Error loading sequence information for H310_07567 - InterProScan visuals disabled

Ap. invadans: H310_07567

Location

scaffold_14

632501 - 632880 (-)

Protein Sequence

>H310_07567
MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGI
QQLNQYVSLDPNAQHWSVDMEKDPFGQNHPDRPQSLKR

Gene Sequence

>H310_07567
ATGTCGGCATCCCCGACGGTACCGCAGATATACCGCCGCGTGCTGCAGCTGGCAAAGAAA
TTCCCGAGCATCAAACGCGATCAACTCGTCGAGGATATCAAGGCCGAGTTCCACGATAAC
AAAGTGCTTACCGATCCCGTGAAGATCAAGGAGAAAGTAAACATTGCGATCAAGGGCATT
CAACAGCTCAACCAATACGTTTCCCTCGACCCGAACGCGCAGCACTGGTCAGTCGACATG
GAGAAAGATCCTTTCGGGCAGAATCACCCCGACCGGCCGCAATCCCTTAAACGCTAA

Amino Acid Properties