Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHIF:NW_003303626.1266967267209814384e-49
PHIF:NW_003303730.1696902697090633302e-44
PHSO:scaffold_14819126819314633041e-37
PHCA:scaffold_7905777905965633142e-35
PHPA:scaffold_22685354685542633125e-35
PHRA:scaffold_26792649512832993e-34
PHRA:scaffold_1061324013428632952e-32
PHSO:scaffold_5682295682477612614e-32
PHSO:scaffold_351844218624612615e-32
PHKE:scaffold_62253125557823062e-31
PHRA:scaffold_105154701154889632921e-29
PHSO:scaffold_443741794374367632753e-28
PHRA:scaffold_792598026168632781e-27
PHPA:scaffold_66162935163147722656e-26
PHPA:scaffold_4637964008722656e-26
PHKE:scaffold_761697888642471e-23
PHKE:scaffold_985901359201632472e-23
PYVX:scaffold_2751242212598592435e-23
PHPA:scaffold_63243331243519632427e-23
PHRA:scaffold_56163908164087602281e-22
PHPA:scaffold_20363575363757612373e-22
PHCA:scaffold_849405294234612374e-22
PHSO:scaffold_127917072791892622303e-21
PLHA:NW_020189073.13459734830882294e-21
PHSO:scaffold_643792638066472062e-20
PLHA:NW_020187034.19467194859632242e-20
PHIF:NW_003303697.1358991359173612233e-20
PHPA:scaffold_16488750488959702163e-19
PHIF:NW_003303741.115755811575790702136e-19
PHIF:NW_003303754.135451383545335662022e-17
PYIW:scaffold_71110451233631994e-17
PYUU:scaffold_203712980171298208641875e-17
PHSO:scaffold_1120227662022897441729e-16
PYIR:scaffold_5024145336641831e-15
PYIR:scaffold_224917341925641862e-15
PYIR:scaffold_4828108320711813e-15
PYAP:scaffold_56084018574581519e-15
PHSO:scaffold_12168726168932691766e-14
PHPA:scaffold_39149850150038631741e-13
PHCA:scaffold_67220668220901781713e-13
PHIF:NW_003303747.127487072748895631678e-13
PYIR:scaffold_8110459110641611661e-12
PHKE:scaffold_3541430514499651607e-12
PHRA:scaffold_33370567370758641591e-11
PHIF:NW_003303753.128380682838220511474e-10
PYAR:scaffold_345920712256621422e-09
PHIF:NW_003304531.1571750601403e-09
PHRA:scaffold_49484598560341077e-07
PHRA:scaffold_289218231924341072e-06
HYAP:scaffold_59161237161413591166e-06
PLHA:NW_020189861.11846830184700659990.001
PYUU:scaffold_202949018149038769580.36
PHSO:scaffold_36431242643149986780.55
APIN:scaffold_63298383001460780.69
PHKE:scaffold_14866823858751.1
PHIF:NW_003303391.1803808044823751.3
PYIW:scaffold_782912304043751.5
PYIR:scaffold_7754089427164742.2
PYIW:scaffold_35421681189070732.6
PHPA:scaffold_19492924954986592.7
PHSO:scaffold_245520374552372113733.0
PHKE:scaffold_4991433614656113723.4
PHCA:scaffold_2239646339667270715.4
PYVX:scaffold_230223952253849706.0
PLHA:NW_020189964.186949986963055706.1
PHPA:scaffold_46062183070706.4
PYIR:scaffold_9766699694182698.6
PHIF:NW_003303752.12065233206544270699.4
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PITG_19818

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 g...  173     4e-49
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  131     2e-44
PHSO:scaffold_14                                                      121     1e-37
PHCA:scaffold_7 PHYCAscaffold_7                                       125     2e-35
PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 ...  129     1e-33
PHRA:scaffold_267                                                     119     3e-34
PHRA:scaffold_106                                                     118     2e-32
PHSO:scaffold_5                                                       105     4e-32
PHSO:scaffold_35                                                      105     5e-32
PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:Phy...  122     2e-31
PHRA:scaffold_105                                                     117     1e-29
PHSO:scaffold_4                                                       110     3e-28
PHRA:scaffold_79                                                      111     1e-27
PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 ...  106     6e-26
PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 ...  106     6e-26
PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig superc...  99.8    1e-23
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  99.8    2e-23
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  98.2    5e-23
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  97.8    7e-23
PHRA:scaffold_56                                                      92.4    1e-22
PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 ...  95.9    3e-22
PHCA:scaffold_84 PHYCAscaffold_84                                     95.9    4e-22
PHSO:scaffold_1                                                       93.2    3e-21
PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig:...  92.8    4e-21
PHSO:scaffold_64                                                      84.0    2e-20
PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig:...  90.9    2e-20
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  90.5    3e-20
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  87.8    3e-19
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  86.7    6e-19
PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 gen...  82.4    2e-17
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  81.3    4e-17
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  77.0    1e-15
PHSO:scaffold_11                                                      70.9    9e-16
PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:...  75.1    1e-15
PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:...  76.3    2e-15
PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:...  74.3    3e-15
PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:p...  67.0    4e-12
PHSO:scaffold_12                                                      72.4    6e-14
PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 ...  71.6    1e-13
PHCA:scaffold_67 PHYCAscaffold_67                                     70.5    3e-13
PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 ge...  68.9    8e-13
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  68.6    1e-12
PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig superc...  66.2    7e-12
PHRA:scaffold_33                                                      65.9    1e-11
PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 gen...  61.2    4e-10
PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:...  59.3    2e-09
PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 ...  58.5    3e-09
PHRA:scaffold_494                                                     45.8    7e-07
PHRA:scaffold_2892                                                    45.8    2e-06
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  49.3    6e-06
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  42.7    0.001
PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:p...  26.9    0.36 
PHSO:scaffold_3                                                       34.7    0.55 
APIN:scaffold_63 supercont1.63 dna:supercontig supercontig:Apha_i...  34.7    0.69 
PHKE:scaffold_1486 scf_22126_1486.1_contig_1 dna:supercontig supe...  33.5    1.1  
PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 g...  33.5    1.3  
PYIW:scaffold_78 piw_scaffold_78 dna:supercontig supercontig:piw_...  33.5    1.5  
PYIR:scaffold_775 pir_scaffold_775 dna:supercontig supercontig:pi...  33.1    2.2  
PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:...  32.7    2.6  
PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 ...  27.3    2.7  
PHSO:scaffold_2                                                       32.7    3.0  
PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig superc...  32.3    3.4  
PHCA:scaffold_22 PHYCAscaffold_22                                     32.0    5.4  
PYVX:scaffold_230 pve_scaffold_230 dna:supercontig supercontig:pv...  31.6    6.0  
PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig:...  31.6    6.1  
PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310...  31.6    6.4  
PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pi...  31.2    8.6  
PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 gen...  31.2    9.4  

>PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 
genomic scaffold, whole genome shotgun sequence
Length=313873

 Score = 173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +3

Query  1       MLHQRTTSNSLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQ  60
               MLHQRTTSNSLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQ
Sbjct  266967  MLHQRTTSNSLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQ  267146

Query  61      DFKAWRDENGYKSLRDFMDRA  81
               DFKAWRDENGYKSLRDFMDRA
Sbjct  267147  DFKAWRDENGYKSLRDFMDRA  267209

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 73/92 (79%), Gaps = 10/92 (11%)
 Frame = +2

Query  56      FKPQQDFKAWRDENGYKSLRDFMDRANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATT  115
               + P+ D  A+              R +LFRRVTPCDRLVTRTTDRARCGSTTRWCWMATT
Sbjct  267251  YGPEGDAAAYSGGG----------RRSLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATT  267400

Query  116     VTRSSQarttlwttrharararcagtGWASAS  147
               VTRSSQARTTLWTTRHARARARCAGTGWASAS
Sbjct  267401  VTRSSQARTTLWTTRHARARARCAGTGWASAS  267496

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 131 bits (330),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFK QQDFKAWRDENGYKSLRDFM
Sbjct  696902  LAPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFM  697081

Query  79      DRA  81
               DRA
Sbjct  697082  DRA  697090

 Score = 69.3 bits (168),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  87      VTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGWASA  146
               V PCDRLVTRTTDRA+CG TTRWCWMATTVTRSSQARTTLWTTRHARARARCAGTGWA A
Sbjct  697170  VAPCDRLVTRTTDRAKCGLTTRWCWMATTVTRSSQARTTLWTTRHARARARCAGTGWACA  697349

Query  147     S  147
               S
Sbjct  697350  S  697352

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  79      DRANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararc  138
                R +LFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQARTTLWTTRHARARARC
Sbjct  673439  GRRSLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQARTTLWTTRHARARARC  673618

Query  139     agtGWASAS  147
               AGTGWASAS
Sbjct  673619  AGTGWASAS  673645

>PHSO:scaffold_14
Length=1806347

 Score = 121 bits (304),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTADAHQIVLLPEPQWTT DK+TKYNPLAFLENQGFK Q+DF AWR ENGYKSLRDFM
Sbjct  819314  LAPTADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFM  819135

Query  79      DRA  81
               DRA
Sbjct  819134  DRA  819126

 Score = 55.5 bits (132),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -2

Query  79      DRANL--FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQ  121
                RA L  FR+VT C    T TT RARCGSTTRWCWMATT TRSS+
Sbjct  819076  PRAPLSPFRKVTRCALPATPTTARARCGSTTRWCWMATTATRSSR  818942

