Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHSO:scaffold_1279913027996211645317e-62
PLHA:NW_020189861.1184554418460801794804e-55
PHCA:scaffold_84998271001441063056e-47
HYAP:scaffold_591899761905662004171e-46
PHRA:scaffold_56151668151955962772e-45
PHKE:scaffold_986680566987612317e-44
PHIF:NW_003303697.14304384307851163236e-34
PYAP:scaffold_16219066195841742804e-28
PHPA:scaffold_63250492250749902771e-27
PYVX:scaffold_275269730561201836e-27
ALLA:FR8240811015491020341652109e-19
PYUU:scaffold_203713064911306640501532e-17
SADI:scaffold_42052472056901511834e-15
ALCA:scaffold_801810818386961269e-14
APAS:scaffold_12706702706833441122e-11
APIN:scaffold_20401149401292481091e-10
PYIW:scaffold_963987510033551314e-08
PYAR:scaffold_291733217544711235e-07
SAPA:scaffold_243933393937881561102e-05
HYAP:scaffold_821565115845661042e-04
PHIF:NW_003303729.1426319426465501007e-04
PHSO:scaffold_440621394062285501007e-04
PYIR:scaffold_810319210333849997e-04
PHKE:scaffold_1743055324364998e-04
PHPA:scaffold_1771763671778250980.001
PLHA:NW_020187475.114494814514266980.001
PYUU:scaffold_2028860496860813107970.001
PHRA:scaffold_6216002216016850890.018
PYIW:scaffold_955753597475890.018
PYVX:scaffold_5755728591664870.029
PYAR:scaffold_269335953559840.077
ALCA:scaffold_64761927635354820.14
SADI:scaffold_8010040510059363770.68
SAPA:scaffold_95838958407761751.1
PYAR:scaffold_134463791898714.6
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PPTG_17126

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHSO:scaffold_1                                                       209     7e-62
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  189     4e-55
PHCA:scaffold_84 PHYCAscaffold_84                                     122     6e-47
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  165     1e-46
PHRA:scaffold_56                                                      111     2e-45
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  93.6    7e-44
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  129     6e-34
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  112     4e-28
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  111     1e-27
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  75.1    6e-27
ALLA:FR824081 dna:supercontig supercontig:ENA1:FR824081:1:137019:...  85.5    9e-19
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  63.5    2e-17
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  75.1    4e-15
ALCA:scaffold_80 AcNc2_CONTIG_80_length_84930 dna:supercontig sup...  53.1    9e-14
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  47.8    2e-11
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  46.6    1e-10
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  55.1    4e-08
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  52.0    5e-07
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  47.0    2e-05
HYAP:scaffold_82 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  44.7    2e-04
PHIF:NW_003303729.1 Phytophthora infestans T30-4 supercont1.30 ge...  43.1    7e-04
PHSO:scaffold_4                                                       43.1    7e-04
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  42.7    7e-04
PHKE:scaffold_174 scf_22126_174.1_contig_1 dna:supercontig superc...  42.7    8e-04
PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 ...  42.4    0.001
PLHA:NW_020187475.1 Plasmopara halstedii genome assembly, contig:...  42.4    0.001
PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:p...  42.0    0.001
PHRA:scaffold_62                                                      38.9    0.018
PYIW:scaffold_95 piw_scaffold_95 dna:supercontig supercontig:piw_...  38.9    0.018
PYVX:scaffold_575 pve_scaffold_575 dna:supercontig supercontig:pv...  38.1    0.029
PYAR:scaffold_2693 par_scaffold_2693 dna:supercontig supercontig:...  37.0    0.077
ALCA:scaffold_64 AcNc2_CONTIG_64_length_94369 dna:supercontig sup...  36.2    0.14 
SADI:scaffold_80 supercont1.80 dna:supercontig supercontig:Sap_di...  34.3    0.68 
SAPA:scaffold_95 supercont2.95 dna:supercontig supercontig:ASM151...  33.5    1.1  
PYAR:scaffold_1344 par_scaffold_1344 dna:supercontig supercontig:...  32.0    4.6  

