Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:1026341279812919692e-119
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:130980776212051552694e-23
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:1050931171622133e-19
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:722373149491983e-17
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383243419761408e-08
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937845940321277e-06
PHIF:PITG_12031:PITG_12037:NW_003303738.1:2021009:2090721459144606049890.48
PHIF:PITG_00864:PITG_00865:NW_003303758.1:5152553:516625679994549860.86
PHSO:PHYSO_494226:PHYSO_557030:scaffold_3:350988:35122910324051761.0
PHKE:PHYKE_9688:PHYKE_9689:scaffold_340:12237:197873103328565841.4
PHIF:PITG_09153:PITG_09156:NW_003303745.1:829411:857843272362737948796.3
PYVX:PYVX_13690:PYVX_13697:scaffold_15:21692:2541072464132787.3
SADI:SDRG_06249:SDRG_06250:scaffold_17:166507:1667334521869699.0
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB.intergenic.fasta
           274,424 sequences; 626,110,404 total letters

Query= PHYRA_95901

Length=1075
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634               377     2e-119
PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807          108     4e-23 
PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093               86.7    3e-19 
PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237                    80.9    3e-17 
SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383                  58.5    8e-08 
PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937                    53.5    7e-06 
PHIF:PITG_12031:PITG_12037:NW_003303738.1:2021009:2090721             38.9    0.48  
PHIF:PITG_00864:PITG_00865:NW_003303758.1:5152553:5166256             37.7    0.86  
PHSO:PHYSO_494226:PHYSO_557030:scaffold_3:350988:351229               33.9    1.0   
PHKE:PHYKE_9688:PHYKE_9689:scaffold_340:12237:19787                   37.0    1.4   
PHIF:PITG_09153:PITG_09156:NW_003303745.1:829411:857843               35.0    6.3   
PYVX:PYVX_13690:PYVX_13697:scaffold_15:21692:25410                    34.7    7.3   
SADI:SDRG_06249:SDRG_06250:scaffold_17:166507:166733                  31.2    9.0   

>PHCA:PHYCA_556162:PHYCA_34475:scaffold_84:101319:102634
Length=1315

 Score = 377 bits (969),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 213/291 (73%), Positives = 223/291 (77%), Gaps = 48/291 (16%)
 Frame = +1

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEAN+SPMRHSAVVTTAEVQAFN
Sbjct  127  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANSSPMRHSAVVTTAEVQAFN  306

Query  61   AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGY----  116
            AILQ+TE ELRAKAELVL GMVNSS     +    GT+LP VTVA PPS + RSGY    
Sbjct  307  AILQRTETELRAKAELVLNGMVNSSFEPSQS----GTVLPAVTVANPPSIKRRSGYRRAY  474

Query  117  ----GDASSIPIEFFRE---------------------QFHNSSVEVRQSLMPSPQHWQR  151
                 DASSIP+EFFRE                     QF NSSVE+RQSLMPSPQHWQR
Sbjct  475  KPRRTDASSIPMEFFREVNGGVNVVLC*NAILM*SCL*QFRNSSVEIRQSLMPSPQHWQR  654

Query  152  HLGIQHGRLLRKKTTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------  202
            HLG+QHGRL+RKKTTQHCRLLPSVNK DPTAPTPELREEDAKHGV NLVTR         
Sbjct  655  HLGLQHGRLMRKKTTQHCRLLPSVNKADPTAPTPELREEDAKHGVFNLVTRGFLPAYADL  834

Query  203  ----SSGTKDGSGVMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLR  249
                +SG  D  GVMKQRATRIYDRSEQ AR TP TQSTGYNLAALKFDLR
Sbjct  835  TPAFASGAND--GVMKQRATRIYDRSEQSARPTPITQSTGYNLAALKFDLR  981

>PYUU:PYU1_G001735:PYU1_G001734:scaffold_2037:1308343:1309807
Length=1464

 Score = 108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 88/155 (57%), Gaps = 25/155 (16%)
 Frame = +3

