Error loading sequence information for CCI45132 - InterProScan visuals disabled

Al. candida: CCI45132

Location

scaffold_90

16447 - 18240 (+)

Protein Sequence

>CCI45132
MSGNESNSPSSDIGDKNAVSSQDFKVSETLESRTKSSSNIEEDGESDSTDHRIGKSKVPT
YKCSDQEVEQKKEVEKGSTLSSQVIKLKEEIKKHKILLEALAPVPGLDRNILEAVLLEGD
AMNHDLRDVKIVHQAKQLRQLKQLIQKEQRVAHNALNSMKLMEVEKVKMERELEAAHLQI
KKTKFRVESLTLRNGSEVISNNQAEMSPRVSSKRTNSPHAATQRKSSTWRSKYDDLKIHN
DKLQSDMKKLHRALTQELGVDASMPLMELLEMYGPNQSTGSVIGEGGKRTRSQQIIVLKA
KVKELKRRLALERRRTSSISSNLEATNLYEKPGGSIDAKVGSELVKQHEHKQKQLDQLLS
DNEQYRIRVEQLIGKLKASQSRTHILEQERKENKAKIQVLAEKSGTDDKLIDALQAQVSL
WKEKTQKAKRVHTDGNNITGTSTILPSLSTSHSTSPRGHKSQNHSRSHHSSTAEVSIKQV
EMAIPAIPVSETARYRQLHVENERLLCVIRELKKQHVKTDITQSPGTATESRIPRPMESR
EYVDINATKTIEKMRTRFCKPLEETDHENTSLPLAPL

Gene Sequence

>CCI45132
ATGAGCGGGAATGAATCCAATTCCCCGTCTAGCGACATTGGTGACAAAAATGCTGTTTCT
TCCCAAGACTTCAAAGTAAGTGAGACTCTAGAGTCAAGAACGAAAAGCAGCAGCAATATC
GAGGAGGATGGCGAAAGCGATTCTACTGATCATAGAATTGGCAAAAGCAAGGTACCGACT
TACAAATGTTCTGACCAAGAAGTCGAACAGAAAAAAGAGGTGGAAAAAGGTTCTACGTTA
TCGTCACAAGTGATAAAGTTGAAAGAGGAGATCAAGAAACATAAGATACTTCTGGAAGCG
CTTGCGCCTGTCCCTGGTTTGGATAGGAATATTTTGGAAGCTGTACTTCTCGAGGGGGAC
GCGATGAATCATGATCTTCGAGATGTGAAAATCGTCCATCAAGCAAAACAATTGCGTCAA
CTGAAGCAATTGATACAAAAAGAGCAACGAGTCGCACATAATGCTCTCAATTCCATGAAG
TTAATGGAGGTGGAGAAAGTAAAGATGGAGAGAGAGCTAGAGGCTGCTCATTTGCAGATA
AAAAAAACAAAATTTCGAGTGGAGTCTCTGACTTTGAGAAATGGAAGCGAAGTGATTAGT
AACAATCAGGCGGAAATGTCTCCACGTGTCTCTTCTAAACGTACCAACTCGCCCCATGCT
GCTACCCAGAGGAAGTCTTCAACATGGAGATCCAAATATGATGATCTGAAGATACATAAT
GATAAGCTTCAATCCGATATGAAGAAGTTGCATCGGGCGCTTACTCAAGAGTTGGGCGTC
GACGCATCAATGCCTTTGATGGAACTTCTCGAGATGTACGGCCCAAATCAGAGTACAGGA
TCAGTGATTGGTGAAGGGGGGAAGCGAACTCGCTCTCAGCAGATTATCGTACTGAAGGCT
AAAGTCAAGGAACTGAAACGCAGATTAGCTTTGGAAAGGCGTCGTACTTCCAGCATAAGT
AGCAATCTGGAAGCCACAAATCTCTATGAAAAACCTGGCGGAAGCATTGATGCAAAAGTA
GGTTCCGAACTCGTCAAACAACACGAGCATAAACAGAAGCAACTAGATCAATTGCTTTCC
GACAATGAACAGTACCGCATTCGTGTGGAGCAACTTATTGGTAAACTCAAGGCTAGTCAA
TCACGGACGCATATATTAGAACAAGAAAGGAAAGAGAATAAGGCGAAGATCCAAGTTCTG
GCCGAAAAGTCCGGTACGGATGACAAGCTTATCGACGCTCTGCAGGCTCAGGTGTCATTA
TGGAAAGAGAAGACACAGAAGGCAAAACGTGTACATACTGATGGAAATAATATCACAGGC
ACAAGTACAATTCTCCCATCTCTGAGTACATCTCATTCCACAAGCCCTAGAGGACACAAG
TCACAAAATCACAGCAGATCGCATCATTCTAGTACAGCTGAGGTTTCTATAAAGCAGGTC
GAAATGGCTATACCAGCTATACCAGTCTCCGAAACAGCTCGATACCGTCAGCTTCACGTC
GAGAATGAGCGGCTCTTATGTGTTATAAGGGAGCTAAAGAAGCAACACGTCAAAACTGAC
ATCACTCAGTCGCCAGGGACTGCAACAGAATCACGCATTCCGCGCCCTATGGAAAGCCGG
GAATATGTCGACATCAATGCAACTAAAACAATTGAGAAAATGAGGACAAGATTTTGTAAG
CCTTTGGAAGAAACGGATCACGAGAACACGAGTCTTCCGCTAGCTCCACTTTAG

Amino Acid Properties