>PHSO:scaffold_1
Length=13391543

 Score = 209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 128/164 (78%), Gaps = 28/164 (17%)
 Frame = +1

Query  1        MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQ------------  48
                MAEA RELRPLYKKLLRLAQSLPEPKR+ S+DQIRR+FR+HGDLTDP+            
Sbjct  2799130  MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGCVHVVSCPSCP  2799309

Query  49       ----------------EVSALIQRAQSSLSYLKIVTPRAESNMGVQRYIYRNGQRVNADE  92
                                 VSALIQRAQSSLSYLKIVTPR ESN GVQR+IYRNGQRVNA E
Sbjct  2799310  AV*SLYCVDAMSVCGCRVSALIQRAQSSLSYLKIVTPRGESNTGVQRFIYRNGQRVNAAE  2799489

Query  93       FEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
                FE KGEENAR+KTQD+E GL+RHHQLLRRQYF+DRKSGPPRPIF
Sbjct  2799490  FEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRKSGPPRPIF  2799621

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 123/179 (69%), Gaps = 43/179 (24%)
 Frame = -1

Query  1        MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE-----------  49
                M+ A RELRPLYKKLLRLAQ+LP+ KRQSSIDQIRR+FR H DLTDP+E           
Sbjct  1846080  MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKE*LDEVNFSCLS  1845901

Query  50       -----------VSALIQRAQSSLSYLKIVTPRAES---------------------NMGV  77
                           VS  IQRAQSSLSYLKI+TPR ES                     + GV
Sbjct  1845900  RSNSSLQFLLRVSEFIQRAQSSLSYLKIITPRTESSRCFVALRYPAICR*LDSNHTDTGV  1845721

Query  78       QRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
                QR+IYRNGQRVNA +FE+KG ENARWKTQDME G +RHHQLLRRQYF+DRKSGPPRPIF
Sbjct  1845720  QRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRKSGPPRPIF  1845544

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 122 bits (305),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 19/106 (18%)
 Frame = +2

Query  50      VSALIQRAQSSLSYLKIVTPRAES-------------------NMGVQRYIYRNGQRVNA  90
               VS L+QRAQSSL YLKIVTPRAES                   + GVQR+IYR+G+RVNA
Sbjct  99827   VSKLLQRAQSSLGYLKIVTPRAESSEFCLFICSCFLAESTAATDTGVQRFIYRDGKRVNA  100006

Query  91      DEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
               +E E KGEENARWKTQDME GL+RHHQLLRRQYF+DRKSGPPRPIF
Sbjct  100007  EELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRKSGPPRPIF  100144

 Score = 86.7 bits (213),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  4      AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSAL  53
              A RELRPLYKKLLRLAQSLPEPKRQ+SIDQIRR+FR+H DLTDP+E  ++
Sbjct  99627  AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKECGSI  99776

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 126/200 (63%), Gaps = 67/200 (34%)
 Frame = +1

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE-----------  49
               MA+AMR   PLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGDLTDP+E           
Sbjct  189976  MADAMR---PLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKECVVVVIMNKSR  190146

Query  50      ------------------VSALIQRAQSSLSYLKIVTPRAES------------------  73
                                 VS+L+QRAQSS+ +LKIVTPRAES                  
Sbjct  190147  FLFVS*LPNELSICFRCRVSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCLTLSL  190326

Query  74      -----------------NMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhh  116
                                + G+QR++YR+G+R++A E ++KGEENAR+KTQD+E G++RHH
Sbjct  190327  FSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHH  190506

Query  117     qllrrqYFLDRKSGPPRPIF  136
               QLLRRQ+F+DRKSGPPRPIF
Sbjct  190507  QLLRRQHFMDRKSGPPRPIF  190566

>PHRA:scaffold_56
Length=334739

 Score = 111 bits (277),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 68/96 (71%), Gaps = 23/96 (24%)
 Frame = -1

Query  2       AEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE------------  49
               A A RELRPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR+H +LTDP+E            
Sbjct  151955  AMAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKECVSLFILSLPGQ  151776

Query  50      -----------VSALIQRAQSSLSYLKIVTPRAESN  74
                          VSALIQRAQSSL YLKIVTPRAES+
Sbjct  151775  FTNYR*IAAARVSALIQRAQSSLGYLKIVTPRAESS  151668