Query  129   EQFHNSSVEVRQSLMPSP-QHWQRHLGIQHGRLLRKKTTQHCRLLPSVNKVDPTAPTPEL  187
             ++F NS+VE    L P+P    QR   I  GRL++ K T H RLLPSVNK DP+AP PEL
Sbjct  762   QRFQNSAVE----LKPTPFSPVQR---ITKGRLVKSKMTHHARLLPSVNKCDPSAPPPEL  920

Query  188   REEDAKHGVLNLVTRS----------SGTKDGSGVMKQRATRIYDRSEQPARATPFTQST  237
              E DAK G+ +L+ R           +       ++K   TRIY+R EQP R  P+T  +
Sbjct  921   FEHDAKSGMFSLINRGFVPVGADLTPAFVNSHGSIIKNSKTRIYNRQEQPIRPMPYTNPS  1100

Query  238   GYNLAALKFDL-------RSTGTGKNDRSNDDMEG  265
             G+++A+LKFDL        S  + ++   NDD++G
Sbjct  1101  GFSMASLKFDLAAPPERASSCSSDESQARNDDVQG  1205

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            M+++QQQHHVEDVGR+LLQTQEQLR+MREQM +  AA                A+V AF 
Sbjct  263  MDQIQQQHHVEDVGRILLQTQEQLRLMREQMASTTAATTPTRFHQ-----TAPADVAAFQ  427

Query  61   AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRS  114
             ILQ+ E+E+RAKAELVL G+VN+SS A    +   + LP V  ++ P+TR ++
Sbjct  428  EILQRAELEIRAKAELVLNGLVNTSSQAAAASTL--STLPAVVSSSSPTTRKQN  583

>PHCA:PHYCA_34475:PHYCA_511415:scaffold_84:104867:105093
Length=226

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 53/62 (85%), Gaps = 7/62 (11%)
 Frame = +1

Query  1013  GALAFLRTALEVIGREVGATIEM--ATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKM  1070
             GALAFLRTALEVIGREVGATIEM  +TSRPVS   GNFA VLSAVRA+TGG   DRLGKM
Sbjct  1     GALAFLRTALEVIGREVGATIEMSSSTSRPVS---GNFAHVLSAVRAATGG--KDRLGKM  165

Query  1071  RR  1072
             RR
Sbjct  166   RR  171

>PHKE:PHYKE_8394:PHYKE_8395:scaffold_98:72001:72237
Length=236

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  1026  GREVGATIEMATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLR  1074
             GRE GATIEMA SR  S  +GNFAQVLSA+RASTGGGKGDRLGK RRLR
Sbjct  3     GREAGATIEMAASRSHSAHSGNFAQVLSAIRASTGGGKGDRLGKARRLR  149

>SAPA:SPRG_06353:SPRG_06354:scaffold_24:425584:426383
Length=799

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 17/76 (22%)
 Frame = +3

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    +V A  
Sbjct  243  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDVDALQ  371

Query  61   AILQQTEVELRAKAEL  76
            AIL++ E++LR+KAE+
Sbjct  372  AILERAELDLRSKAEV  419

>PYAR:PYAR_13581:PYAR_13570:scaffold_29:14824:15937
Length=1113

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
            ME++QQQHHVEDVGR+LL TQ+QLR +REQ++
Sbjct  940  MEQLQQQHHVEDVGRILLHTQDQLRHLREQLS  845

>PHIF:PITG_12031:PITG_12037:NW_003303738.1:2021009:2090721
Length=69712

 Score = 38.9 bits (89),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  912    ASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960
              ++ S +  N  RSG+  AA+     A+    + AG+PRC VVC+Y+ HP
Sbjct  45914  STKSTMQLNCHRSGTDAAAEEHPFWATKPDQSRAGSPRCCVVCTYLLHP  46060