 Score = 112 bits (280),  Expect(3) = 4e-37, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTADAHQIVLL EPQ TT DKDTKYNPLAFLENQGF+ Q+DF +WRD+NGYKSLRDFM
Sbjct  813940  LAPTADAHQIVLLSEPQ*TTSDKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFM  814119

Query  79      DRA  81
               D+A
Sbjct  814120  DKA  814128

 Score = 59.7 bits (143),  Expect(3) = 4e-37, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  84      FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQ  121
               FRR TPC R VTRTT RARCGSTTR CW ATT TRSS+
Sbjct  814199  FRRATPCVRRVTRTTARARCGSTTRRCWRATTATRSSR  814312

 Score = 24.3 bits (51),  Expect(3) = 4e-37, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 2/18 (11%)
 Frame = +2

Query  7       TSNSL--ATTFHFAVRPT  22
               T NS+  ATT HFAVRPT
Sbjct  813800  TGNSIVAATTSHFAVRPT  813853

 Score = 115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -2

Query  21      PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
               PTADAHQIVLLPEPQWTT DK TKYNPLAFLENQGFK Q+DF AWR ENGY++LRDFMD+
Sbjct  815827  PTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDK  815648

Query  81      A  81
               A
Sbjct  815647  A  815645

 Score = 37.0 bits (84),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  60      QDFKAWRDENGYKSLRDFMDRANL  83
               +DF +WRD+NGYKSLRDF   A L
Sbjct  920427  EDFASWRDKNGYKSLRDFRVTATL  920356

>PHCA:scaffold_7 PHYCAscaffold_7
Length=1368812

 Score = 125 bits (314),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -2

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTADAHQIVLLPEPQWTT DKDTKYNPLAFLENQGFK QQDF AWR+ENGYKSLRDFM
Sbjct  905965  LAPTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFM  905786

Query  79      DRA  81
               DRA
Sbjct  905785  DRA  905777

 Score = 44.7 bits (104),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  88      TPCDRLVTRTTDRARCGSTTRWCWMATTVTR  118
               TPC   VTRT  R +CG TTRWCWM TT TR
Sbjct  905694  TPCAPRVTRTMVRVKCGLTTRWCWMVTTATR  905602

 Score = 119 bits (298),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTADAHQIVLLPEPQWTT DKDTKYNPLAFLEN+GF  Q+DF AWR ENGYKSLRDFM
Sbjct  908730  LAPTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFM  908909

Query  79      DRA  81
               DRA
Sbjct  908910  DRA  908918

 Score = 48.5 bits (114),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  80      RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
               R + FRRVTPC   VTR   R RCG T RWCW   TVTRSS
Sbjct  908977  RRSPFRRVTPCVPRVTRMMVRVRCGLTIRWCWTERTVTRSS  909099

 Score = 115 bits (289),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +2

Query  1       MLHQRTTSNSLATTFH--FAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKP  58
               M+H    + ++A+T      +  TA+AHQIVLLPEPQWTT DKDTKYNPLAFLENQGFK 
Sbjct  904241  MVHSFALTFAVASTLSSLALLDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  904420

Query  59      QQDFKAWRDENGYKSLRDFMDRA  81
               QQDF +WR EN YKSLRDFMD A
Sbjct  904421  QQDFASWRTENNYKSLRDFMDNA  904489

 Score = 48.1 bits (113),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  89      PCDRLVTRTTDRARCGSTTRWCWMATTVTR  118
               PC  LVTRTT R +CG TTRWCWM TT TR
Sbjct  904575  PCVPLVTRTTVRVKCGLTTRWCWMVTTATR  904664

 Score = 106 bits (264),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTA AHQ+VLLP PQW T ++DT+++PLAFLE+QGFK QQDF AWR+ENGYKSLRDFM
Sbjct  901408  LAPTATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFM  901587

Query  79      DRANLFRR  86
               DRA    R
Sbjct  901588  DRAKYTVR  901611

 Score = 43.1 bits (100),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  80      RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararca  139
               R + F + TPC   VTRTT R +CG  TRW W A T TRSS  R T  TTR ARA ARC 
Sbjct  901655  RRSPFLQATPCAPRVTRTTVRVKCGLMTRW*WKAITATRSSLVRATPSTTRPARASARCT  901834

Query  140     gtGWASAS  147
               GTGW  AS
Sbjct  901835  GTGWVFAS  901858

 Score = 97.8 bits (242),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 8/87 (9%)
 Frame = -3

Query  3       HQRTTSNSLATTFHFA--------VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQ  54
               H  +  +SL +T   A        + PTA AHQ+VLLP+PQW T ++DT++ PL FLE  
Sbjct  876795  HLFSMVSSLVSTLVVASTLSSMALLAPTATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGV  876616

Query  55      GFKPQQDFKAWRDENGYKSLRDFMDRA  81
               GFK Q DF AWR ENGYKSLRDFMD A
Sbjct  876615  GFKTQADFTAWRKENGYKSLRDFMDNA  876535

 Score = 47.0 bits (110),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -1

Query  80      RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararca  139
               R + FRR  PC  LVTRTT R RCG  TRW W  TT TRSS  RTT  TTR ARA ARC 
Sbjct  876476  RRSPFRREMPCVPLVTRTTVRVRCGLMTRW*WKVTTATRSSLVRTTPSTTRPARASARCT  876297

Query  140     gtGWASAS  147
               GTGW   S
Sbjct  876296  GTGWVCVS  876273

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 40/67 (60%), Gaps = 6/67 (9%)
 Frame = +2

Query  37      TTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFRRVTPCDRLVTR  96
                 Q K  +YNPLAFLEN+GF  Q+DF AWR ENGYKS  DFMDRA       P  R  T 
Sbjct  900350  VAQGKKFQYNPLAFLENEGFTAQEDFTAWRTENGYKSF-DFMDRAKY-----PA*RTGTM  900511

Query  97      TTDRARC  103
                 D  +C
Sbjct  900512  VHDPFQC  900532

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  41      KDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSL  74
               K  +YNPLAFLEN+GF  Q+DF AWR ENGYK L
Sbjct  895372  KKFQYNPLAFLENEGFTTQEDFTAWRTENGYKLL  895271

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = -1

Query  29      VLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWR  66
               VLLPEPQ T   K  KYNPLAFLE+ GFK Q+DF  W+
Sbjct  902648  VLLPEPQRTANGKGAKYNPLAFLEH-GFKTQEDFAPWK  902538

>PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.22, whole genome shotgun 
sequence
Length=998868

 Score = 124 bits (312),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + P ADAHQIVLLPEPQWTT DKDTKYNPLAFLENQGFK Q+DFK+WRDENGYKSLRDFM
Sbjct  685354  LAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFM  685533

Query  79      DRA  81
               DRA
Sbjct  685534  DRA  685542

 Score = 43.9 bits (102),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  84      FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
               FRR TPC    TRT  R +CGST  WC  ATTVTRSS
Sbjct  685613  FRRATPCVPPDTRTMARVKCGSTILWCLTATTVTRSS  685723

 Score = 119 bits (299),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = -3

Query  1       MLHQRTTSNSLATTFHFA--VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKP  58
               M+H    + ++ATT      + P ADAHQIVLLPEPQWTT DKDTKYNPLAFLENQGFK 
Sbjct  687196  MVHSVVPALAVATTLSSMALLAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  687017

Query  59      QQDFKAWRDENGYKSLRDFMDRA  81
               Q+DF +WR+EN YKSLRDFMD A
Sbjct  687016  QEDFLSWRNENNYKSLRDFMDNA  686948

 Score = 45.4 bits (106),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  84      FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
               FR+VTPC    TRTT R +CGST  WC M  TVTRSS
Sbjct  686877  FRQVTPCVPPDTRTTARVKCGSTILWCLMVKTVTRSS  686767

 Score = 129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = +1

Query  1       MLHQRTTSNSLATTFHFA--VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKP  58
               M+H    + ++A T      V PT DAHQIVLLPEPQWTT DKDTKYNPLAFLENQGFKP
Sbjct  714103  MVHSVVQACAVAATLSGMALVLPTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKP  714282

Query  59      QQDFKAWRDENGYKSLRDFMDRANLFRRVTP  89
               Q+DF AW  ENGYKSLRDFMDRA     VTP
Sbjct  714283  QEDFAAWSKENGYKSLRDFMDRAKY--EVTP  714369

 Score = 109 bits (272),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -3

Query  22      TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
               T DAHQIVLLPEPQWTT DK+TKYNPLAFLEN+GF  Q+DF AWR ENGYKSLRDF+D A
Sbjct  682888  TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  682709

 Score = 46.2 bits (108),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -1

Query  84      FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
               FRR TPC    TRT  R +CGST  WC  ATTVTRSS
Sbjct  682638  FRRATPCVPPDTRTMARVKCGSTILWCLTATTVTRSS  682528

 Score = 34.3 bits (77),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +2

Query  82      NLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagt  141
               NLFRR   C    T TT  A+C     WC  AT   R+S ART   TT  A+  A   GT
Sbjct  714416  NLFRRKVSCVPPGTLTTVHAKCTLMIPWCSKATIAMRNSPARTAPSTTHRAKEHAHFDGT  714595

