Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:PHYCA_507519:PHYCA_507521:scaffold_28:279076:2812062812484212117e-16
PHKE:PHYKE_8991:PHYKE_8992:scaffold_386:5416:9948249637164231672e-10
PHRA:PHYRA_77668:PHYRA_77669:scaffold_26:46251:48930945191461375e-07
PHKE:PHYKE_1716:PHYKE_1718:scaffold_178:7550:13768865106871767.9
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PYIR_13418

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHCA:PHYCA_507519:PHYCA_507521:scaffold_28:279076:281206              85.9    7e-16
PHKE:PHYKE_8991:PHYKE_8992:scaffold_386:5416:9948                     68.9    2e-10
PHRA:PHYRA_77668:PHYRA_77669:scaffold_26:46251:48930                  57.4    5e-07
PHKE:PHYKE_1716:PHYKE_1718:scaffold_178:7550:13768                    33.9    7.9  

>PHCA:PHYCA_507519:PHYCA_507521:scaffold_28:279076:281206
Length=2130

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 167/421 (40%), Gaps = 70/421 (17%)
 Frame = -1

Query  326   SSREWAIERFQEWVDSRFNVGV---------DNLLALVGDGGSGKSTLTGALCDKFHDNV  376
             + REW  E FQ WV                   +  +VG  GSGKS++   +     + +
Sbjct  1248  AGREWLFEHFQRWVQGSSMSTSSESTRELYNQRMFWVVGQIGSGKSSVAACMVHSCPE-I  1072

Query  377   VAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LA  432
              A H    + +   S R  +LSL  QL + LP + + L        LEE  P+     L 
Sbjct  1071  AAFHFARQEDEQTHSARRCILSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELV  901

Query  433   RKVLVDPLCALEEPLTAK--VFVFDGIDQC---------------KSKGRND---LLDFL  472
               +L+ PL A+  P   K  V + DG++                   KG ND   L+  L
Sbjct  900   THLLIGPLNAIARPTKYKSLVLLIDGVEWLIPRPASSSLPPLSGNSWKGSNDEECLVSML  721

Query  473   AVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTII--LINDIIG--N  528
               +I  LP WV V + S+  P + +KL      D + +     ND  I   ++  +   +
Sbjct  720   PSLISRLPEWVRVVLLSREDPPVLSKLHAFVPPDITIEQFQQQNDQDIRRYVHHSLSKLH  541

Query  529   FSDKD----------------VPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIP  572
             FSD D                + QA E++ R+S G F +     QA+S        G + 
Sbjct  540   FSDDDFEKASVGIEPSSHRCGMDQAVELIARRSEGLFLYAVNVVQAIS-------EGRLH  382

Query  573   LDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQ  632
             L+ L +LP  +    ++ F   F         +V+P+LE +  AA  P  L T  +  E 
Sbjct  381   LNELAELPVGMGAYLQQFFASHFSD-HDMYKHRVRPVLE-VCCAAYEPLPLATLARVLEW  208

Query  633   FSLSKEDIRTIRRAFVDIIAVNHGTYRI---ETSALFEWLVDPQRAGEQFYVDVSGGMNL  689
                 + D      +   I A N    +I     S++ +W+ D   +G  F+VDV+ G   
Sbjct  207   DVYEQRDAGETLGSLFSIEAGNDPESQILRPFHSSVLDWVQDSNSSG-VFFVDVTSGHER  31

Query  690   L  690
             L
Sbjct  30    L  28

>PHKE:PHYKE_8991:PHYKE_8992:scaffold_386:5416:9948
Length=4532

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 97/423 (23%), Positives = 164/423 (39%), Gaps = 80/423 (19%)
 Frame = +3

Query  328   REWAIERFQEWVDSRFNVGV--------------DNLLALVGDGGSGKSTLTGALCDKFH  373
             REW    FQ WV+   ++G                 +  +VG  G+GK+++   L     
Sbjct  2496  REWLFNIFQRWVEGFPSIGSSSSSSSTTSRELGSQRVFWVVGQIGAGKTSVAARLVQSCP  2675

