Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHSO:scaffold_1279358827940251467892e-96
PHPA:scaffold_632446882451251467081e-85
PHRA:scaffold_561610151614521467072e-85
PHIF:NW_003303697.13948403952771467037e-85
PHKE:scaffold_9860415608491456879e-83
PHCA:scaffold_8495232956451386842e-82
PLHA:NW_020189861.1184651818469491446243e-74
HYAP:scaffold_591612971617341465997e-71
PYVX:scaffold_275654869731425627e-66
PYIR:scaffold_81071141075451444861e-55
PYUU:scaffold_2037129955912999901444833e-55
PYIR:scaffold_2249143118471394261e-47
PHPA:scaffold_226854416858691444181e-46
PYIW:scaffold_71110847112841464145e-46
PHCA:scaffold_79054509058781444137e-46
PHSO:scaffold_148187998192271444067e-45
PHRA:scaffold_267941198241394058e-45
PHIF:NW_003303730.16969896974021394031e-44
PHRA:scaffold_10612928133411394022e-44
PYIR:scaffold_50242236361393762e-44
PHSO:scaffold_3518115185461454004e-44
PHSO:scaffold_56819686823991454004e-44
PLHA:NW_020187034.194758951801423872e-42
PHRA:scaffold_7925671260811393846e-42
PHPA:scaffold_203636563640811433722e-40
PHPA:scaffold_661626111630361433713e-40
PHPA:scaffold_46347238971433713e-40
PHKE:scaffold_622347138841393696e-40
PHKE:scaffold_7613857981393696e-40
PLHA:NW_020189073.134684351061423688e-40
PYAR:scaffold_3459214625651403608e-39
PYAP:scaffold_56012650130691403582e-38
PYIR:scaffold_48281866081413364e-38
PHCA:scaffold_672203412207691443441e-36
PHPA:scaffold_391499371503621433422e-36
PHSO:scaffold_121684171688271383397e-36
PHKE:scaffold_35414398148081383352e-35
PHRA:scaffold_333706573710671383343e-35
PHPA:scaffold_164888344892591423105e-32
PHIF:NW_003303741.1157528115757061423071e-31
PHIF:NW_003303754.1354483835452631423052e-31
PHSO:scaffold_6437965383121173019e-31
PHSO:scaffold_4437393343742801172982e-30
PHIF:NW_003303626.1267298267555862842e-28
PHSO:scaffold_1120225952022867972123e-26
PHRA:scaffold_49481518297491767e-25
PHRA:scaffold_289215151661491767e-25
PYAP:scaffold_18217401961741791e-21
PHRA:scaffold_92179812183611342295e-21
PHRA:scaffold_43331263335151362261e-20
PYAP:scaffold_1129364340051322181e-19
PHCA:scaffold_241719841723731372181e-19
PHKE:scaffold_221223526301382111e-18
PHSO:scaffold_2255977125601511332073e-18
PHPA:scaffold_5102059610209851362074e-18
PHCA:scaffold_931443791447411272041e-17
PHCA:scaffold_9881206816011382022e-17
PHSO:scaffold_165511275515011312013e-17
PHIF:NW_003303753.1377241937727781262003e-17
PYAP:scaffold_216172421041391995e-17
PHKE:scaffold_949266930191231995e-17
PLHA:NW_020187210.15496945500651301987e-17
PHCA:scaffold_501509931513701311977e-17
PHRA:scaffold_294725334729041291933e-16
PHPA:scaffold_44933034936651261924e-16
PHRA:scaffold_891241881245081111881e-15
PHKE:scaffold_15541090414671321881e-15
PHRA:scaffold_1234452248421111872e-15
PHRA:scaffold_41812499128191111862e-15
PYIW:scaffold_70031834971161813e-15
PHIF:NW_003303752.1206492120652801261863e-15
PHCA:scaffold_223992763996591341853e-15
PHKE:scaffold_25044932452821221854e-15
PYVX:scaffold_563959099521331845e-15
PHPA:scaffold_123927353930551111845e-15
PHSO:scaffold_104549894553511261835e-15
PHIF:NW_003303738.1105848710588491261836e-15
PHIF:NW_003303747.127044942704661561836e-15
PYIR:scaffold_155250028621231802e-14
PHCA:scaffold_23825133828331111802e-14
SAPA:scaffold_311327781331131231802e-14
PYIR:scaffold_15247816481511201792e-14
PHSO:scaffold_155732545736281351774e-14
PYVX:scaffold_1211743517647711386e-14
PYVX:scaffold_639199723051081766e-14
PYAP:scaffold_28914391146781011766e-14
PYAR:scaffold_88372240451191757e-14
PHRA:scaffold_5138360387401331757e-14
PHIF:NW_003303743.1148099414813741331758e-14
APAS:scaffold_331214841218611361758e-14
PHPA:scaffold_95383275386711211731e-13