Query  142     GWASAS  147
               GWASAS
Sbjct  714596  GWASAS  714613

>PHRA:scaffold_267
Length=29552

 Score = 119 bits (299),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = +3

Query  1     MLHQRTTSNSLATTFH--FAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKP  58
             M+H    + ++A+       + PTADAHQ+VLLPEPQWTT DKDTKYNPLAFLEN+GF  
Sbjct  9264  MVHPIVPTLAVASVLSSMALLAPTADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTT  9443

Query  59    QQDFKAWRDENGYKSLRDFMDRA  81
             Q+DF +WRDENGYKSLRDFMD A
Sbjct  9444  QEDFASWRDENGYKSLRDFMDNA  9512

 Score = 47.0 bits (110),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  84    FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGW  143
             FR VT C    TRTT RARCG TTRWC  ATTVTRSS ARTT  TTR ARARAR  GTGW
Sbjct  9583  FRLVTRCVPRDTRTTVRARCGLTTRWCSTATTVTRSSLARTTPSTTRPARARARFVGTGW  9762

Query  144   ASAS  147
             AS S
Sbjct  9763  ASVS  9774

>PHRA:scaffold_106
Length=147471

 Score = 118 bits (295),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  19     VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
              + PTADAHQIVLLPEPQWTT DKDTKYNPLAFLEN+GF  Q+DF AWR ENGYKSLRDFM
Sbjct  13428  LAPTADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFM  13249

Query  79     DRA  81
              D A
Sbjct  13248  DNA  13240

 Score = 40.8 bits (94),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  84     FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGW  143
              FR  T C    TRTT RARCGSTTRWC  A T TRSS ARTT  TTR ARARAR  GTGW
Sbjct  13169  FRPTTRCVPRDTRTTVRARCGSTTRWCSTARTATRSSLARTTPSTTRPARARARFVGTGW  12990

Query  144    ASAS  147
               S S
Sbjct  12989  VSDS  12978

 Score = 21.6 bits (44),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 8/11 (73%), Positives = 8/11 (73%), Gaps = 0/11 (0%)
 Frame = -3

Query  12     ATTFHFAVRPT  22
              A TFHF  RPT
Sbjct  13543  AITFHFGYRPT  13511

>PHSO:scaffold_5
Length=6830280

 Score = 105 bits (261),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  21      PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
               P    HQIVLLPEP WTT DK+TKYNPLAFLEN+GF  Q+DF AWR ENGYKSLRDFMDR
Sbjct  682477  PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  682298

Query  81      A  81
               A
Sbjct  682297  A  682295

 Score = 54.3 bits (129),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -1

Query  79      DRANL--FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQ  121
                RA L  FR+VT C    T TT RARCGSTTRWCWMATT TRSS+
Sbjct  682245  PRAPLSPFRKVTRCALPATPTTARARCGSTTRWCWMATTATRSSR  682111

>PHSO:scaffold_35
Length=32414

 Score = 105 bits (261),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  21     PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
              P    HQIVLLPEP WTT DK+TKYNPLAFLEN+GF  Q+DF AWR ENGYKSLRDFMDR
Sbjct  18624  PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  18445

Query  81     A  81
              A
Sbjct  18444  A  18442

 Score = 54.3 bits (129),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -1

Query  79     DRANL--FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQ  121
               RA L  FR+VT C    T TT RARCGSTTRWCWMATT TRSS+
Sbjct  18392  PRAPLSPFRKVTRCALPATPTTARARCGSTTRWCWMATTATRSSR  18258

>PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_622.1:1:14582:1 
REF
Length=14582

 Score = 122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 8/82 (10%)
 Frame = -2

Query  8     SNSLATTFHFA--------VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQ  59
             S S+A+T  F         + PTADAHQIVLLPEP WTT DKDTKYNPLAFLE +GF PQ
Sbjct  5557  SRSIASTVAFTAALSSVALLAPTADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQ  5378

Query  60    QDFKAWRDENGYKSLRDFMDRA  81
             +DFKAWR+ENGYKSLRDFMD A
Sbjct  5377  EDFKAWREENGYKSLRDFMDNA  5312

 Score = 116 bits (290),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 63/81 (78%), Gaps = 4/81 (5%)
 Frame = -1

Query  5     RTTSNSLATTFHFA----VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQ  60
             R+ +++LA T   +    + P ADAHQIVLLPEP WTT DKDTKYNPLAFLE +GF PQ+
Sbjct  4025  RSIASTLAVTTVLSSAALLAPIADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQE  3846

Query  61    DFKAWRDENGYKSLRDFMDRA  81
             DF AWR ENGYKSLRDFMD A
Sbjct  3845  DFTAWRIENGYKSLRDFMDNA  3783

 Score = 40.0 bits (92),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  78    MDRANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrhararar  137
             M   + FRR TPC    TRTTDRAR GST    W  TT TR S ARTT  TTR ARARA 
Sbjct  3730  MAHRSPFRRATPCAPRDTRTTDRARSGSTIPLRWAMTTATRRSPARTTPSTTRPARARAH  3551

Query  138   cagtGWASAS  147
               GTGWA  S
Sbjct  3550  SVGTGWACVS  3521

>PHRA:scaffold_105
Length=157074

 Score = 117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTADAHQ+VLLPEPQWTT D+DTKYNPLAFLE++GF  Q+DF +WRDENGYKSLRDFM
Sbjct  154889  LAPTADAHQVVLLPEPQWTTDDRDTKYNPLAFLESEGFTTQEDFASWRDENGYKSLRDFM  154710

Query  79      DRA  81
               D A
Sbjct  154709  DNA  154701

>PHSO:scaffold_4
Length=7609242

 Score = 110 bits (275),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -3

Query  19       VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
                + PTADAHQIVL PEPQWTT DK+TKYNPLAFLENQGF  QQDF+ WR +NGYK+LRDFM
Sbjct  4374367  LAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFM  4374188

Query  79       DRA  81
                D  
Sbjct  4374187  DHG  4374179

 Score = 110 bits (275),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  19       VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
                + PTADAHQIVL PEPQWTT DK+TKYNPLAFLENQGF  QQDF+ WR +NGYK+LRDFM
Sbjct  4364926  LAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFM  4365105

Query  79       DRA  81
                D  
Sbjct  4365106  DHG  4365114

 Score = 35.4 bits (80),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = -1

Query  84       FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
                FR  TPC    T T  RAR GSTTR C  ATT TR S
Sbjct  4374108  FRTETPCAPRATPTMVRARSGSTTRACCRATTATRRS  4373998

 Score = 35.4 bits (80),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  84       FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
                FR  TPC    T T  RAR GSTTR C  ATT TR S
Sbjct  4365185  FRTETPCAPRATPTMVRARSGSTTRACCRATTATRRS  4365295

>PHRA:scaffold_79
Length=220511

 Score = 111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  19     VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
              + PTADAHQ+VLLPEPQWTT +KDTKYNPLAFLE QGF  Q DF AWR +NGYK+LRDFM
Sbjct  26168  LAPTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFM  25989

Query  79     DRA  81
              DRA
Sbjct  25988  DRA  25980

>PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.66, whole genome shotgun 
sequence
Length=310063

 Score = 106 bits (265),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = -1

Query  10      SLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDEN  69
               ++A T   AV  T DAHQIVL PEPQWTT +KD KYNPLAFLE QGF+ Q+DF AWR +N
Sbjct  163147  AVAATLSCAVLST-DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDN  162971

Query  70      GYKSLRDFMDRA  81
               GYK+LRDFMDRA
Sbjct  162970  GYKTLRDFMDRA  162935

>PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.46, whole genome shotgun 
sequence
Length=493760

 Score = 106 bits (265),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = -3

Query  10    SLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDEN  69
             ++A T   AV  T DAHQIVL PEPQWTT +KD KYNPLAFLE QGF+ Q+DF AWR +N
Sbjct  4008  AVAATLSCAVLST-DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDN  3832

Query  70    GYKSLRDFMDRA  81
             GYK+LRDFMDRA
Sbjct  3831  GYKTLRDFMDRA  3796

>PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_761.1_contig_1:1:9298:1 
REF
Length=9298

 Score = 99.8 bits (247),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  18   AVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDF  77
             + P  DAHQIVLLPEPQW T  K+ KYNPLAFLENQGF  Q+D  AWR +NGYK+LR F
Sbjct  888  VIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAF  709

Query  78   MDRA  81
            MD A
Sbjct  708  MDMA  697

 Score = 31.2 bits (69),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 34/68 (50%), Gaps = 0/68 (0%)
 Frame = -3

Query  80   RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararca  139
            R N  +R  PC    TR     R GSTTR CW     TR S  RTT  T    +A A CA
Sbjct  638  RHNQSQRGVPCAPQATRMMVHVRSGSTTRACWKVVIATRRSLERTTPSTILPVKAPACCA  459

Query  140  gtGWASAS  147
            GTGW  AS
Sbjct  458  GTGWVFAS  435

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  19     VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
              + PTADAHQ+VLLP P +TT DKDTKY PLAFLENQGF+   DF AWR  NGYK+LR FM
Sbjct  59201  LAPTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFM  59022

Query  79     DRA  81
              D A
Sbjct  59021  DGA  59013

 Score = 93.6 bits (231),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  19     VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
              + P A+AHQ+VLLP P +TT DK TKY PLAFLE+QGF  Q+DF AWR +NGY SLR F 
Sbjct  57478  IAPIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFN  57657