Query  374   DNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV---  430
             + + A H    + +   + R  +LSL  QL + LP + + L        LEE  P+    
Sbjct  2676  E-IAAFHFAQQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFP  2843

Query  431   -LARKVLVDPLCALEEPLTAKVFVFDGIDQC---------------------KSKGRNDL  468
              L   +LV PL A+  P  + V + DG++                       +SK    L
Sbjct  2844  ELVTNLLVGPLNAIARPSKSLVLLIDGLEWLIPASSSSSPPSLSSLSMSSWKESKEEECL  3023

Query  469   LDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN  528
             +  L  ++P LP WV   + S+  P + ++L      + + +N    ND  I     +  
Sbjct  3024  VSMLPSLVPRLPEWVRFVLLSREDPTVLSRLQPFEPPNITMENFRQENDQDICRFTSLA-  3200

Query  529   FSDKDVPQAR--------------------EILKRKSGGNFTFLDFTKQALSHPGMEEDN  568
             FS  D+ Q                      E++ R+S G F +     QA+       + 
Sbjct  3201  FSKLDLEQTTASKSTASPANSDEVSAHDIVELVTRRSEGLFLYAVNVVQAI-------NE  3359

Query  569   GYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWK-KVQPLLELIVTAASGPYALITEN  627
             G + L  L  LP  +    ++ F   F      ++K +V+P+LE ++ AA  P  L T  
Sbjct  3360  GRLHLHDLAALPVGMGACLQQFFASHFAD--QDLYKLRVRPVLE-VLCAAYEPLPLATLA  3530

Query  628   QAQEQFSLSKEDIRTIRRAFVDIIAVNHG----TYRIETSALFEWLVDPQRAGEQFYVDV  683
             +  E     + D+ T   +   I A +        R   S++ +W+ D   A   F+ DV
Sbjct  3531  RVLEWDVYEQRDVSTTLGSLFYIEAGSSDPESQVLRPFHSSVLDWVQDSTSASA-FFADV  3707

Query  684   SGG  686
             + G
Sbjct  3708  ASG  3716

>PHRA:PHYRA_77668:PHYRA_77669:scaffold_26:46251:48930
Length=2679

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (45%), Gaps = 19/146 (13%)
 Frame = -1

Query  328  REWAIERFQEWVDSRF---------NVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVA  378
            REW  E+FQ WV              V    +  +VG  GSGK+++   +     + + A
Sbjct  519  REWLFEQFQWWVQGSSLSNSSTTTREVSNQRVFWVVGQIGSGKTSVAARMVQSCPE-IAA  343

Query  379  MHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARK  434
             H    + +   SPR  +LSL  QL + LP + + L        LEE  P+     L   
Sbjct  342  FHFARQEDEQTHSPRRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFTELVTH  172

Query  435  VLVDPLCALEEPLTAK--VFVFDGID  458
            +L+ PL A+  P T K  V + DG++
Sbjct  171  LLIGPLSAIARPTTYKSLVLLIDGVE  94

>PHKE:PHYKE_1716:PHYKE_1718:scaffold_178:7550:13768
Length=6218

 Score = 33.9 bits (76),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 36/71 (51%), Gaps = 3/71 (4%)
 Frame = +1

Query  450   KVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSA  509
             KV++ +  ++   +  N LL FL    P++P  VG+ IT      LP   + + L+ FSA
Sbjct  865   KVYIIEQAEKMTVQAANSLLKFLEE--PQVPA-VGILITDNGQAMLPTIRSRSQLVPFSA  1035

Query  510   KNTNYMNDTII  520
              N   M  ++I
Sbjct  1036  LNPEEMLQSLI  1068

Lambda      K        H        a         alpha
   0.318    0.134    0.380    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 107444284324

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40