PYIR:scaffold_1319561159341191722e-13
PYIW:scaffold_1535654969141281722e-13
PHRA:scaffold_13195992963601341722e-13
PHKE:scaffold_39928126284881271722e-13
PHKE:scaffold_2237256376361331703e-13
PHIF:NW_003303506.1199523721311695e-13
PYAR:scaffold_67472687540961695e-13
PHCA:scaffold_401087221090691271687e-13
PHCA:scaffold_116492276495591171687e-13
PYIR:scaffold_582133591251617e-13
PHKE:scaffold_7252792531511271678e-13
PYUU:scaffold_20367131937134951121661e-12
SADI:scaffold_13455296556311231652e-12
HYAP:scaffold_17636793371011071652e-12
PYVX:scaffold_8941915561261642e-12
PHKE:scaffold_11515529081301642e-12
PHRA:scaffold_521024061027471201643e-12
PYUU:scaffold_20294738024741551261633e-12
PLHA:NW_020187244.1202279120231411221615e-12
PYVX:scaffold_25103937401351606e-12
PYIR:scaffold_87112411127761281607e-12
SAPA:scaffold_194645984649481351608e-12
SADI:scaffold_264153719201461591e-11
PHRA:scaffold_3131444914733991581e-11
PYUU:scaffold_14021595701599081301581e-11
PHRA:scaffold_2877527778411091581e-11
PYVX:scaffold_38525718260801271572e-11
APIN:scaffold_11823092823277661472e-11
PYAP:scaffold_583634467181401563e-11
PLHA:NW_020189511.14309604313251281563e-11
APIN:scaffold_99107799111261261563e-11
PYAR:scaffold_37017550178791151554e-11
PYAP:scaffold_55819414198151461545e-11
PHSO:scaffold_3642551964258931401536e-11
PYUU:scaffold_20075508385511431091537e-11
PYIR:scaffold_206610891316801527e-11
PHKE:scaffold_49990949288691528e-11
PYIR:scaffold_9989885102321221529e-11
PYAR:scaffold_1918739942721511e-10
PHRA:scaffold_12324674250151351521e-10
PHRA:scaffold_37285308285592991511e-10
HYAP:scaffold_85376775380091171511e-10
PHSO:scaffold_8124060512409491211511e-10
PYAP:scaffold_1879968103871541502e-10
PYVX:scaffold_30510229105821241502e-10
PYIR:scaffold_81453249601571502e-10
PYIW:scaffold_1952440547161101502e-10
PYIR:scaffold_1744165720251291492e-10
SADI:scaffold_911575381578881351492e-10
SAPA:scaffold_321166041169271211493e-10
PLHA:NW_020187410.1331136701271483e-10
PLHA:NW_020186941.155957563191211483e-10
PYIW:scaffold_2639162720491471483e-10
SADI:scaffold_221346921350841491474e-10
PHCA:scaffold_39200088200372991474e-10
PHKE:scaffold_206309834931491474e-10
PYAR:scaffold_21220006203261171475e-10
PHCA:scaffold_146403451071465e-10
PYUU:scaffold_2032690440690703931465e-10
PYIR:scaffold_27783812121301465e-10
PHCA:scaffold_4924791251321361466e-10
SADI:scaffold_272909732913231351457e-10
PYAR:scaffold_44524558621441457e-10
PHIF:NW_003304531.1430669811448e-10
PHPA:scaffold_1949469498101291459e-10
PHIF:NW_003303594.179011793521351441e-09
PHIF:NW_003303637.11828401831811351441e-09
PYVX:scaffold_504235042550671151e-09
PYIW:scaffold_8782075811301441e-09
PLHA:NW_020188258.1135621513565681231431e-09
SAPA:scaffold_123062303065591141431e-09
PYAR:scaffold_1613712074401151431e-09
PYIR:scaffold_573542557631231422e-09
PHCA:scaffold_88149258153111461422e-09
PHRA:scaffold_233903783907611431422e-09
PYUU:scaffold_20386013726017701461422e-09
ALLA:FR82407647661479781191412e-09
PHSO:scaffold_3111535118221011413e-09
PHIF:NW_003303391.18019780421761413e-09
PYIW:scaffold_532832886901281403e-09
PYIR:scaffold_349771210771281403e-09
HYAP:scaffold_463744278041371404e-09
PHIF:NW_003303757.153260055326202701395e-09
PYAP:scaffold_1235350953778951395e-09
SADI:scaffold_24452805452981631395e-09
ALCA:scaffold_16827529278461191396e-09
PYUU:scaffold_20288213048216421291386e-09
PHPA:scaffold_1446228944626721431387e-09
PYVX:scaffold_3412352223716691378e-09
PHPA:scaffold_818743887722991379e-09
APAS:scaffold_49302651302824621239e-09
PYIW:scaffold_712152418621151371e-08
PYIR:scaffold_196617861968651351e-08