 Score = 92.4 bits (228),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -2

Query  76      GVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPI  135
               G+QRYIYRNGQRVNADE E  GEENAR+KTQD+EGGL+RHHQLLRRQ+F+DRKSGPPRPI
Sbjct  151585  GIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGPPRPI  151406

Query  136     F  136
               F
Sbjct  151405  F  151403

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 93.6 bits (231),  Expect(3) = 7e-44, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +1

Query  76     GVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPI  135
              GVQRYIYRNGQRVNA E EEKGEENAR+KTQDME GL+RHHQL+RRQ+F+DRKSGPPRP+
Sbjct  66805  GVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPRPM  66984

Query  136    F  136
              F
Sbjct  66985  F  66987

 Score = 86.3 bits (212),  Expect(3) = 7e-44, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  1      MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
              MAEA RELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FRNHGDL+DP+E 
Sbjct  66365  MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEC  66514

 Score = 39.3 bits (90),  Expect(3) = 7e-44, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  50     VSALIQRAQSSLSYLKIVTPRAESNMGVQRYI  81
              VS L+Q AQSSLSYLKIVTPR E+      ++
Sbjct  66624  VSKLLQLAQSSLSYLKIVTPRDETESSACSFL  66719

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 84/116 (72%), Gaps = 23/116 (20%)
 Frame = +1

Query  44      LTDPQEVSALIQRAQSSLSYLKIVTPRAES-----------------------NMGVQRY  80
               L     VSALIQRAQSSLSYLKIVTPRAES                       + GVQRY
Sbjct  430438  LITSCRVSALIQRAQSSLSYLKIVTPRAESSEFLVIMPPPCDWSDAACAVNNVDTGVQRY  430617

Query  81      IYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
               IYRNGQRVNA EFEEKG ENARWK QDMEGGL+RHHQLL+RQYF++RKSGPPRPIF
Sbjct  430618  IYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRKSGPPRPIF  430785

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALI  54
               MAEAM ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFR+HGD TDP+E + ++
Sbjct  430254  MAEAMSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKECAVVV  430415

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 107/174 (61%), Gaps = 42/174 (24%)
 Frame = +1

Query  4      AMRELRPLYKKLLRLAQSLP-EPKRQSSIDQIRRDFRNHGDLTDPQE-------------  49
              A  ELRPLYK+LLRLA+SLP E KR++++ QIR +FR+  D  DP+E             
Sbjct  19066  ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKE*VTAHEMR***DD  19245

Query  50     ------VSALIQRAQSSLSYLKIVTPRA---------------------ESNMGVQRYIY  82
                    V+AL+QRAQ+ + YLKIVTPR+                      ++ GV+ ++Y
Sbjct  19246  *RVEDRVAALVQRAQAKIGYLKIVTPRSTAGRMRWRVERPELCVLMRRWSADAGVKSFVY  19425

Query  83     RNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
               NG+RV++ + + + EE AR+KT D EG +RRH+QLLRRQ+F+DR   PP+PIF
Sbjct  19426  VNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQHFMDRGVAPPKPIF  19584

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 73/90 (81%), Gaps = 4/90 (4%)
 Frame = +1

Query  47      PQEVSALIQRAQSSLSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQ  106
               P  VSAL         +L +V     ++MGVQRYIYRNGQRVNADEFEEKGEENARWKTQ
Sbjct  250492  PSPVSALY----CVRIFL*LV*LVTNADMGVQRYIYRNGQRVNADEFEEKGEENARWKTQ  250659

Query  107     DMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
               DMEGGLRRHHQLLRRQYFLDRKSGPPRPIF
Sbjct  250660  DMEGGLRRHHQLLRRQYFLDRKSGPPRPIF  250749

 Score = 105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 7/70 (10%)
 Frame = +2

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
               MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE + ++  A   
Sbjct  250214  MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQECALILYIA---  250384

Query  61      LSYLKIVTPR  70
                    +V PR
Sbjct  250385  ----TLVCPR  250402

