Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:4263832436411335011e-55
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:1026341279692973942e-39
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:130980781011241062872e-25
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937848940311184e-09
APIN:H310_12006:H310_12007:scaffold_35:394497:3973081979220079787.7
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= SDRG_01764

Length=1092
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383                  197     1e-55
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634               156     2e-39
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807          115     2e-25
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937                    50.1    4e-09
APIN:H310_12006:H310_12007:scaffold_35:394497:397308                  34.7    7.7  

>SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383
Length=799

 Score = 197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 109/133 (82%), Gaps = 17/133 (13%)
 Frame = +3

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAE--  58
            MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNID+DALQAILERAELDLRSKAE  
Sbjct  243  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDVDALQAILERAELDLRSKAEVR  422

Query  59   ---------------IVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103
                           IVLNGVVN+TMKTLPVIEAPGGGQPSVSKFS+KLAKQRELAD MA
Sbjct  423  PPVSAQAAQQPHAA*IVLNGVVNHTMKTLPVIEAPGGGQPSVSKFSTKLAKQRELADTMA  602

Query  104  RDGSLDDHRTRSS  116
            RD  LD +   +S
Sbjct  603  RDVRLDGYDVGAS  641

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 18/48 (38%)
 Frame = +1

Query  106  GSLDDHRTRSSPVERLRQ------------------QLGQPVVPVERD  135
            GSL+D RTR+SPVERLRQ                  QLGQPVVPVERD
Sbjct  655  GSLEDRRTRNSPVERLRQVAPVRDRRRLILRHVLV*QLGQPVVPVERD  798

>PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634
Length=1315

 Score = 156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 154/297 (52%), Gaps = 67/297 (23%)
 Frame = +1

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43
            M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  127  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANSSPMRHSAVVTTAEVQAFN  306

Query  44   AILERAELDLRSKAEIVLNGVVNNTMK------TLPVIEAPGGGQPSVSKFSS-KLAKQR  96
            AIL+R E +LR+KAE+VLNG+VN++ +       LP +       PS+ + S  + A + 
Sbjct  307  AILQRTETELRAKAELVLNGMVNSSFEPSQSGTVLPAVTV--ANPPSIKRRSGYRRAYKP  480

Query  97   ELADAMARDGSLDDHRTRSSPVERLRQ---------------------QLGQPVVPVERD  135
               DA             S P+E  R+                     Q     V + + 
Sbjct  481  RRTDAS------------SIPMEFFREVNGGVNVVLC*NAILM*SCL*QFRNSSVEIRQS  624

Query  136  RPPG----KRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNL  191
              P     +R +G  +Q GRL++KK T   RLLP VN+ DP AP P+L ++DAK GV NL
Sbjct  625  LMPSPQHWQRHLG--LQHGRLMRKKTTQHCRLLPSVNKADPTAPTPELREEDAKHGVFNL  798

Query  192  VNRGFIPTSADLSLAFTHG--DGIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLK  246
            V RGF+P  ADL+ AF  G  DG+++    R+YDRSEQ  +  P   S+ +N+A+LK
Sbjct  799  VTRGFLPAYADLTPAFASGANDGVMKQRATRIYDRSEQSARPTPITQSTGYNLAALK  969

>PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807
Length=1464

 Score = 115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +3

Query  142   PIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSA  201
             P+ R  + GRL+K K+T   RLLP VN+ DP AP P+L + DAK G+ +L+NRGF+P  A
Sbjct  810   PVQRITK-GRLVKSKMTHHARLLPSVNKCDPSAPPPELFEHDAKSGMFSLINRGFVPVGA  986

Query  202   DLSLAFTHGDG-IIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLK  246
             DL+ AF +  G II+NSK R+Y+R EQP++  PY N S F++ASLK
Sbjct  987   DLTPAFVNSHGSIIKNSKTRIYNRQEQPIRPMPYTNPSGFSMASLK  1124

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%), Gaps = 20/95 (21%)
 Frame = +2

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNI------------DIDALQAILER  48
            MD++ QQ+HVEDVGRILLQ Q++LR MREQ+ ++               D+ A Q IL+R
Sbjct  263  MDQIQQQHHVEDVGRILLQTQEQLRLMREQMASTTAATTPTRFHQTAPADVAAFQEILQR  442

Query  49   AELDLRSKAEIVLNGVVN--------NTMKTLPVI  75
            AEL++R+KAE+VLNG+VN        +T+ TLP +
Sbjct  443  AELEIRAKAELVLNGLVNTSSQAAAASTLSTLPAV  547

>PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937
Length=1113

 Score = 50.1 bits (118),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQV  31
            M++L QQ+HVEDVGRILL  QD+LR++REQ+
Sbjct  940  MEQLQQQHHVEDVGRILLHTQDQLRHLREQL  848

 Score = 35.0 bits (79),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 11/64 (17%)
 Frame = -2

Query  31   VLTSNNIDIDALQAILERAELDLRSKAEIVLNGVV----------NNTMKTLPVIEAPGG  80
             L SNN   + ++ IL+RAE +LR KAE+VL  +V           ++ ++LP +  P G
Sbjct  749  ALLSNNAGAE-IEEILQRAENELRMKAELVLGNLVTSGPAAASATQSSDRSLPSVRQPHG  573

Query  81   GQPS  84
              PS
Sbjct  572  VSPS  561

>APIN:H310_12006:H310_12007:scaffold_35:394497:397308
Length=2811

 Score = 34.7 bits (78),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 8/79 (10%)
 Frame = +2

Query  414   VTTFMARPGQRFKGEDSRHAAAI---LLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTY  470
             ++ + +RP +R K     H A +      S  R H + RRL+ HH H   S    ++RTY
Sbjct  1979  ISCWQSRPTKRLKW----HRAKV*CPRCPSFQRKHFSLRRLQAHHSHKLKSTAWVLWRTY  2146

Query  471   KSVKEIQVKLRLAREADAR  489
             +    IQ+   LA E+ AR
Sbjct  2147  RRRMTIQMYTTLA-ESKAR  2200

Lambda      K        H        a         alpha
   0.320    0.134    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 166016520964

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40