PYIW:scaffold_3542136317131301342e-08
PYIR:scaffold_4627352908621342e-08
PYIW:scaffold_182154918991301342e-08
PHIF:NW_003303307.174210801211343e-08
PYAP:scaffold_94530956711351343e-08
PYAP:scaffold_63016883172241261333e-08
PYAP:scaffold_231056410845991333e-08
PYAR:scaffold_480133327691324e-08
PHPA:scaffold_460468668731324e-08
SADI:scaffold_390681860641306e-08
PYUU:scaffold_20332775327962721226e-08
PYAR:scaffold_1366127016351331316e-08
PYIW:scaffold_2701695117097491309e-08
PYUU:scaffold_17896982106986081441299e-08
PYAP:scaffold_7421752366691291e-07
PLHA:NW_020188786.12425142428401171291e-07
PYVX:scaffold_62220562325941291e-07
PYIR:scaffold_136142174420721281e-07
PHKE:scaffold_88436523858731272e-07
PYAP:scaffold_79329643242951282e-07
PYIW:scaffold_360272030971301272e-07
PYVX:scaffold_1070136117261261262e-07
PHRA:scaffold_532207824131181263e-07
PHPA:scaffold_764378043974711263e-07
PYAR:scaffold_5931575915929581263e-07
PLHA:NW_020188562.19214469217301011253e-07
PHRA:scaffold_4471936722981261254e-07
PHCA:scaffold_34476314480321401245e-07
PHRA:scaffold_143849583852781121246e-07
PYAR:scaffold_5051945591251236e-07
PYIW:scaffold_3644138617331221227e-07
PYAP:scaffold_744451548741241221e-06
PHKE:scaffold_27947764480721081211e-06
PYIW:scaffold_5012281482961211e-06
PYVX:scaffold_6981312013323731202e-06
PYIR:scaffold_63012462128031211202e-06
PYAP:scaffold_1054341546821191202e-06
PYAR:scaffold_48872936881371192e-06
PYIR:scaffold_45223876243131571193e-06
PYVX:scaffold_4961021310380561183e-06
PYIR:scaffold_54815700160051151183e-06
PYAR:scaffold_317321492337671174e-06
PHKE:scaffold_19112398127481211174e-06
PHPA:scaffold_8181632118167221401166e-06
PYAP:scaffold_20925692760691166e-06
PYIW:scaffold_50603036471201157e-06
PHKE:scaffold_71531833371671158e-06
SADI:scaffold_210201871020372661158e-06
PYVX:scaffold_16402756791421149e-06
PYVX:scaffold_1554207142247631141e-05
PHRA:scaffold_55597809992711141e-05
PYAP:scaffold_983359939191131141e-05
PYIR:scaffold_212220332302951131e-05
PHKE:scaffold_37626532268701281132e-05
PYUU:scaffold_20318355083819951132e-05
PYIR:scaffold_243521452414951122e-05
PYIR:scaffold_2511147218791411112e-05
PYIR:scaffold_97651335273471122e-05
PYAR:scaffold_1972471050181081103e-05
PHIF:NW_003303565.151648520011281094e-05
PYAR:scaffold_3482175121041241094e-05
PYUU:scaffold_20122071082074701271095e-05
PYAR:scaffold_226581211171071095e-05
PYAR:scaffold_261711321329691087e-05
PYIR:scaffold_281211351389901078e-05
PYAP:scaffold_3282738727617811061e-04
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYSO_353401

Length=146
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHSO:scaffold_1                                                       308     2e-96
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  277     1e-85
PHRA:scaffold_56                                                      276     2e-85
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  275     7e-85
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  269     9e-83
PHCA:scaffold_84 PHYCAscaffold_84                                     268     2e-82
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  244     3e-74
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  235     7e-71
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  221     7e-66
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  191     1e-55
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  190     3e-55
PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:...  168     1e-47
PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 ...  165     1e-46
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  164     5e-46