 Score = 45.8 bits (107),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  48      QEVSALIQRAQSSLSYLKIVTPRAESN  74
               + VSALIQRAQSSLSYLKIVTPRAES+
Sbjct  250422  RRVSALIQRAQSSLSYLKIVTPRAESS  250502

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 75.1 bits (183),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 71/120 (59%), Gaps = 31/120 (26%)
 Frame = -2

Query  48    QEVSALIQRAQSSLSYLKIVTPRAESNM-------------------------------G  76
             + V+ L+QRAQS L YLKIVTPR  S                                 G
Sbjct  3056  RRVAKLLQRAQSQLGYLKIVTPRGPSGTWPRPPFAGNWRGLS*LVVSFWWC*PRLVTASG  2877

Query  77    VQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
             V+RYIYRNGQRV+AD  E  GE+ AR+KT DMEG L+RHHQLLRRQ+F+DR   PPRPIF
Sbjct  2876  VKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDRGVAPPRPIF  2697

 Score = 66.6 bits (161),  Expect(2) = 6e-27, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  7     ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE  49
             ELRPLYKKLLRLAQSLPEPKR S++ QIR +FR+H ++TD  E
Sbjct  3261  ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAE  3133

>ALLA:FR824081 dna:supercontig supercontig:ENA1:FR824081:1:137019:1 
REF
Length=137019

 Score = 85.5 bits (210),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 96/165 (58%), Gaps = 44/165 (27%)
 Frame = +2

Query  4       AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE--------------  49
               AM + R +YK+L+RLA+SLP  K+ +++  IR +FR H D++DP +              
Sbjct  101549  AMSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQCVRIY*TLLTASNF  101728

Query  50      -------VSALIQRAQSSLSYLKIVTPR--------------AESNM------GVQRYIY  82
                      +S L++RAQS++ YLKIVTP               +ESN       GV+R+++
Sbjct  101729  *LKPFRRLSQLLERAQSTIGYLKIVTPHKRSGPWLCVCLSH*SESNQMLCSDSGVKRFMF  101908

Query  83      RNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDR  127
               ++G+R+   E   K  E AR+K QD+  GL+RHHQLLRRQ+F+DR
Sbjct  101909  KDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  102034

 Score = 37.7 bits (86),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = -3

Query  11     LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
              LY+++LRLA+  P  KR + I+ IR +FR   D+T    +   I  A + +  L
Sbjct  72679  LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  72518

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 63.5 bits (153),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  4        AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSAL  53
                A  +LRP+YKKLL+LAQ+LP  KRQ++++QIRR+FR H    DP+E   L
Sbjct  1306491  ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKECVYL  1306640

 Score = 45.1 bits (105),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 58/112 (52%), Gaps = 36/112 (32%)
 Frame = +1

Query  50       VSALIQRAQSSLSYLKIVTPRAES-------------NM--------------------G  76
                ++AL+ RAQSS+ YLKIVTPRA S             NM                    G
Sbjct  1306717  IAALLARAQSSIGYLKIVTPRATSGTVVYAAHYA*RDNMFTVSLVCMFVVSTWPFWADAG  1306896

Query  77       VQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRK  128
                V+ Y+Y  G+RV A       E+ AR+KT D    ++RH QLLRRQ+F+DRK
Sbjct  1306897  VKNYVYIKGKRVEA---AGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  1307043

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 83/151 (55%), Gaps = 33/151 (22%)
 Frame = -1

Query  8       LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE--------------VSAL  53
               +R  YKKLL+LA+S+P+ +R  +++++R +FR H     P+E              +  L
Sbjct  205690  IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEE*VMRRRDRRSRVGRLDQL  205511

Query  54      IQRAQSSLSYLKIVTPRAES---------NMGV-------QRYIYRNGQRVNADEFEEKG  97
               +++AQS +SYLKIVTP+  S         NM           ++Y+NGQR++  E     
Sbjct  205510  LRKAQSKISYLKIVTPKKSSSAYARGCVWNMTFLVGSTQGSHFVYKNGQRIDGREL---S  205340

Query  98      EENARWKTQDMEGGlrrhhqllrrqYFLDRK  128
                ++A  KT D    + +H QL+RRQ+F+DRK
Sbjct  205339  ADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  205247