>PHIF:PITG_00864:PITG_00865:NW_003303758.1:5152553:5166256
Length=13703

 Score = 37.7 bits (86),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +1

Query  912  ASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960
            ++NS +  N  R G+  A++     A+    + AG+PRC VVC+Y+ HP
Sbjct  799  SANSTMQLNCHRFGTDAASEEHPFWATKLAESCAGSPRCCVVCTYLLHP  945

>PHSO:PHYSO_494226:PHYSO_557030:scaffold_3:350988:351229
Length=241

 Score = 33.9 bits (76),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 7/51 (14%)
 Frame = +1

Query  498  HVPSLSLDEHSRLSAENFAVQQNLQLTRICA--AALDSHVDLLVYVSPFEL  546
            H  +L+    SR SA++FA+QQNL  T IC+  +A+D      V  +PF+L
Sbjct  103  HQSTLNYPPTSRQSAQSFAIQQNLLPTSICSRTSAVDD-----VATAPFQL  240

>PHKE:PHYKE_9688:PHYKE_9689:scaffold_340:12237:19787
Length=7550

 Score = 37.0 bits (84),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = -3

Query  362   PLA-YVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATT  420
             PLA +VD + L     + Q    K  LLA I NEE ++ VL+R G +Y+  D+  R +  
Sbjct  3285  PLAPFVDKEVLARQIQSLQS--CKQSLLAEIKNEEHILHVLKREGSQYE--DQIDRLSVN  3118

Query  421   IQACV  425
             IQAC+
Sbjct  3117  IQACL  3103

>PHIF:PITG_09153:PITG_09156:NW_003303745.1:829411:857843
Length=28432

 Score = 35.0 bits (79),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = -1

Query  913    SNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960
              +NS +  N  RSG+  A++     A+    + AG+ RC VVC+Y+ HP
Sbjct  27379  ANSTMQLNCHRSGTDAASEEHPFWATKLAQSRAGSSRCCVVCTYLLHP  27236

>PYVX:PYVX_13690:PYVX_13697:scaffold_15:21692:25410
Length=3718

 Score = 34.7 bits (78),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 55/132 (42%), Gaps = 8/132 (6%)
 Frame = +3

Query  217  ATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDDMEGNREHID----G  272
            +TR    S +  R TP  +     +    F L +  TG+     + + G+R H+      
Sbjct  72   STRKRHYSTRAERRTPVCRLAPLAVVVHSFSLVAASTGRGQNL*ELLAGHRAHLQVPARA  251

Query  273  EISDEDQGGADNDKD-EEAEMEEL--GANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTP  329
             +   D    D + D  +A +  L  GA +D I     LLDA +LH  ++  G+ + D P
Sbjct  252  VVVHHDAVRVDGEHDVADALLARLAHGARID-IHAPAQLLDAVALHLQVVDVGQRLGDVP  428

Query  330  EFVSFRRVAQEL  341
                 R V Q L
Sbjct  429  LPHIVRAVRQRL  464

>SADI:SDRG_06249:SDRG_06250:scaffold_17:166507:166733
Length=226

 Score = 31.2 bits (69),  Expect = 9.0, Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 33/69 (48%), Gaps = 11/69 (16%)
 Frame = +3

Query  371  LLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSI  430
            L+   A   P   +S +  C +  +  M++ + P Q YKGRD+K       Q CVR  S+
Sbjct  45   LIGTVANAPP---QSAISKCNLKVQSQMAISKAPSQTYKGRDKKG------QECVR--SV  191

Query  431  RRRYVRSRA  439
               Y+  +A
Sbjct  192  SHTYIPRKA  218

Lambda      K        H        a         alpha
   0.320    0.134    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 163511788860

  Database: OGOB.intergenic.fasta
    Posted date:  Sep 16, 2018  4:46 PM
  Number of letters in database: 626,110,404
  Number of sequences in database:  274,424

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40