PHCA:scaffold_7 PHYCAscaffold_7                                       163     7e-46
PHSO:scaffold_14                                                      160     7e-45
PHRA:scaffold_267                                                     160     8e-45
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  159     1e-44
PHRA:scaffold_106                                                     159     2e-44
PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:...  149     2e-44
PHSO:scaffold_35                                                      158     4e-44
PHSO:scaffold_5                                                       158     4e-44
PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig:...  153     2e-42
PHRA:scaffold_79                                                      152     6e-42
PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 ...  147     2e-40
PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 ...  147     3e-40
PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 ...  147     3e-40
PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:Phy...  146     6e-40
PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig superc...  146     6e-40
PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig:...  146     8e-40
PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:...  143     8e-39
PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:p...  142     2e-38
PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:...  134     4e-38
PHCA:scaffold_67 PHYCAscaffold_67                                     137     1e-36
PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 ...  136     2e-36
PHSO:scaffold_12                                                      135     7e-36
PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig superc...  133     2e-35
PHRA:scaffold_33                                                      133     3e-35
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  124     5e-32
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  122     1e-31
PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 gen...  122     2e-31
PHSO:scaffold_64                                                      120     9e-31
PHSO:scaffold_4                                                       119     2e-30
PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 g...  114     2e-28
PHSO:scaffold_11                                                      86.3    3e-26
PHRA:scaffold_494                                                     72.4    7e-25
PHRA:scaffold_2892                                                    72.4    7e-25
PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:p...  73.6    1e-21
PHRA:scaffold_9                                                       92.8    5e-21
PHRA:scaffold_4                                                       91.7    1e-20
PYAP:scaffold_1129 pag1_scaffold_1129 dna:supercontig supercontig...  88.6    1e-19
PHCA:scaffold_24 PHYCAscaffold_24                                     88.6    1e-19
PHKE:scaffold_221 scf_22126_221.1 dna:supercontig supercontig:Phy...  85.9    1e-18
PHSO:scaffold_2                                                       84.3    3e-18
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  84.3    4e-18
PHCA:scaffold_93 PHYCAscaffold_93                                     83.2    1e-17
PHCA:scaffold_98 PHYCAscaffold_98                                     82.4    2e-17
PHSO:scaffold_16                                                      82.0    3e-17
PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 gen...  81.6    3e-17
PYAP:scaffold_216 pag1_scaffold_216 dna:supercontig supercontig:p...  81.3    5e-17