>ALCA:scaffold_80 AcNc2_CONTIG_80_length_84930 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_80_length_84930:1:84930:1 
REF
Length=84930

 Score = 53.1 bits (126),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 21/96 (22%)
 Frame = +3

Query  50     VSALIQRAQSSLSYLKIVTPRAESNM------------------GVQRYIYRNGQRVNAD  91
              ++ L++RAQS++ YLKIVTP   S                    GV+ ++Y++G+R+   
Sbjct  18108  LAQLLERAQSTIGYLKIVTPHKRSGTYIFVCMSIRCKLYVSPDSGVKHFVYKDGERI---  18278

Query  92     EFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDR  127
              E   +  E A++K QDME GL+RH+QL+RRQYF+DR
Sbjct  18279  EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  18386

 Score = 43.9 bits (102),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1      MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDP  47
              +  A+ E R ++KK+++LA+SLP  K+  ++  IR +FR H D+ DP
Sbjct  17896  IMTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDP  18036

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 47.8 bits (112),  Expect(3) = 2e-11, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  6       RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQE  49
               + +R  YKKL++LAQSLP  ++ +++D+IR DFR+ G ++  +E
Sbjct  706702  KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEE  706833

 Score = 31.6 bits (70),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  68      TPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDR  127
                 R     G QR+IY++G+R+++   ++ G  N   KT D+   + RH +L+RRQ+F+DR
Sbjct  706986  CSRGSIESGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDR  707159

Query  128     K  128
               K
Sbjct  707160  K  707162

 Score = 28.1 bits (61),  Expect(3) = 2e-11, Method: Composition-based stats.
 Identities = 12/18 (67%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  53      LIQRAQSSLSYLKIVTPR  70
               L+ +AQS +SYLKIVTP+
Sbjct  706892  LVMKAQSKISYLKIVTPK  706945

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 46.6 bits (109),  Expect(3) = 1e-10, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -3

Query  6       RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSAL  53
               + +R  YKKL++LAQSLP  ++  ++D++R +FR+HG +T   +   L
Sbjct  401292  KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQCGPL  401149

 Score = 30.8 bits (68),  Expect(3) = 1e-10, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = -1

Query  53      LIQRAQSSLSYLKIVTPRAESNMGVQRYIYRNG  85
               ++ +AQS +SYLKIVTP+    M + R I   G
Sbjct  401102  IVMKAQSKISYLKIVTPKRAPRMCMSRCIVSPG  401004

 Score = 27.7 bits (60),  Expect(3) = 1e-10, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = -2

Query  78      QRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRK  128
               QRYIY++G+R++    ++    NA  KT D    + RH +L+RRQ+F+DRK
Sbjct  400981  QRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFMDRK  400835

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +2

Query  7      ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSL  61
              +LRP+YKKLL+LA++LPE KR+++  QIR +FR+  +L+DP+E   +I+ A  SL
Sbjct  9875   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKE--CVIRVATCSL  10033

 Score = 38.9 bits (89),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  50     VSALIQRAQSSLSYLKIVTPRAESNM  75
              ++AL+ RAQSS+SYLKIVTPR  S M
Sbjct  10068  LNALLARAQSSISYLKIVTPRKSSGM  10145

 Score = 36.2 bits (82),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  73     SNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRK  128
              ++ GV+ YIY+NGQRV A    E G   A+++  D  G + RH +LLRRQ+F+DRK
Sbjct  10231  ADAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMDRK  10389

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 52.0 bits (123),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 23/71 (32%)
 Frame = -1

Query  28     QSSIDQIRRDFRNHGDLTDPQ-----------------------EVSALIQRAQSSLSYL  64
              ++++ QIR +FR+ GDL+DP+                        V+AL+ RAQS + YL
Sbjct  17544  EATLQQIRSEFRSSGDLSDPKACVLILFPPALLGVPLTIGGALRSVAALVLRAQSKIGYL  17365

Query  65     KIVTPRAESNM  75
              KIVTPRA S M
Sbjct  17364  KIVTPRATSGM  17332

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 75/156 (48%), Gaps = 41/156 (26%)
 Frame = +3

