Error loading sequence information for H310_07576 - InterProScan visuals disabled

Ap. invadans: H310_07576

Location

scaffold_14

655000 - 656507 (+)

Protein Sequence

>H310_07576
MHAAPSHYGAVSLDIKKAHEASTKHTRSAVSHSLILQQEAGEARCLPEAASQKVQLAITS
SIVINVLLAIAKTYAAVSSGSLAVLSSLVDSILDLTSQALFWFSDRYMHTPNEKYPAGRR
RLEPIAVVVSATLMGMASLEVVQKSVTTLIEGFGGHLPELDMSILTIAVLGVAITVKLML
WFICGQIAYVSPSAAALAQDHRNDVFSNLVAVSTSLMAHYYSGLWYFDPIGAIAISIYIT
LSWVATGKEQVERLVGLQADEDFIERVRAIADAHHPKLQSDIIRAYHFGNNFLVELEVVL
PKDMSVQESHDISLALQIKVEALDEVERAFVHVDYQSRDYDEHKDPTVRLD

Gene Sequence

>H310_07576
ATGCACGCCGCTCCGAGCCACTACGGCGCTGTGTCCTTGGACATCAAGAAGGCGCACGAG
GCCAGCACCAAACACACGCGCTCGGCCGTGTCGCACTCGTTGATCTTGCAGCAGGAAGCT
GGGGAAGCTCGATGTCTTCCCGAAGCAGCCTCGCAAAAGGTGCAGTTGGCTATCACGTCG
TCCATTGTGATCAACGTCCTCCTCGCCATTGCCAAGACGTACGCTGCGGTGTCGAGTGGG
TCACTTGCCGTGTTGTCGTCGCTCGTCGACTCGATCTTGGACTTGACGTCGCAAGCGTTA
TTCTGGTTCTCTGATCGGTACATGCACACCCCAAACGAAAAGTACCCTGCCGGGCGCCGC
CGTTTGGAACCGATTGCCGTCGTTGTCTCCGCCACGTTGATGGGCATGGCGTCCCTCGAG
GTCGTGCAAAAGTCGGTAACTACCCTCATTGAAGGTTTTGGCGGACATCTTCCGGAGCTC
GACATGTCGATTCTCACGATTGCCGTCTTGGGAGTTGCGATCACCGTCAAGCTGATGTTA
TGGTTCATTTGTGGTCAAATTGCATACGTCTCTCCTTCCGCCGCTGCCCTCGCCCAGGAT
CATCGCAACGACGTGTTTTCCAACTTGGTGGCTGTGTCGACGTCGTTAATGGCGCACTAC
TACAGCGGCCTATGGTACTTCGATCCGATCGGTGCTATCGCTATCTCCATCTACATCACG
CTGAGCTGGGTCGCGACCGGGAAGGAGCAAGTCGAGCGCCTGGTTGGCCTGCAGGCCGAC
GAGGACTTTATCGAGCGCGTTCGAGCAATTGCTGACGCCCACCATCCCAAGCTCCAGTCC
GACATCATCCGCGCGTACCATTTTGGCAACAACTTCCTCGTGGAGCTCGAAGTCGTGCTG
CCCAAAGACATGAGCGTGCAAGAATCGCACGACATCAGTCTGGCGCTCCAGATCAAGGTT
GAGGCCCTCGATGAAGTCGAACGCGCGTTTGTGCACGTGGACTACCAAAGCCGCGACTAC
GACGAGCACAAGGATCCGACCGTCCGCCTCGACTAG

Amino Acid Properties