PHKE:scaffold_949 scf_22126_949.1_contig_1 dna:supercontig superc...  81.3    5e-17
PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig:...  80.9    7e-17
PHCA:scaffold_50 PHYCAscaffold_50                                     80.5    7e-17
PHRA:scaffold_29                                                      79.0    3e-16
PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 u...  78.6    4e-16
PHRA:scaffold_89                                                      77.0    1e-15
PHKE:scaffold_155 scf_22126_155.1 dna:supercontig supercontig:Phy...  77.0    1e-15
PHRA:scaffold_1234                                                    76.6    2e-15
PHRA:scaffold_418                                                     76.3    2e-15
PYIW:scaffold_7003 piw_scaffold_7003 dna:supercontig supercontig:...  74.3    3e-15
PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 gen...  76.3    3e-15
PHCA:scaffold_22 PHYCAscaffold_22                                     75.9    3e-15
PHKE:scaffold_250 scf_22126_250.1 dna:supercontig supercontig:Phy...  75.9    4e-15
PYVX:scaffold_563 pve_scaffold_563 dna:supercontig supercontig:pv...  75.5    5e-15
PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 ...  75.5    5e-15
PHSO:scaffold_10                                                      75.1    5e-15
PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 ge...  75.1    6e-15
PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 ge...  75.1    6e-15
PYIR:scaffold_155 pir_scaffold_155 dna:supercontig supercontig:pi...  73.9    2e-14
PHCA:scaffold_2 PHYCAscaffold_2                                       73.9    2e-14
SAPA:scaffold_31 supercont2.31 dna:supercontig supercontig:ASM151...  73.9    2e-14
PYIR:scaffold_152 pir_scaffold_152 dna:supercontig supercontig:pi...  73.6    2e-14
PHSO:scaffold_15                                                      72.8    4e-14
PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pv...  65.5    1e-11
PYVX:scaffold_639 pve_scaffold_639 dna:supercontig supercontig:pv...  72.4    6e-14
PYAP:scaffold_289 pag1_scaffold_289 dna:supercontig supercontig:p...  72.4    6e-14
PYAR:scaffold_88 par_scaffold_88 dna:supercontig supercontig:par_...  72.0    7e-14
PHRA:scaffold_51                                                      72.0    7e-14
PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 ge...  72.0    8e-14
APAS:scaffold_33 supercont1.33 dna:supercontig supercontig:Apha_a...  72.0    8e-14
PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 u...  71.2    1e-13
PYIR:scaffold_1319 pir_scaffold_1319 dna:supercontig supercontig:...  70.9    2e-13
PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:...  70.9    2e-13
PHRA:scaffold_131                                                     70.9    2e-13
PHKE:scaffold_399 scf_22126_399.1 dna:supercontig supercontig:Phy...  70.9    2e-13
PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKe...  70.1    3e-13
PHIF:NW_003303506.1 Phytophthora infestans T30-4 supercont1.253 g...  69.7    5e-13
PYAR:scaffold_674 par_scaffold_674 dna:supercontig supercontig:pa...  69.7    5e-13
PHCA:scaffold_40 PHYCAscaffold_40                                     69.3    7e-13
PHCA:scaffold_11 PHYCAscaffold_11                                     69.3    7e-13
PYIR:scaffold_5821 pir_scaffold_5821 dna:supercontig supercontig:...  66.6    7e-13
PHKE:scaffold_72 scf_22126_72.1 dna:supercontig supercontig:PhyKe...  68.9    8e-13
PYUU:scaffold_2036 scf1117875582036 dna:supercontig supercontig:p...  68.6    1e-12
SADI:scaffold_134 supercont1.134 dna:supercontig supercontig:Sap_...  68.2    2e-12