Query  8       LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIV  67
               +R  YKKLL+LA+S+P+ +R  +++++R +FR H     P+E +    R +    YL  V
Sbjct  393339  IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEE*A---MRGRDWRLYLVCV  393509

Query  68      ---------TPRAESNM----------------GVQR----------YIYRNGQRVNADE  92
                        +PR  ++                 G  R          ++Y+NGQR++  E
Sbjct  393510  DSTSSSARRSPRLATSRS*RLRSRRVRTQPPAYGT*RSPVGPGQGNHFVYKNGQRIDGRE  393689

Query  93      FEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRK  128
                     ++A  KT D    + +H QL+RRQ+F+DRK
Sbjct  393690  L---SADSATIKTADYNAMMTKHVQLVRRQHFMDRK  393788

>HYAP:scaffold_82 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_82:1:287376:1 
REF
Length=287376

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -2

Query  1      MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
              MAEA   LR +Y+++L+LAQ  P  KRQS I  I+ +FR + +L+D Q+V   +   Q+ 
Sbjct  15845  MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  15669

Query  61     LSYLKI  66
              +  L +
Sbjct  15668  IKELSM  15651

>PHIF:NW_003303729.1 Phytophthora infestans T30-4 supercont1.30 
genomic scaffold, whole genome shotgun sequence
Length=2025055

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
               MAE  RE+  +Y+++L+LAQ  P  KR+S I  I+ +F  + DLTD Q++
Sbjct  426319  MAET-REVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKI  426465

>PHSO:scaffold_4
Length=7609242

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -1

Query  1        MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
                MAE    LR +Y+++L+LAQ  P  KR+S I  I+ +F  + DLTD Q++
Sbjct  4062285  MAETKEVLR-MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKI  4062139

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  2       AEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
               A A+ +LRP+YKKLL+LA++LPE KR +++ QIR +FR   D++DP+E 
Sbjct  103338  AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKEC  103192

 Score = 42.4 bits (98),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  50      VSALIQRAQSSLSYLKIVTPRAESNMGVQRYIY  82
               ++AL+ RAQSS+ YLKIVTPR  S MG    ++
Sbjct  103057  LNALLARAQSSIGYLKIVTPRKSSGMGFAHVVF  102959

 Score = 37.7 bits (86),  Expect = 0.048, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 3/78 (4%)
 Frame = -2

Query  51      SALIQRAQSSLSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEG  110
               S ++     SL+++         + GV+ YIY+NGQRV A    E G   A++   D   
Sbjct  102959  SCILATLNLSLAHIHHCRCNPHIDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNA  102789

Query  111     GlrrhhqllrrqYFLDRK  128
                ++RH +LLRRQ+F+DRK
Sbjct  102788  QMQRHQKLLRRQHFMDRK  102735

>PHKE:scaffold_174 scf_22126_174.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_174.1_contig_1:1:71367:1 
REF
Length=71367

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  1     MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
             MAE ++E+  +Y+++L+LAQ  P  KR S I  I+ +F  H  LTD Q++   +  A++ 
Sbjct  3243  MAE-VKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAG  3067

Query  61    LSYL  64
             +  L
Sbjct  3066  IKEL  3055

>PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.17, whole genome shotgun 
sequence
Length=1143538

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
               MAE    LR LY+++L+LAQ  P  KR+S I  I+ +F  + +LTD Q++
Sbjct  717636  MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKI  717782

>PLHA:NW_020187475.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_555, whole genome shotgun sequence
Length=2240492

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = +3

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
               MAE  + LR +Y++LL+LAQ  P  KR++ I  I+ +F  +  +TD Q++   +  A + 
Sbjct  144948  MAETKQVLR-VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAG  145124

Query  61      LSYLKI  66
               +  L +
Sbjct  145125  IKELSM  145142

>PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:pug:scf1117875582028:1:960197:1 
REF
Length=960197

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 52/107 (49%), Gaps = 9/107 (8%)
 Frame = -1

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
               M EA +E+  +Y+++L+LA   P  KR + I  I+ +FR +  LTD   + A +Q A+  
Sbjct  860813  MTEA-KEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQG  860637