Query  79     DRAN  82
              D A+
Sbjct  57658  DDAS  57669

 Score = 29.6 bits (65),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  89     PCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGWASA  146
              PC R VTR T  ARCG T RW    T  T  S ARTTL TT   R   R  G+GWASA
Sbjct  57752  PCVRRVTRMTVPARCGWTIRWSCSTTIATTPSVARTTLLTTARVRLLVRSTGSGWASA  57925

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = -2

Query  27     QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
              QIVL P P +     D +   LA+L+ QG     + + W + +GY SLR  +D   L++
Sbjct  60906  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYK  60730

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  21     PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
              P ADAHQ V+LP+P WTT D+D  Y+PLAFLENQGFK Q+DF AWR  NGYK+LR FMD
Sbjct  12422  PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  12598

 Score = 91.3 bits (225),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -1

Query  22     TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
               ADAHQ V+LP P W T DKD  Y PLAFLE+QGF  Q+DF AWR +NGY SLR FMD A
Sbjct  14934  VADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGA  14755

Query  82     N  82
              +
Sbjct  14754  S  14752

 Score = 33.9 bits (76),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  90     CDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGWASAS  147
              C    TRT+ RAR GSTTRWC   TT T  S AR T  TTR AR RAR  G+GWASA+
Sbjct  14669  CAPRGTRTSVRARSGSTTRWCCSTTTATTQSLARPTTSTTRPARPRARSTGSGWASAT  14496

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  22     TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
               ADAHQ V+LPEP WTT D+D  Y PLAFLE+QGF+  +DF AWR  NGYK+LR FMD+A
Sbjct  13545  VADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQA  13724

Query  82     N  82
              +
Sbjct  13725  S  13727

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  22    TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
              ADAHQ V+LP+P WT++D D  Y+PLAFLE+QGF  Q+DF +WR  NGY +LR FMD+A
Sbjct  9313  VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  9134

Query  82    N  82
             +
Sbjct  9133  S  9131

 Score = 73.2 bits (178),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +2

Query  21    PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
             P A AHQ+V+LP P +T + KD ++ PLAFLE Q F    DF  + D NG+ SLR FMD 
Sbjct  7574  PQAMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD  7753

Query  81    ANLF  84
              +L+
Sbjct  7754  DSLY  7765

 Score = 31.2 bits (69),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +3

Query  90    CDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
             C    TRTT RAR GSTTR C   TT  RSS
Sbjct  7845  CAPRGTRTTARARSGSTTRVCCSTTTAMRSS  7937

 Score = 45.8 bits (107),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = +2

Query  27    QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLF  84
             Q+VL P P +     D + +P+A+LE QG     + + W  E GY +LR  MD   L+
Sbjct  6485  QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLY  6658

 Score = 33.1 bits (74),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  94    VTRTTDRARCGSTTRWCWMATTVTRSSQ  121
              TR T RAR GSTTRW W A T TRSS+
Sbjct  6753  ATRWTGRARSGSTTRWRWRAATATRSSR  6836

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PT++AHQ+VLLP P +TT +KDTKY PLAFLENQG++  +DF  WR  NGYK+LRDFM
Sbjct  243519  LAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFM  243340

Query  79      DRA  81
               DRA
Sbjct  243339  DRA  243331

 Score = 87.8 bits (216),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +1

Query  1       MLHQRTTSNSLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQ  60
               M+    +S S A     A    A+AHQ+VLL  P +TT DKDTKY PLAFLE+QGF  Q+
Sbjct  241921  MVSSHVSSLSTAVVLSSATL-LANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQE  242097

Query  61      DFKAWRDENGYKSLRDFMDRAN  82
               DF AWR +NGY SLR F D A+
Sbjct  242098  DFTAWRKDNGYDSLRAFNDGAS  242163

 Score = 35.8 bits (81),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +2

Query  78      MDRANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrhararar  137
               M+  + FR  T C RL TRTT R RCG TT W    TT  + S A TT  T   AR  A 
Sbjct  242213  METFSPFRMATLCVRLGTRTTARVRCGWTTPWSCSTTTAMKPSVANTTRSTIARARPPAH  242392

Query  138     cagtGWASAS  147
                 G+GW SA+
Sbjct  242393  SIGSGWVSAT  242422

 Score = 41.2 bits (95),  Expect = 0.004, Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  27      QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
               Q+VL P P +     D +   LA+L+ QG     + ++W  ++GY SLR  +D  +L++
Sbjct  245182  QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYK  245006

>PHRA:scaffold_56
Length=334739

 Score = 92.4 bits (228),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  23      ADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRAN  82
               ADAHQ+VLLP P +TT DK TKY PLAFLE+QGF  Q+DF AWR+ENGY SLR F D A+
Sbjct  164087  ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGAS  163908

 Score = 34.7 bits (78),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  84      FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGW  143
               FR  TPC R  TRTT RAR G TT W     T TRSS ART   TT HAR  AR  G+GW
Sbjct  163840  FRTATPCARRATRTTVRARSGWTTPWSCSMITATRSSAARTIPSTTVHARPPARFTGSGW  163661

Query  144     ASAS  147
               A A+
Sbjct  163660  ACAT  163649

 Score = 92.0 bits (227),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  21      PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
               P  DAHQ+VLLP P +TT  KDTKY PLAFLENQGF+   DF AWR  NGYK+LR FMD 
Sbjct  162529  PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  162708

Query  81      A  81
               A
Sbjct  162709  A  162711

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = +2

Query  27      QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
               QIVL P P +     D +   LA+L+ QG     + + W  ++GY SLR  +D  +L++
Sbjct  160958  QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQ  161134

>PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.20, whole genome shotgun 
sequence
Length=1049362

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  21      PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
               P  +AHQ+VL P PQW T ++DT++NPLAFLE+QGFK Q+DFK+WR +NGYK+LRDFM+ 
Sbjct  363575  PLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH  363754

Query  81      A  81
               A
Sbjct  363755  A  363757

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  21     PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
              PTADAHQ+VLLP P +TT +KDTKY PLAFLE+QGFK  +DF  WR  NGYK+LR FMD 
Sbjct  94234  PTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  94055

Query  81     A  81
              A
Sbjct  94054  A  94052

 Score = 89.0 bits (219),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  23     ADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRAN  82
              ADAHQ+VLLP P +TT DK TKY PLAFLE+QGF  Q+DF AWR +NGY SLR F D A+
Sbjct  92735  ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGAS  92914

 Score = 32.7 bits (73),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +3

Query  84     FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
              FR  T C +  TRTT RA+CG T RW    TTVTR S
Sbjct  92982  FRTPTQCAQPGTRTTVRAKCGWTIRWSCSTTTVTRLS  93092

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -3

Query  27     QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
              Q+V  P P +     D +   LA+L+ QG     + ++W +++GY SLR  +D  +L++
Sbjct  95702  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQ  95526

>PHSO:scaffold_1
Length=13391543

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  21       PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
                PTADAHQ+VLLP P +TT DK TKY PLAFLENQG++  +DF AWR + GYK+LR FMD 
Sbjct  2791892  PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  2791713

Query  81       AN  82
                A+
Sbjct  2791712  AS  2791707

 Score = 87.4 bits (215),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  23       ADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRAN  82
                A AHQ+VLLP P +TT DK TKY PLAFLE+QGF  Q+DF AWR +NGY SLR F D A+
Sbjct  2790340  AGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS  2790519

 Score = 30.8 bits (68),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  80       RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararca  139
                + + FR  T C    TRTT RAR GSTT W    TT T  S ARTT  TT  A  RAR  
Sbjct  2790575  KCSPFRTTTLCAPQATRTTARARFGSTTPWSCSTTTATSPSAARTTPSTTARAPPRARST  2790754

Query  140      gtGWASAS  147
                G+GWA A+
Sbjct  2790755  GSGWACAT  2790778

 Score = 40.0 bits (92),  Expect = 0.009, Method: Composition-based stats.
 Identities = 20/65 (31%), Positives = 33/65 (51%), Gaps = 0/65 (0%)
 Frame = -1

Query  21       PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80
                P     Q+V  P P +     D +   LA+L+ QG     + ++W  E+GY SLR  +D 
Sbjct  2794100  PGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDD  2793921

Query  81       ANLFR  85
                 +L++
Sbjct  2793920  ESLYK  2793906

 Score = 26.9 bits (58),  Expect(2) = 2.0, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (42%), Gaps = 16/86 (19%)
 Frame = +2

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLE-NQGF-------KPQQD---FKAWRDENG  70
                +ADAH  +  P  Q+    K T Y      + N  F        P+ +   F +   + G
Sbjct  2592104  SADAHGYISNPAAQFVDSTKSTYYAKTITADVNSAFGGLKWDDSPEANTATFTSSFAKAG  2592283

Query  71       YKSLRDFMDR-----ANLFRRVTPCD  91
                Y SLRD +D+     AN    V+P D
Sbjct  2592284  YSSLRDMLDQQVTDCANTRTDVSPVD  2592361

 Score = 26.9 bits (58),  Expect(2) = 2.0, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (42%), Gaps = 16/86 (19%)
 Frame = -1

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLE-NQGF-------KPQQD---FKAWRDENG  70
                +ADAH  +  P  Q+    K T Y      + N  F        P+ +   F +   + G
Sbjct  2595608  SADAHGYISNPAAQFVDSTKSTYYAKTITADVNSAFGGLKWDDSPEANTATFTSSFAKAG  2595429

Query  71       YKSLRDFMDR-----ANLFRRVTPCD  91
                Y SLRD +D+     AN    V+P D
Sbjct  2595428  YSSLRDMLDQQVTDCANTRTDVSPVD  2595351