HYAP:scaffold_176 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  68.2    2e-12
PYVX:scaffold_894 pve_scaffold_894 dna:supercontig supercontig:pv...  67.8    2e-12
PHKE:scaffold_1151 scf_22126_1151.1_contig_1 dna:supercontig supe...  67.8    2e-12
PHRA:scaffold_52                                                      67.8    3e-12
PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:p...  67.4    3e-12
PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig:...  66.6    5e-12
PYVX:scaffold_2510 pve_scaffold_2510 dna:supercontig supercontig:...  66.2    6e-12
PYIR:scaffold_871 pir_scaffold_871 dna:supercontig supercontig:pi...  66.2    7e-12
SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM151...  66.2    8e-12
SADI:scaffold_264 supercont1.264 dna:supercontig supercontig:Sap_...  65.9    1e-11
PHRA:scaffold_313                                                     65.5    1e-11
PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:p...  65.5    1e-11
PHRA:scaffold_28                                                      65.5    1e-11
PYVX:scaffold_385 pve_scaffold_385 dna:supercontig supercontig:pv...  65.1    2e-11
APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_i...  61.2    2e-11
PYAP:scaffold_583 pag1_scaffold_583 dna:supercontig supercontig:p...  64.7    3e-11
PLHA:NW_020189511.1 Plasmopara halstedii genome assembly, contig:...  64.7    3e-11
APIN:scaffold_9 supercont1.9 dna:supercontig supercontig:Apha_inv...  64.7    3e-11
PYAR:scaffold_370 par_scaffold_370 dna:supercontig supercontig:pa...  64.3    4e-11
PYAP:scaffold_558 pag1_scaffold_558 dna:supercontig supercontig:p...  63.9    5e-11
PHSO:scaffold_3                                                       63.5    6e-11
PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:p...  63.5    7e-11
PYIR:scaffold_2066 pir_scaffold_2066 dna:supercontig supercontig:...  63.2    7e-11
PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig superc...  63.2    8e-11
PYIR:scaffold_998 pir_scaffold_998 dna:supercontig supercontig:pi...  63.2    9e-11
PYAR:scaffold_1918 par_scaffold_1918 dna:supercontig supercontig:...  62.8    1e-10
PHRA:scaffold_123                                                     63.2    1e-10
PHRA:scaffold_37                                                      62.8    1e-10
HYAP:scaffold_8 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8:...  62.8    1e-10
PHSO:scaffold_8                                                       62.8    1e-10
PYAP:scaffold_187 pag1_scaffold_187 dna:supercontig supercontig:p...  62.4    2e-10
PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pv...  62.4    2e-10
PYIR:scaffold_81 pir_scaffold_81 dna:supercontig supercontig:pir_...  62.4    2e-10
PYIW:scaffold_1952 piw_scaffold_1952 dna:supercontig supercontig:...  62.4    2e-10
PYIR:scaffold_1744 pir_scaffold_1744 dna:supercontig supercontig:...  62.0    2e-10
SADI:scaffold_91 supercont1.91 dna:supercontig supercontig:Sap_di...  62.0    2e-10
SAPA:scaffold_32 supercont2.32 dna:supercontig supercontig:ASM151...  62.0    3e-10
PLHA:NW_020187410.1 Plasmopara halstedii genome assembly, contig:...  61.6    3e-10
PLHA:NW_020186941.1 Plasmopara halstedii genome assembly, contig:...  61.6    3e-10
PYIW:scaffold_2639 piw_scaffold_2639 dna:supercontig supercontig:...  61.6    3e-10
SADI:scaffold_22 supercont1.22 dna:supercontig supercontig:Sap_di...  61.2    4e-10
PHCA:scaffold_39 PHYCAscaffold_39                                     61.2    4e-10
PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:Phy...  61.2    4e-10
PYAR:scaffold_212 par_scaffold_212 dna:supercontig supercontig:pa...  61.2    5e-10
