAGGCTTTGCAATGTACTTCCGAGCGGCTTGCTAAGAGTGCTGATGCT
CGTAAAAACGAAACGCATCGGTCCATCACTATCCCTCGTGTGAAAGGGGAGTTGGAGGAA
GGCGGGAGTGGTGACGCGTATTCGTTCTACCAGATCGCGAATGGGACATATGTGATTCTT
CACCCGTTAAACGTAAAATGTCTACTGAAAGAGTTTTCAGATCAGAAGCAGCCGCAGCAA
CAAGGTGAAAGTATAAACGACGCGCATAAAACGGATTTAGAAGCTGTATGGATCCAAGAG
GTAGCAAGCTCAGAGACCATACGTCCTAATCGTTACCACCTACTACCAGAACGAATCAGC
GGACGTGTATTAGACATCGAGCACATGGTCATGAACGACGAAGCGCTGAAGCGATACCGA
TTTTTAAGCCATTTACCGCGCTTTTGCGATTTCTACATTTGCGAGCTCGACTTGACGTCC
CAGCTCTCGCCTCCGACACTGAATGCGTTTCAAAATGAACTTAAGAAGCGTTCCAAGCAG
CGGAAGCAAAAGTTGAAGCTGCACAGCGCGACGACTCCGTTATCTCCGATCGCTAAACGG
GACGCGTCGGCGTTTTCGCTCGAGCAAGAAGGGACAATGTGGCCGTCCCCATATGAACAG
GCACTGATCGAGTCTATGGAGGATATCGCTCTTGATGAGTTTTCTTTGGATACTGCAGAG
CAGGAAAGCCAATCTTATGCTTCGGTGGTGGAGGAGGAGCAGCAGTCATTTGAGAGAGTG
ACGGAAAACTCTGGATTGTTTCCTGCACTTGGAGGTGCCTCTACGAGCGACGCCAGGCCT
TTTGGCTCAAATTCAATCGTATTTGGCTCGCCGTCTGCGTGGGGTAGTGCGTCCAGCAGT
CCACCAGCAGTAGCATGGACGCCTGGCAAGAAGAAGAAAGGAGCGGGCAAGAAAGGCGTA
TCTCTGTTTTCGACCACGCAGCGCCGTTCGTATCGCTAA

Amino Acid Properties