 Score = 23.5 bits (49),  Expect(2) = 2.0, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +3

Query  95       TRTTDRARCGSTTRW  109
                TRTT RAR GSTT W
Sbjct  2592420  TRTTARARSGSTTPW  2592464

 Score = 23.5 bits (49),  Expect(2) = 2.0, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -2

Query  95       TRTTDRARCGSTTRW  109
                TRTT RAR GSTT W
Sbjct  2595292  TRTTARARSGSTTPW  2595248

>PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2165, whole genome shotgun sequence
Length=94632

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 53/88 (60%), Gaps = 10/88 (11%)
 Frame = +1

Query  19     VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
              + P   AHQI+LLPEPQW T DKDTKYNPLAFLENQ F    DF  +  +N Y SLRDF+
Sbjct  34597  LAPNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL  34776

Query  79     DRANLFRRVTPCDRLVTRTTDRARCGST  106
               RAN           VT   DR  CG T
Sbjct  34777  KRANY---------TVTEGADR-DCGFT  34830

>PHSO:scaffold_64
Length=40116

 Score = 84.0 bits (206),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  35     QWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
              QWTT DK+TKYNPLAFLENQGF  QQDF+AWR +NGYK+LRDFMD  
Sbjct  37926  QWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHG  38066

 Score = 36.2 bits (82),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +1

Query  84     FRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120
              FR  TPC    T T  RAR GSTTR C  ATT TR S
Sbjct  38137  FRTETPCAPRATPTMARARSGSTTRACCRATTATRRS  38247

>PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_113, whole genome shotgun sequence
Length=380982

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  19     VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
              + P   AHQIVLLPEPQW T DKDT+YNPLAFLENQ FK   D +A+  +N +K+LRDFM
Sbjct  94671  LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  94850

Query  79     DRA  81
              D A
Sbjct  94851  DNA  94859

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  19      VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               + PTA AHQ+VLLP P +TT DKDTKY PL FLE QG++  +DF  WR  NGYK+LRDFM
Sbjct  359173  LAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFM  358994

Query  79      D  79
               +
Sbjct  358993  E  358991

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -1

Query  27      QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
               QIVL P P +     D +   LA+L+ QG     + ++W  + GY SLR  +D  +L++
Sbjct  395334  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYK  395158

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  22      TADAHQIVLLPEPQW--TTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
               T DAHQ++L PEP W     D+DT++ PLAFLE+QGF  Q DF  WR ++GYK+LRDFMD
Sbjct  488750  TVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  488929

Query  80      RANLFRRVTP  89
               RA     VTP
Sbjct  488930  RAKYTTSVTP  488959

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = -2

Query  22       TADAHQIVLLPEPQW--TTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
                TA AHQ++  PEP W     D+DT++ PLAFLE+QGF  Q+DF  WR +NGYK LRDFMD
Sbjct  1575790  TAVAHQLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMD  1575611

Query  80       RANLFRRVTP  89
                RA     VTP
Sbjct  1575610  RAKYVTSVTP  1575581

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -3

Query  22       TADAHQIVLLPEPQWT--TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
                T DAHQ++L PEP W     D+DT++  LAFLE+QGF  Q+DF  WR +NGYK LRDFMD
Sbjct  1596486  TVDAHQVMLKPEPIWKPGISDRDTRWRLLAFLESQGFPCQEDFDGWRAKNGYKDLRDFMD  1596307

Query  80       R  80
                R
Sbjct  1596306  R  1596304

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -2

Query  22       TADAHQIVLLPEPQWT--TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDF  77
                TA AHQ++  PEP W     D+DT++NPLAFLE+QGF  Q+DF  WR +NGYK LR+ 
Sbjct  1594522  TAVAHQLIQQPEPIWKPGISDRDTRWNPLAFLESQGFPCQEDFNGWRAKNGYKDLREL  1594349

>PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 
genomic scaffold, whole genome shotgun sequence
Length=4768765

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = -1

Query  26       HQIVLLPEPQWT--TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANL  83
                HQ++L PEP W     D+DT++ PLAFLE+QGF  Q DF +WR +NGYK+LRDFMDR N 
Sbjct  3545335  HQLLLEPEPIWKAGINDRDTRWRPLAFLESQGFPCQADFNSWRAQNGYKNLRDFMDRGNY  3545156

Query  84       FRRVTP  89
                   VTP
Sbjct  3545155  TTTVTP  3545138

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  23    ADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRAN  82
              DAHQ VLLPEP WT + +  ++NPLAFLENQGFK   DF+A+  + GYK+LRDFMD   
Sbjct  1045  VDAHQYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQT  1224

Query  83    LFR  85
              ++
Sbjct  1225  AYK  1233

 Score = 74.7 bits (182),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +3

Query  3     HQRTTSNSLATTFHFAVRPTA----DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKP  58
              Q+T + S+  +   AV  ++    DAHQ V LP P WT + +  ++NPLAFLE QG+K 
Sbjct  3480  QQQTMAPSITKSLVLAVAVSSAALVDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKC  3659

Query  59    QQDFKAWRDENGYKSLRDFMDRANLFR  85
               DF A+    GYK+LR FMD    ++
Sbjct  3660  TADFTAYYKSKGYKNLRGFMDDKKAYK  3740

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 5/106 (5%)
 Frame = +1

Query  2     LHQRTTSNSLA-----TTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGF  56
             LHQ+T  + +A           +   ADAHQ V +P+P WT   K T + PL+FLE  G 
Sbjct  5092  LHQQTADSMVARSLALAASAALLLSGADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGV  5271

Query  57    KPQQDFKAWRDENGYKSLRDFMDRANLFRRVTPCDRLVTRTTDRAR  102
             K  +    +  + GY +LR  MD + L++  +  D  +   TD ++
Sbjct  5272  KTSESVDGFMKDKGYSTLRALMDDSKLYKTNSNADNFLCGYTDPSK  5409

 Score = 30.8 bits (68),  Expect(2) = 2.9, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 25/60 (42%), Gaps = 0/60 (0%)
 Frame = +2

Query  25     AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLF  84
              A+  V  PEP +           +A LE+Q      D   +  + GY SLR  +D   L+
Sbjct  10781  ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  10960

 Score = 20.4 bits (41),  Expect(2) = 2.9, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 15/29 (52%), Gaps = 0/29 (0%)
 Frame = +3

Query  82     NLFRRVTPCDRLVTRTTDRARCGSTTRWC  110
              +L R+   C    T  T RAR GSTT  C
Sbjct  11019  SLSRQTASCVSQAT*RTGRARSGSTTSSC  11105

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 76.6 bits (187),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
                 ADAHQ+V+LP P +T   KD +++PLAFLENQG+K   DF A+    GYKSLR FMD  
Sbjct  1298017  VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  1298196

Query  82       NLFR  85
                  ++
Sbjct  1298197  KAYK  1298208

 Score = 31.6 bits (70),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  95       TRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrharararcagtGWASAS  147
                TRTT RARCGSTT       TVTR+S AR T   TR ARARARCAGTGWASAS
Sbjct  1298297  TRTTVRARCGSTTPRSCRVPTVTRTSPARPTP*ATRRARARARCAGTGWASAS  1298455

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
                +ADAHQ V+LP P +T + +  ++NPLAFLENQGFK   DF A+    GYKSLR FMD  
Sbjct  1288622  SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDK  1288801

Query  82       NLFRRVTPCD  91
                  ++     D
Sbjct  1288802  KAYKVAAGAD  1288831

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
                TADAHQ V+LP P +T + +  ++NPLAFLENQGF+   DF A+    GYK+LR FMD  
Sbjct  1295883  TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDK  1296062

Query  82       NLFRRVTPCD  91
                  +   +  D
Sbjct  1296063  KAYTVASGAD  1296092

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
                +ADAHQ V+LP P +T + +  ++NPLAFLENQG+K   DF A+    GYK+LR FMD  
Sbjct  1294346  SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDP  1294525

Query  82       NLFRRVTPCD  91
                  ++     D
Sbjct  1294526  KAYKVAAGAD  1294555

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 4/89 (4%)
 Frame = +1

Query  1        MLHQRTTSNS----LATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGF  56
                +LH+   + S    LA T   A     DAHQ+++ PEP +    KD ++ PLAFLENQG 
Sbjct  1299406  ILHKPPMAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV  1299585

Query  57       KPQQDFKAWRDENGYKSLRDFMDRANLFR  85
                    D   +  + GY +LR  MD   L+ 
Sbjct  1299586  NTSADVAGFMKQKGYANLRALMDDEKLYE  1299672

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +3

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
                T  AHQ V +P+P WT   K T + PL+FLE  G K       +  E GY +LRD MD  
Sbjct  1300986  TVYAHQAVEVPKPNWTVPKKATYWAPLSFLEKNGVKTSASVNGFMKEKGYNTLRDLMDDQ  1301165

Query  82       NLFRRVTPCDRLVTRTTDRAR  102
                 L++  +  D  +   TD  +
Sbjct  1301166  KLYKVNSNADNFLCGYTDPTK  1301228

 Score = 43.1 bits (100),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 29/61 (48%), Gaps = 0/61 (0%)
 Frame = -3

Query  25       AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLF  84
                A   VL PEP +     + +  P+A LE QG K   D   +  + GY +LR  +D   L+
Sbjct  1303097  AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  1302918

