Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:130980785213881835066e-54
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634700978932951e-26
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:1050931171601402e-09
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:722375414932880.027
PYUU:PYU1_G009980:PYU1_G009979:scaffold_2027:104244:1082222320251169920.14
HYAP:HYAP_09436:HYAP_09437:scaffold_101:61070:84016227442290855787.6
APIN:H310_03875:H310_03876:scaffold_6:408258:40896656765330759.9
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PYIW_18793

Length=997
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807          199     6e-54
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634               118     1e-26
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093               58.5    2e-09
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237                    38.5    0.027
PYUU:PYU1_G009980:PYU1_G009979:scaffold_2027:104244:108222            40.0    0.14 
HYAP:HYAP_09436:HYAP_09437:scaffold_101:61070:84016                   34.7    7.6  
APIN:H310_03875:H310_03876:scaffold_6:408258:408966                   33.5    9.9  

>PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807
Length=1464

 Score = 199 bits (506),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 125/183 (68%), Gaps = 10/183 (5%)
 Frame = +3

Query  1     MAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQ  60
             M  HARLLPSVNKCDPSAP PEL E DAK+GM SL+NRGF+PVG DLT AFVNSHG II+
Sbjct  852   MTHHARLLPSVNKCDPSAPPPELFEHDAKSGMFSLINRGFVPVGADLTPAFVNSHGSIIK  1031

Query  61    NHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHK------A  114
             N KTRIY+RQEQPIR +P+TNPSGF++A+LKFDLAA  E R    S   SQ +      A
Sbjct  1032  NSKTRIYNRQEQPIRPMPYTNPSGFSMASLKFDLAAPPE-RASSCSSDESQARNDDVQGA  1208

Query  115   ALAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQ  174
             A   V+G Q      + R+RG NV+TVS QGD  RG  +A +RSA    S      S NQ
Sbjct  1209  AKGDVSGLQ---SVGDERSRGANVITVSLQGDGTRGTLNAALRSATHSGSASFASKSGNQ  1379

Query  175   EAE  177
             E +
Sbjct  1380  EPD  1388

>PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634
Length=1315

 Score = 118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +1

Query  3    QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVN-SHGGIIQN  61
            QH RLLPSVNK DP+APTPEL E+DAK+G+ +LV RGFLP   DLT AF + ++ G+++ 
Sbjct  700  QHCRLLPSVNKADPTAPTPELREEDAKHGVFNLVTRGFLPAYADLTPAFASGANDGVMKQ  879

Query  62   HKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDL  94
              TRIYDR EQ  R  P T  +G+N+A LKFDL
Sbjct  880  RATRIYDRSEQSARPTPITQSTGYNLAALKFDL  978

>PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093
Length=226

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +1

Query  934  GALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNFADVLAAIRALTGGKSAKLEKIRR  993
            GAL FLRTALEV+GREVG  A  +  +S     +GNFA VL+A+RA TGGK  +L K+RR
Sbjct  1    GALAFLRTALEVIGREVG--ATIEMSSSTSRPVSGNFAHVLSAVRAATGGKD-RLGKMRR  171

>PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237
Length=236

 Score = 38.5 bits (88),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +3

Query  965  AETGNFADVLAAIRALT-GGKSAKLEKIRRLR  995
            A +GNFA VL+AIRA T GGK  +L K RRLR
Sbjct  54   AHSGNFAQVLSAIRASTGGGKGDRLGKARRLR  149

>PYUU:PYU1_G009980:PYU1_G009979:scaffold_2027:104244:108222
Length=3978

 Score = 40.0 bits (92),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -1

Query  307   LIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDD  366
             L R+  ++  G+  +R+A + +Q FFR+   +K   + R  LA++  IQ  WR Y SHD 
Sbjct  2511  LARKLFKKIHGEFVRRQATLRLQCFFRVCLARKAAIQLRRRLAAIT-IQCCWRCYQSHD-  2338

Query  367   LKRRIKSQR  375
                R+K QR
Sbjct  2337  ---RVKHQR  2320

>HYAP:HYAP_09436:HYAP_09437:scaffold_101:61070:84016
Length=22946

 Score = 34.7 bits (78),  Expect = 7.6, Method: Composition-based stats.
 Identities = 19/55 (35%), Positives = 26/55 (47%), Gaps = 0/55 (0%)
 Frame = -3

Query  875    SEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCS  929
              S+YI   NVST+     +HTC L G  F ++     VF L  +    + GL   S
Sbjct  22908  SKYILENNVSTLGLFVLYHTCSLDGTTFVMDSVFFFVFYLLVAYAPKIGGLSASS  22744

>APIN:H310_03875:H310_03876:scaffold_6:408258:408966
Length=708

 Score = 33.5 bits (75),  Expect = 9.9, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)
 Frame = -2

Query  364  HDDLKRRIKSQRDQQHAQWEAKMQRLKRDW  393
            HDD  RR+ + + Q HA+WEA  +R +R W
Sbjct  653  HDDPTRRLNTSQKQWHARWEAGGER-RRWW  567

Lambda      K        H        a         alpha
   0.321    0.134    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 150015577716

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40