Error loading sequence information for HYAP_07161 - InterProScan visuals disabled

Hy. arabidopsidis: HYAP_07161

Location

scaffold_59

365674 - 366417 (+)

Protein Sequence

>HYAP_07161
MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH
PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY
DTAEKLWVWKYSDGQGEGVPQTWSRCLAVEKFYMDLHEEIRFRVTNINFTRVTKTAKGEL
VHRALCIM

Gene Sequence

>HYAP_07161
ATGTTCGTGCTCACGCGCCTATCGGACGTGATTCCTGTGGCGCCGTCGCTCTTTGACGCG
GACTATACCCAGGTCCTTATCGAAGAGATCGACCGCAAATACGCCAACAAAGTCATCGCT
GATGTCGGACTATGCGTCACGCTGTACGACTTTGTGCGCATTGGCGACGCGTTCGTGCAC
CCGTCGGACGGCACGTCGCACTCGCACGTGGAATTCCGGATGATCGTCTTCCGTCCGTTT
GTGGGCGAAGTGCTCAAGGGACGGATTGTGGGCTGCACAGACGAGCACATTCGCGTATCC
ATGGACTTTGTGCAGGACATTATCATTCCGTCCTATGCTCTCCAGACGCCGTCGTACTAT
GATACGGCAGAGAAGTTGTGGGTGTGGAAGTACTCAGATGGACAAGGTGAAGGAGTGCCA
CAGACGTGGAGTCGTTGTTTGGCGGTAGAGAAGTTTTACATGGACTTACATGAGGAGATT
CGCTTTCGGGTGACCAACATTAACTTTACGCGTGTGACGAAGACAGCAAAAGGTGAATTG
GTGCATCGAGCGTTATGCATAATGTAG

Amino Acid Properties