Query  85       R  85
                 
Sbjct  1302917  N  1302915

 Score = 21.9 bits (45),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -1

Query  99       DRARCGSTT  107
                DRARCGSTT
Sbjct  1302808  DRARCGSTT  1302782

 Score = 33.1 bits (74),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = +3

Query  75       RDFMDRANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSSQarttlwttrhara  134
                R+ M+ A+ F+ +    RLVT TT  ARCGSTT     ATT TRSSQAR T   T  ARA
Sbjct  1288848  RNSMESASRFQ-LARSVRLVTPTTVHARCGSTTPL**RATTATRSSQARRTRSVTLRARA  1289024

Query  135      rarcagtGWASAS  147
                RARCAGTGW  AS
Sbjct  1289025  RARCAGTGWVFAS  1289063

>PHSO:scaffold_11
Length=2192408

 Score = 70.9 bits (172),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  38       TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
                 +DKDTKYNPLAFLE QGF  Q+ F A R +NGYK+LRDFMDR 
Sbjct  2022897  VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRG  2022766

 Score = 33.1 bits (74),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  23       ADAHQIVLLPEPQWTTQDKDT  43
                ADAHQ+VL PEPQW T+   T
Sbjct  2022935  ADAHQVVLQPEPQWRTKIPST  2022873

>PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5024:1:718:1 
REF
Length=718

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  22   TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
            + DAHQ V+LP P +T  DK+  +NPLAFLENQG+K   DF  +    GYK+LR FMD  
Sbjct  145  SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  324

Query  82   NLFR  85
              ++
Sbjct  325  KAYK  336

>PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2249:1:3349:1 
REF
Length=3349

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -3

Query  22    TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
             + DAHQ V+LP P +T + +  ++NPLAFLENQGFK   DF A+    GYK+LR FMD  
Sbjct  1925  SVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDK  1746

Query  82    NLFR  85
             + ++
Sbjct  1745  SAYK  1734

>PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4828:1:781:1 
REF
Length=781

 Score = 74.3 bits (181),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +3

Query  22   TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQ-GFKPQQDFKAWRDENGYKSLRDFMDR  80
            TA AHQ+V+LP+P WT + K  ++ P+A+LE Q GF P  DF  +    G+K++R+FMD 
Sbjct  108  TARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDN  287

Query  81   ANLFRRVTPCD  91
              L+R V+  D
Sbjct  288  DKLYRPVSDAD  320

>PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_560:1:21458:1 
REF
Length=21458

 Score = 62.8 bits (151),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  22    TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
             + DAHQ V +P P +T  D++  +NPLAFLENQG K   D   +    G K+LRD+MD
Sbjct  8574  SVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMD  8401

 Score = 38.1 bits (87),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -1

Query  80    RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTVT  117
             RA+LFRR   C R  TRTT   R GSTTR C  AT  T
Sbjct  8330  RASLFRRTA*CVRPATRTTAHVRSGSTTRACSAATLAT  8217

 Score = 58.5 bits (140),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = -1

Query  26     HQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD-RAN  82
              HQ + +P P  TT D++T  NPLAFLENQG K   D   +  + G K+LRDFMD +AN
Sbjct  11303  HQRITIPAPTLTT-DRNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKAN  11133

 Score = 34.7 bits (78),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 18/30 (60%), Gaps = 0/30 (0%)
 Frame = -2

Query  81     ANLFRRVTPCDRLVTRTTDRARCGSTTRWC  110
               N F R   C RLVTRTT R R GS TR C
Sbjct  11071  VNQFHRTA*CARLVTRTTARVRFGSITREC  10982

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  24     DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANL  83
              +AHQ V  PE  +T  D+ T + P A LENQG+K  +DF A+   NGYK+LRDFMD+   
Sbjct  12575  EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  12754

Query  84     FR  85
              ++
Sbjct  12755  YK  12760

>PHSO:scaffold_12
Length=2105860

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -3

Query  18      AVRPTADAHQIVLLPEPQWT-----TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYK  72
               A+   A+AHQ+V +P P WT       ++   +NPLAFLENQGF+ Q +F  ++ +NGYK
Sbjct  168932  ALVLQAEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTQ*NFTQYQVDNGYK  168753

Query  73      SLRDFMDRA  81
               SLRDFMD A
Sbjct  168752  SLRDFMDNA  168726

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 5/65 (8%)
 Frame = -2

Query  22      TADAHQIVLLPEPQWT-----TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRD  76
               + +AHQ+V +P P WT       ++   +NPL+FLE +GFK Q++F  ++ +NGYKSLRD
Sbjct  167619  SVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  167440

Query  77      FMDRA  81
               FM+RA
Sbjct  167439  FMERA  167425

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 49/88 (56%), Gaps = 15/88 (17%)
 Frame = -1

Query  22      TADAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRD  76
               + DAHQ+V +P P WT  +  +      + PLAFLE QGF  Q +F  +  +NGYKSLRD
Sbjct  162424  SVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRD  162245

Query  77      FMDRANLFRRVTPCDRLVTRTTDRARCG  104
               FMD  N           VT+  D+A CG
Sbjct  162244  FMDNGNYS---------VTKGADQA-CG  162191

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 56/127 (44%), Gaps = 27/127 (21%)
 Frame = -1

Query  17      FAVRPTAD-AHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENG  70
               F + P    A+Q+V +P P WT  +  T      + PLA+ E+QGF    +F  W+  NG
Sbjct  210562  FVLHPAITRANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNG  210383

Query  71      YKSLRDFMDRANL---------------------FRRVTPCDRLVTRTTDRARCGSTTRW  109
               +K+LRDFMD  N                      F+ +T C    T  T  AR G T  W
Sbjct  210382  FKTLRDFMDNGNYSVTSGAD*ACGWTDLKGVRNRFQTITSCAHTATPVTAHARSGWTIPW  210203

Query  110     CWMATTV  116
                  A TV
Sbjct  210202  PTPALTV  210182

 Score = 31.2 bits (69),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 33/80 (41%), Gaps = 26/80 (33%)
 Frame = +2

Query  21     PTADAHQIVLLPE----------------PQWTTQDKDTKYNPLAFLENQGFKPQQDFKA  64
              P+ADAH  +L+PE                P WT+ D D          N G      FKA
Sbjct  95060  PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDG--------NNAG--SVDAFKA  95209

Query  65     WRDENGYKSLRDFMDRANLF  84
               +  N +K L+  MD  +++
Sbjct  95210  LKTANNFKDLKTLMDDTSVY  95269

>PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.39, whole genome shotgun 
sequence
Length=634653

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 5/63 (8%)
 Frame = +3

Query  24      DAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               +AHQ+V +P P WT  +  +K     +NPL+FLE +GFK Q++F  ++ +NGYKSLRDFM
Sbjct  149850  EAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFM  150029

Query  79      DRA  81
               DRA
Sbjct  150030  DRA  150038

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 52/86 (60%), Gaps = 9/86 (10%)
 Frame = +3

Query  1       MLHQRTTSNSLATTFHFAVRPTADAHQIVLLPEPQWT-----TQDKDTKYNPLAFLENQG  55
               ML   T+   L++T     +    AHQ+V +P P WT     + ++   +NPL+FLE +G
Sbjct  150975  MLTTFTSVAVLSSTLLLQTQ----AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEG  151142

Query  56      FKPQQDFKAWRDENGYKSLRDFMDRA  81
               +  Q++F  ++ +NGYKSLRDFMD A
Sbjct  151143  YTTQENFTQYQVDNGYKSLRDFMDNA  151220

 Score = 27.3 bits (59),  Expect(2) = 3.3, Method: Composition-based stats.
 Identities = 21/79 (27%), Positives = 32/79 (41%), Gaps = 24/79 (30%)
 Frame = +2

Query  21     PTADAHQIVLLPEPQ--------WTTQ-------DKDTKYNPLAFLENQGFKPQQDFKAW  65
              P+ +AH  +L+PE Q        W  Q       DK    NP         K    FK+ 
Sbjct  68648  PSVEAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNP---------KSVDTFKSL  68800

Query  66     RDENGYKSLRDFMDRANLF  84
              +  N +K L+  MD  +++
Sbjct  68801  KAANNFKDLKTLMDDTSVY  68857

 Score = 22.7 bits (47),  Expect(2) = 3.3, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +3

Query  98     TDRARCGSTTRWCWMATT  115
              T RA  GSTTRWC   TT
Sbjct  68949  TVRAGFGSTTRWCSTRTT  69002

>PHCA:scaffold_67 PHYCAscaffold_67
Length=292061

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 52/78 (67%), Gaps = 5/78 (6%)
 Frame = -1

Query  9       NSLATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFK  63
               ++LA      +  + +AHQ+V +P P WT  +  +K     +NPL+FLE +GFK Q++F 
Sbjct  220901  STLAVIGSSMLLQSTEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFT  220722

Query  64      AWRDENGYKSLRDFMDRA  81
                ++ +NGYKSLRDFM++A
Sbjct  220721  QYQVDNGYKSLRDFMEKA  220668

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (70%), Gaps = 5/63 (8%)
 Frame = -1

Query  24      DAHQIVLLPEPQWT-----TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
               +AHQ+V +P P WT     + ++   +NPL+FLE +G+  Q++F  ++ +NGYK+LRDFM
Sbjct  219848  EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  219669

Query  79      DRA  81
               D A
Sbjct  219668  DNA  219660

>PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 
genomic scaffold, whole genome shotgun sequence
Length=3552875

