Error loading sequence information for CCI42280 - InterProScan visuals disabled

Al. candida: CCI42280

Location

scaffold_31

125221 - 125823 (-)

Protein Sequence

>CCI42280
MVKIAIIYYSTYGHVARLAETVKEGCELVTGVSADIYQVAETLTDDVLSKMHAPPKKEYP
IATMDVLKDADGILFGFPTRFGLVPAQMKAYFDMAGQLWQSGCTIGKPAGLFFSTGTPGG
GQETTAFTCIPFLTHLGMVFVPLGYRSPLLGNLDEVHGGSAWGAGTLAGPDGSRQPSKLE
LDVAKVQGESFAAVTRKLAA

Gene Sequence

>CCI42280
ATGGTCAAGATTGCAATTATCTATTACTCTACCTATGGACACGTTGCACGCCTGGCGGAA
ACCGTAAAAGAAGGCTGCGAGCTGGTCACAGGCGTTTCAGCTGATATTTATCAAGTCGCT
GAAACACTTACAGATGATGTTTTGTCCAAGATGCATGCTCCACCCAAGAAGGAGTACCCG
ATCGCCACTATGGACGTGCTCAAGGATGCGGATGGAATTCTGTTTGGCTTTCCCACCCGT
TTTGGTCTAGTTCCCGCACAAATGAAAGCTTATTTCGATATGGCTGGACAATTATGGCAG
AGTGGATGCACTATTGGAAAGCCTGCCGGTCTTTTTTTCAGTACTGGAACGCCTGGAGGT
GGACAAGAGACCACTGCTTTCACCTGCATACCATTTCTCACCCATCTAGGCATGGTATTC
GTCCCTCTTGGATATCGCTCCCCGCTTCTCGGCAATCTTGACGAAGTTCACGGAGGAAGT
GCATGGGGCGCAGGGACATTGGCCGGGCCAGATGGAAGTCGTCAACCATCCAAATTGGAG
CTCGACGTAGCCAAAGTACAAGGCGAAAGTTTCGCTGCAGTAACACGCAAACTTGCGGCG
TAG

Amino Acid Properties