PHCA:scaffold_146 PHYCAscaffold_146                                   60.8    5e-10
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  60.8    5e-10
PYIR:scaffold_277 pir_scaffold_277 dna:supercontig supercontig:pi...  60.8    5e-10
PHCA:scaffold_49 PHYCAscaffold_49                                     60.8    6e-10
SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_di...  60.5    7e-10
PYAR:scaffold_4452 par_scaffold_4452 dna:supercontig supercontig:...  60.5    7e-10
PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 ...  60.1    8e-10
PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 ...  60.5    9e-10
PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 g...  60.1    1e-09
PHIF:NW_003303637.1 Phytophthora infestans T30-4 supercont1.122 g...  60.1    1e-09
PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_...  48.9    1e-09
PYIW:scaffold_878 piw_scaffold_878 dna:supercontig supercontig:pi...  60.1    1e-09
PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig:...  59.7    1e-09
SAPA:scaffold_12 supercont2.12 dna:supercontig supercontig:ASM151...  59.7    1e-09
PYAR:scaffold_1613 par_scaffold_1613 dna:supercontig supercontig:...  59.7    1e-09
PYIR:scaffold_573 pir_scaffold_573 dna:supercontig supercontig:pi...  59.3    2e-09
PHCA:scaffold_8 PHYCAscaffold_8                                       59.3    2e-09
PHRA:scaffold_23                                                      59.3    2e-09
PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:p...  59.3    2e-09
ALLA:FR824076 dna:supercontig supercontig:ENA1:FR824076:1:147313:...  58.9    2e-09
PHSO:scaffold_31                                                      58.9    3e-09
PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 g...  58.9    3e-09
PYIW:scaffold_532 piw_scaffold_532 dna:supercontig supercontig:pi...  58.5    3e-09
PYIR:scaffold_3497 pir_scaffold_3497 dna:supercontig supercontig:...  58.5    3e-09
HYAP:scaffold_463 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  58.5    4e-09
PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 gen...  58.2    5e-09
PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:p...  58.2    5e-09
SADI:scaffold_24 supercont1.24 dna:supercontig supercontig:Sap_di...  58.2    5e-09
ALCA:scaffold_168 AcNc2_CONTIG_168_length_51659 dna:supercontig s...  58.2    6e-09
PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:p...  57.8    6e-09
PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 u...  57.8    7e-09
PYVX:scaffold_341 pve_scaffold_341 dna:supercontig supercontig:pv...  57.4    8e-09
PHPA:scaffold_81 NW_008649067.1 Phytophthora parasitica INRA-310 ...  57.4    9e-09
APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_a...  52.0    9e-09
PYIW:scaffold_712 piw_scaffold_712 dna:supercontig supercontig:pi...  57.4    1e-08
PYIR:scaffold_1966 pir_scaffold_1966 dna:supercontig supercontig:...  56.6    1e-08
PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:...  56.2    2e-08
PYIR:scaffold_46 pir_scaffold_46 dna:supercontig supercontig:pir_...  56.2    2e-08
PYIW:scaffold_182 piw_scaffold_182 dna:supercontig supercontig:pi...  56.2    2e-08
PHIF:NW_003303307.1 Phytophthora infestans T30-4 supercont1.454 g...  56.2    3e-08
PYAP:scaffold_94 pag1_scaffold_94 dna:supercontig supercontig:pag...  56.2    3e-08
PYAP:scaffold_630 pag1_scaffold_630 dna:supercontig supercontig:p...  55.8    3e-08
PYAP:scaffold_23 pag1_scaffold_23 dna:supercontig supercontig:pag...  55.8    3e-08
PYAR:scaffold_480 par_scaffold_480 dna:supercontig supercontig:pa...  55.5    4e-08
PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310...  55.5    4e-08