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = -2

Query  24       DAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM  78
                +AHQ+V +P P WT  +  +K     +NPL+FLE +GFK Q++F  ++ +NGYKSL DFM
Sbjct  2748895  EAHQVVNVPSPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLLDFM  2748716

Query  79       DRA  81
                DRA
Sbjct  2748715  DRA  2748707

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = -1

Query  25       AHQIVLLPEPQWT-----TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
                AHQ+V +P P WT     ++++   +NPL+FLE +    Q++F  ++ +NGYKSLRDFMD
Sbjct  2722874  AHQVVYVPSPTWTRVNATSKERRVLWNPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD  2722695

 Score = 30.0 bits (66),  Expect(2) = 3.3, Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 32/73 (44%), Gaps = 6/73 (8%)
 Frame = -2

Query  18       AVRPTADAHQIVLLPEPQWTTQDKD---TKYNPL---AFLENQGFKPQQDFKAWRDENGY  71
                A  P  DAH  +L+PE Q+          + +P+      +    K    FK+ +  N +
Sbjct  2828149  ASIPNVDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNAKSVDTFKSLKAANNF  2827970

Query  72       KSLRDFMDRANLF  84
                K LR  MD  +++
Sbjct  2827969  KDLRTLMDDTSVY  2827931

 Score = 19.6 bits (39),  Expect(2) = 3.3, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)
 Frame = -3

Query  89       PCDRLVTRTTDRARCGSTTRW  109
                P   ++  T  RA  GSTTRW
Sbjct  2827866  PPSLVLLCTMARAGSGSTTRW  2827804

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  24      DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANL  83
               +AHQ+VL+P+P +  + K  ++NPLAFLE+Q F    DF A+   N Y SLR FM+ + L
Sbjct  110459  EAHQLVLIPKPTYIIEGKQNQWNPLAFLEDQSFPTTADFNAYLTANKYTSLRAFMNNSTL  110638

Query  84      F  84
               +
Sbjct  110639  Y  110641

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = +2

Query  25      AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLF  84
               AHQ V +P+P WT   K T + PL+FLE  G K       +  E GY +LR  MD + L+
Sbjct  108800  AHQAVEVPKPNWTLPKKATYWAPLSFLEKNGVKTSASVDGFMKEKGYSTLRALMDDSKLY  108979

Query  85      RRVTPCDRLVTRTTD  99
               +  +  D  +   TD
Sbjct  108980  KVNSNADNFLCGYTD  109024

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +2

Query  25      AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLF  84
               AHQ ++ PEP +    +D ++ PLAFLENQ      DF  +  + GY +LR  MD   L+
Sbjct  107045  AHQKLIYPEPFFLVDGQDMQWQPLAFLENQKINTSADFAGFLKQKGYANLRAMMDDEKLY  107224

Query  85      R  85
                
Sbjct  107225  E  107227

>PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_354.1_contig_1:1:38044:1 
REF
Length=38044

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 5/65 (8%)
 Frame = +1

Query  22     TADAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRD  76
              T +AHQ+V +P P WT  +  +K     +NPL+FLE +G K Q++F  ++ +N Y SLRD
Sbjct  14305  TTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRD  14484

Query  77     FMDRA  81
              FMD+A
Sbjct  14485  FMDKA  14499

>PHRA:scaffold_33
Length=496317

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 5/64 (8%)
 Frame = +1

Query  23      ADAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRDF  77
               A+AHQ+V +P P WT  +  +      +NPL+FLE +GF+ Q++F  ++ +NGY SLRDF
Sbjct  370567  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  370746

Query  78      MDRA  81
               +D+A
Sbjct  370747  LDKA  370758

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 5/65 (8%)
 Frame = -1

Query  23      ADAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRDF  77
               A+AHQ+V +P P WT  +  +      +NPL+FLE +GF+ Q++F  ++ +NGY SLRDF
Sbjct  175914  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  175735

Query  78      MDRAN  82
               +D+A 
Sbjct  175734  LDKAK  175720

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 5/65 (8%)
 Frame = -1

Query  23      ADAHQIVLLPEPQWTTQDKDTK-----YNPLAFLENQGFKPQQDFKAWRDENGYKSLRDF  77
               A+AHQ+V +P P WT  +  +      +NPL+FLE +GF+ Q++F  ++ +NGY SLRDF
Sbjct  171555  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  171376

Query  78      MDRAN  82
               +D+A 
Sbjct  171375  LDKAK  171361

>PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 
genomic scaffold, whole genome shotgun sequence
Length=4722445

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = -1

Query  22       TADAHQIVLLPEPQWT--TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENG  70
                TA AHQ++  PEP W     D+DT++ PLAFLE+QGF  Q+DF  WR +NG
Sbjct  2838220  TAVAHQLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNG  2838068

 Score = 33.5 bits (75),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = -1

Query  80       RANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMATTV  116
                R  L   V P  R V    DRAR GSTTRWC+  TTV
Sbjct  3772705  RKTLLPTVRPPSRAVLCMLDRARSGSTTRWCFRTTTV  3772595

>PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3459:1:3265:1 
REF
Length=3265

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  24    DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANL  83
             +AHQ V LP+  +T  +++T + P A LE QG+K   DF A+   N YK+LR+FMD+   
Sbjct  2071  EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  2250

Query  84    FR  85
             ++
Sbjct  2251  YK  2256

>PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 
genomic scaffold, whole genome shotgun sequence
Length=1472

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = -3

Query  25   AHQIVLLPEPQWT-----TQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79
            AHQ+V +P P WT     ++++   +NPL+FLE +    Q++F  ++ +NGYKSLRDFMD
Sbjct  750  AHQVVYVPSPTWTRVNATSKERRVLWNPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD  571

>PHRA:scaffold_494
Length=11395

 Score = 45.8 bits (107),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  48    LAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
             L+FLE +GF+ Q++F  ++ +NGY SLRDF+D+A
Sbjct  8560  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKA  8459

 Score = 28.1 bits (61),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -2

Query  23    ADAHQIVLLPEPQWT  37
             A+AHQ+V +P P WT
Sbjct  8622  AEAHQVVCIPSPTWT  8578

>PHRA:scaffold_2892
Length=2014

 Score = 45.8 bits (107),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  48    LAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81
             L+FLE +GF+ Q++F  ++ +NGY SLRDF+D+A
Sbjct  1924  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKA  1823

 Score = 26.6 bits (57),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
 Frame = -2

Query  23    ADAHQIVLLPEPQWT  37
             A+ HQ+V +P P WT
Sbjct  1986  AEVHQVVCIPSPTWT  1942

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = +2

Query  27      QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
               Q+VL P P +   D   +   LA+L+ QG     + ++W+ E+GY SLR  +D  +L+ 
Sbjct  161237  QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYH  161413

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 42.7 bits (99),  Expect = 0.001, Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = -2

Query  27       QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85
                Q+VL P P +     D +   LA+LE QG     + ++W  ++ Y SLR  +D   L++
Sbjct  1847006  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  1846830

>PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:pug:scf1117875582029:1:1550222:1 
REF
Length=1550222

 Score = 26.9 bits (58),  Expect(2) = 0.36, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 27/69 (39%), Gaps = 13/69 (19%)
 Frame = +2

Query  22      TADAHQIVLLPEPQW-----TTQDKDTKYNPLAFLENQGFKPQQD--------FKAWRDE  68
               TADAH  + LP+P W     T     T   P       G     D         KA++ +
Sbjct  490181  TADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQ  490360

Query  69      NGYKSLRDF  77
                 YKSL+D 
Sbjct  490361  TKYKSLKDL  490387

 Score = 26.6 bits (57),  Expect(2) = 0.36, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (59%), Gaps = 2/34 (6%)
 Frame = +3

Query  85      RRVTPCDR--LVTRTTDRARCGSTTRWCWMATTV  116
               R  TPC    L+TRT   A+CG+TT WC   TT 
Sbjct  490467  RSQTPCSGTDLITRTWALAKCGATT*WCSRTTTA  490568

>PHSO:scaffold_3
Length=10773376

 Score = 34.7 bits (78),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 16/86 (19%)
 Frame = -2

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLE-NQGFK-------PQQDFKAWRDE---NG  70
                T  AH  +  P+  + +  + TKYN L     N+GF        P+ + KA+ D     G
Sbjct  6431499  TVHAHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATG  6431320

Query  71       YKSLRDFM-----DRANLFRRVTPCD  91
                YKSLR+ +     D  +  +  TP D
Sbjct  6431319  YKSLREMLDPIAPDYGHSLKTATPVD  6431242

 Score = 31.2 bits (69),  Expect = 9.2, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 11/69 (16%)
 Frame = -1

Query  22       TADAHQIVLLPEPQWTTQDKDTKYNPLAFLE-NQGFK-------PQQDFKAWRDE---NG  70
                T  AH  +  P+  + +  + TKYN L     N+GF        P+ + KA+ D     G
Sbjct  6433894  TVHAHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATG  6433715

Query  71       YKSLRDFMD  79
                YKSLR+ +D
Sbjct  6433714  YKSLREMLD  6433688

>APIN:scaffold_63 supercont1.63 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.63:1:128505:1 
REF
Length=128505

 Score = 34.7 bits (78),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (52%), Gaps = 1/60 (2%)
 Frame = +3