Query  61      LSYLKIVTPRAESNMGVQRYIYR--------NGQRVNADEFEEKGEE  99
               +  L   T    S+M  +  + R         G  VNA    EK EE
Sbjct  860636  IVELSQYTNLNPSSMTWKVDVGREVGQGPPAGGPVVNAKVVGEK*EE  860496

>PHRA:scaffold_62
Length=334142

 Score = 38.9 bits (89),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  1       MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
               MAE  +E+  +Y+++L+LAQ  P  KR S I  I+ +F  +  LTD Q++
Sbjct  160022  MAET-KEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKI  160168

>PYIW:scaffold_95 piw_scaffold_95 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_95:1:31709:1 
REF
Length=31709

 Score = 38.9 bits (89),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query  1     MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
             MAEA +E+  LY+++L+LA   P  KR + I +I+ +F  +  LTD  ++   +Q A+  
Sbjct  5753  MAEA-KEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQG  5929

Query  61    LSYLKIVTPRAESNM  75
             +  L   T    S+M
Sbjct  5930  IVELSQYTNLNPSSM  5974

>PYVX:scaffold_575 pve_scaffold_575 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_575:1:19158:1 
REF
Length=19158

 Score = 38.1 bits (87),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +1

Query  1     MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
             MA+ +  +R LY+++L+LAQ  P  KR S +  I+ +F  +  L+D Q+V   I  A++ 
Sbjct  5728  MADRLEVVR-LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAG  5904

Query  61    LSYL  64
             +  L
Sbjct  5905  IQEL  5916

>PYAR:scaffold_2693 par_scaffold_2693 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2693:1:4498:1 
REF
Length=4498

 Score = 37.0 bits (84),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  6    RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
            RE+  LY+++L+LA+  P  KR + ++ I+ +F     LTD   +   I  AQ+ +  L
Sbjct  535  REVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  359

>ALCA:scaffold_64 AcNc2_CONTIG_64_length_94369 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_64_length_94369:1:94369:1 
REF
Length=94369

 Score = 36.2 bits (82),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = -2

Query  11     LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
              LY+++LRLA+  P  KR + ++ IR +FR   ++  P  +   I  A + +  L
Sbjct  76353  LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  76192

>SADI:scaffold_80 supercont1.80 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.80:1:248937:1 
REF
Length=248937

 Score = 34.3 bits (77),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 32/63 (51%), Gaps = 0/63 (0%)
 Frame = +1

Query  2       AEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSL  61
               A A R +  +Y+++L+LAQ  P  K+   +  I+ +F  +  LTD  ++   I  A   +
Sbjct  100405  AMAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGI  100584

Query  62      SYL  64
                 L
Sbjct  100585  EQL  100593

>SAPA:scaffold_95 supercont2.95 dna:supercontig supercontig:ASM15154v2:supercont2.95:1:144479:1 
REF
Length=144479

 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = -1

Query  4      AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
              A R +  +Y+++L+LAQ  P  K+   +  I+ +F  +  LTD  ++   I  A   +  
Sbjct  84077  AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQ  83898

Query  64     L  64
              L
Sbjct  83897  L  83895

>PYAR:scaffold_1344 par_scaffold_1344 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1344:1:8973:1 
REF
Length=8973

 Score = 32.0 bits (71),  Expect = 4.6, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 44/98 (45%), Gaps = 13/98 (13%)
 Frame = -1

Query  6    RELRPLYKKLL-------RLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQ  58
            +EL PLY  +L       R A  LP P R S  D+      +HG    P   +  ++ A 
Sbjct  918  QELVPLYVDVLLSLPLSMRTAMLLPPPPRSSDGDEDEASEADHG---HPTHAALPVRGAS  748

Query  59   SSLSYLKIVTPRAESNMGVQRYIY--RNGQRVNADEFE  94
             +L  L+ + P+ ++ + V + IY  R   R + D  +
Sbjct  747  GALYALRPLAPQWDA-VAVAKQIYYERKAGRADVDALQ  637

Lambda      K        H        a         alpha
   0.316    0.133    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10634724750

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40