Error loading sequence information for CCI44232 - InterProScan visuals disabled

Al. candida: CCI44232

Location

scaffold_64

76060 - 76377 (-)

Protein Sequence

>CCI44232
MERAQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIK
ELMMYANLNPVEANWTVEIGRPSEKAADIDQKRVEMKEKRVGVEK

Gene Sequence

>CCI44232
ATGGAACGAGCACAGATTTTCGGGCTTTATCGTCGTATTCTCAGACTTGCTCGACGCTAT
CCGAGCATCAAACGAGATGCGATAGTTGAGGATATACGATTGGAATTCCGAGAAAGTCGA
AACATCGCTAGACCAGCTGCAATTGAGCAGAAAATTGCTTCGGCAAATGCAGGAATCAAA
GAGCTAATGATGTATGCCAATTTGAACCCCGTTGAAGCGAACTGGACCGTTGAAATCGGT
CGACCAAGTGAGAAAGCAGCAGATATCGATCAGAAGAGGGTAGAAATGAAAGAGAAGCGA
GTTGGAGTAGAAAAATAG

Amino Acid Properties