Query  46     NPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFRRVTPCDRLVTRTTDRARCGS  105
              N +  +   G     D+++W    G    +D++ RA   RR+T CDR V+  + RAR GS
Sbjct  29838  NNICTISAFGGTQGHDYRSWFAYLGAARRQDYIPRA-TGRRITSCDRTVSTGSKRARRGS  30014

>PHKE:scaffold_1486 scf_22126_1486.1_contig_1 dna:supercontig 
supercontig:PhyKer238_432v1:scf_22126_1486.1_contig_1:1:1233:1 
REF
Length=1233

 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (7%)
 Frame = -3

Query  28   IVLLPEPQWTTQDK---DTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRAN  82
            IV    P WT  D    + +  P + LE+QG     +F   + +NGY +L DFMD  N
Sbjct  238  IVYARAPTWTAADSTQVERRTRP-SNLEDQGIYITVNFAQ*QIDNGYTTLLDFMDSGN  68

>PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 
genomic scaffold, whole genome shotgun sequence
Length=80461

 Score = 33.5 bits (75),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  59     QQDFKAWRDENGYKSLRDFMDRA  81
              Q++F  ++ +NGYKSL DFMDRA
Sbjct  80448  QENFTQFQVDNGYKSLLDFMDRA  80380

>PYIW:scaffold_78 piw_scaffold_78 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_78:1:33253:1 
REF
Length=33253

 Score = 33.5 bits (75),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 5/43 (12%)
 Frame = -1

Query  3     HQRTTSNSLATTFHFAVRP-----TADAHQIVLLPEPQWTTQD  40
             H+R+   S AT +HF V P     T  A Q+ ++P+P+ T Q+
Sbjct  3040  HERSGLCSCATCYHFRVSPHRNRSTCGAEQVSVVPDPRVTRQE  2912

>PYIR:scaffold_775 pir_scaffold_775 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_775:1:15870:1 
REF
Length=15870

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (5%)
 Frame = -2

Query  50    FLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFRRVTPCDRLVTRTTDRARCGSTTRW  109
              L N   +     +  R     +SLR F++R++  R   PC RL  RTT   R   +T W
Sbjct  4271  VLSNAAGRCCNRLRKSRST*RARSLRTFVERSSSGR-SPPCRRLSARTT*HPR--RSTLW  4101

Query  110   CWMA  113
             CW+A
Sbjct  4100  CWLA  4089

>PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3542:1:2951:1 
REF
Length=2951

 Score = 32.7 bits (73),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 11/70 (16%)
 Frame = -3

Query  22    TADAHQIVLLPEPQWTTQDKDTKYNP-LAFLENQGFK-------PQQD---FKAWRDENG  70
             +A+AH  V  P+ Q+T     T ++       N+GF        P+Q+   F A   + G
Sbjct  1890  SAEAHGFVSQPKAQYTGGGSYTSFSAEFTASVNKGFSGYIFNRSPEQNVQQFTAAWSKTG  1711

Query  71    YKSLRDFMDR  80
             YKSL++ MD+
Sbjct  1710  YKSLKELMDK  1681

>PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.19, whole genome shotgun 
sequence
Length=1020763

 Score = 27.3 bits (59),  Expect(2) = 2.7, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 35/86 (41%), Gaps = 16/86 (19%)
 Frame = +2

Query  22     TADAHQIVLLPEPQWTTQDKDTKY-NPLAFLENQGF-------KPQQD---FKAWRDENG  70
              +ADAH  V  P  Q+      TKY   +    N  F        P+ +   F +     G
Sbjct  49292  SADAHGYVSKPAAQFVDPSSSTKYVKTITADVNSAFGGLKWDDSPEANAATFTSSFANAG  49471

Query  71     YKSLRDFMDR-----ANLFRRVTPCD  91
              Y SLRD +D+     AN    V+P D
Sbjct  49472  YSSLRDMLDQQVTDCANTRTDVSPVD  49549

 Score = 23.1 bits (48),  Expect(2) = 2.7, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +3

Query  95     TRTTDRARCGSTTRW  109
              TRTT RAR GSTT W
Sbjct  49608  TRTTVRARFGSTTLW  49652

>PHSO:scaffold_2
Length=11587142

 Score = 32.7 bits (73),  Expect = 3.0, Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 39/113 (35%), Gaps = 20/113 (18%)
 Frame = -2

Query  17       FAVRPTADAHQIVLLPEPQWTTQ---------DKDTKYNPLAFLE---NQGFKPQQD---  61
                F   P  D H   + P P  T Q         D+     P   LE       +PQ D   
Sbjct  4552372  FVGLPATDGHAAAVFPAPSITNQQHVRHRCSTDQPAASGPRNLLEAWIRVVSRPQHDGDD  4552193

Query  62       ----FKAWRDENGYKSLRDFMDRANLFRRVTPCDRLVTRTTDRARCGSTTRWC  110
                    F      NG++ LRD   R     R+ PC R + R TD  R      WC
Sbjct  4552192  AACRFSGGIGTNGHEWLRD-AARVCDEPRILPC*RYLRRRTDSVRHEPVHVWC  4552037

>PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_499.1_contig_1:1:23234:1 
REF
Length=23234

 Score = 32.3 bits (72),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 44/113 (39%), Gaps = 18/113 (16%)
 Frame = -2

Query  11     LATTFHFA-VRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLE-NQGF-------KPQQD  61
              LA+   FA +  +  +H  +  P+  +      T YN L     N+GF        P Q+
Sbjct  14656  LASVLLFASLAASVQSHGYISKPKASYKPNTIYTTYNKLTGASINKGFDGGHYNWSPTQN  14477

Query  62     FKAWRDE---NGYKSLRDFMDRANLFRRVTPCDRLVTRTTDRARCGSTTRWCW  111
               +A++D     GYKSLRD +D       + P       T D       T   W
Sbjct  14476  AQAFKDHWNATGYKSLRDMLD------PIAPGYGFSLETADPVNVAGYTEMWW  14336

>PHCA:scaffold_22 PHYCAscaffold_22
Length=843021

 Score = 32.0 bits (71),  Expect = 5.4, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 6/70 (9%)
 Frame = +1

Query  21      PTADAHQIVLLPEPQWTTQDKD---TKYNPLAFLEN-QGFKPQQ--DFKAWRDENGYKSL  74
               P+ DAH  +L+PE Q+          + +P+   E+  G KP     FKA +  N +K L
Sbjct  396463  PSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVDAFKALKTANNFKDL  396642

Query  75      RDFMDRANLF  84
               +  MD  +++
Sbjct  396643  KTLMDDTSVY  396672

>PYVX:scaffold_230 pve_scaffold_230 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_230:1:35647:1 
REF
Length=35647

 Score = 31.6 bits (70),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +3

Query  18     AVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWR  66
              A RP   A ++ LLPE   T Q K  +  PL  LE +GFK  +  K  R
Sbjct  22395  ASRPVLHA-RLCLLPENSATKQAKSRQSLPLVSLEGRGFKDLRPRKGRR  22538

>PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3060, whole genome shotgun sequence
Length=3267112

 Score = 31.6 bits (70),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 27/55 (49%), Gaps = 11/55 (20%)
 Frame = -3

Query  35      QWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFRRVTP  89
               +WTTQ   +K N +A LEN    P +D       N    LR  +  +++ RR TP
Sbjct  869630  RWTTQASSSKRNAIASLEN----PSRD-------NSRSCLRCSIKHSSMIRRTTP  869499

>PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.460, whole genome 
shotgun sequence
Length=3430

 Score = 31.6 bits (70),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (49%), Gaps = 6/70 (9%)
 Frame = -3

Query  21   PTADAHQIVLLPEPQWTTQDKD---TKYNPLAFLEN-QGFKPQ--QDFKAWRDENGYKSL  74
            P  DAH  +L+PE Q+          + +P+   E+  G KP     FKA +  N +K L
Sbjct  830  PNTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVDAFKALKTANNFKDL  651

Query  75   RDFMDRANLF  84
            +  MD  +++
Sbjct  650  KTLMDDTSVY  621

>PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_976:1:12025:1 
REF
Length=12025

 Score = 31.2 bits (69),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 38/82 (46%), Gaps = 13/82 (16%)
 Frame = +3

Query  11    LATTFHFAVRPTADAHQIVLLPEPQWTTQDKDTKYNP-LAFLENQGF-------KPQQD-  61
             L TT       +A+AH  +  P+ Q+T     T YN       N+ F        P+Q+ 
Sbjct  6699  LTTTAMLLAPESAEAHGFLSQPKAQYTGGASYTSYNAEFTASVNKAFAGRPFNWSPEQNT  6878

Query  62    ---FKAWRDENGYKSLRDFMDR  80
                 +AW  + GYKSLR+ MD+
Sbjct  6879  AQFTEAW-PKTGYKSLRELMDK  6941

>PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 
genomic scaffold, whole genome shotgun sequence
Length=4595942

 Score = 31.2 bits (69),  Expect = 9.4, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 6/70 (9%)
 Frame = -1

Query  21       PTADAHQIVLLPEPQWTTQDKDT---KYNPLAFLEN-QGFKPQ--QDFKAWRDENGYKSL  74
                P+ DAH  +L+PE Q+          + +P+   E+  G KP     FKA +  N +K L
Sbjct  2065442  PSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVNAFKALKTANKFKDL  2065263

Query  75       RDFMDRANLF  84
                +  MD  +++
Sbjct  2065262  KTLMDDTSVY  2065233

Lambda      K        H        a         alpha
   0.321    0.129    0.421    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14458857272

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40