SADI:scaffold_390 supercont1.390 dna:supercontig supercontig:Sap_...  54.7    6e-08
PYUU:scaffold_2033 scf1117875582033 dna:supercontig supercontig:p...  51.6    6e-08
PYAR:scaffold_1366 par_scaffold_1366 dna:supercontig supercontig:...  55.1    6e-08
PYIW:scaffold_270 piw_scaffold_270 dna:supercontig supercontig:pi...  54.7    9e-08
PYUU:scaffold_1789 scf1117875581789 dna:supercontig supercontig:p...  54.3    9e-08
PYAP:scaffold_74 pag1_scaffold_74 dna:supercontig supercontig:pag...  54.3    1e-07
PLHA:NW_020188786.1 Plasmopara halstedii genome assembly, contig:...  54.3    1e-07
PYVX:scaffold_622 pve_scaffold_622 dna:supercontig supercontig:pv...  54.3    1e-07
PYIR:scaffold_1361 pir_scaffold_1361 dna:supercontig supercontig:...  53.9    1e-07
PHKE:scaffold_884 scf_22126_884.1_contig_1 dna:supercontig superc...  53.5    2e-07
PYAP:scaffold_793 pag1_scaffold_793 dna:supercontig supercontig:p...  53.9    2e-07
PYIW:scaffold_360 piw_scaffold_360 dna:supercontig supercontig:pi...  53.5    2e-07
PYVX:scaffold_1070 pve_scaffold_1070 dna:supercontig supercontig:...  53.1    2e-07
PHRA:scaffold_532                                                     53.1    3e-07
PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 ...  53.1    3e-07
PYAR:scaffold_593 par_scaffold_593 dna:supercontig supercontig:pa...  53.1    3e-07
PLHA:NW_020188562.1 Plasmopara halstedii genome assembly, contig:...  52.8    3e-07
PHRA:scaffold_44                                                      52.8    4e-07
PHCA:scaffold_3 PHYCAscaffold_3                                       52.4    5e-07
PHRA:scaffold_14                                                      52.4    6e-07
PYAR:scaffold_505 par_scaffold_505 dna:supercontig supercontig:pa...  52.0    6e-07
PYIW:scaffold_3644 piw_scaffold_3644 dna:supercontig supercontig:...  51.6    7e-07
PYAP:scaffold_744 pag1_scaffold_744 dna:supercontig supercontig:p...  51.6    1e-06
PHKE:scaffold_279 scf_22126_279.1 dna:supercontig supercontig:Phy...  51.2    1e-06
PYIW:scaffold_50 piw_scaffold_50 dna:supercontig supercontig:piw_...  51.2    1e-06
PYVX:scaffold_698 pve_scaffold_698 dna:supercontig supercontig:pv...  50.8    2e-06
PYIR:scaffold_630 pir_scaffold_630 dna:supercontig supercontig:pi...  50.8    2e-06
PYAP:scaffold_10 pag1_scaffold_10 dna:supercontig supercontig:pag...  50.8    2e-06
PYAR:scaffold_4887 par_scaffold_4887 dna:supercontig supercontig:...  50.4    2e-06
PYIR:scaffold_452 pir_scaffold_452 dna:supercontig supercontig:pi...  50.4    3e-06
PYVX:scaffold_496 pve_scaffold_496 dna:supercontig supercontig:pv...  50.1    3e-06
PYIR:scaffold_548 pir_scaffold_548 dna:supercontig supercontig:pi...  50.1    3e-06
PYAR:scaffold_3173 par_scaffold_3173 dna:supercontig supercontig:...  49.7    4e-06
PHKE:scaffold_191 scf_22126_191.1 dna:supercontig supercontig:Phy...  49.7    4e-06
PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 u...  49.3    6e-06
PYAP:scaffold_209 pag1_scaffold_209 dna:supercontig supercontig:p...  49.3    6e-06
PYIW:scaffold_5060 piw_scaffold_5060 dna:supercontig supercontig:...  48.9    7e-06
PHKE:scaffold_715 scf_22126_715.1 dna:supercontig supercontig:Phy...  48.9    8e-06
SADI:scaffold_2 supercont1.2 dna:supercontig supercontig:Sap_dicl...  48.9    8e-06
PYVX:scaffold_1640 pve_scaffold_1640 dna:supercontig supercontig:...  48.5    9e-06
PYVX:scaffold_155 pve_scaffold_155 dna:supercontig supercontig:pv...  48.5    1e-05
PHRA:scaffold_555                                                     48.5    1e-05
PYAP:scaffold_983 pag1_scaffold_983 dna:supercontig supercontig:p...  48.5    1e-05
PYIR:scaffold_2122 pir_scaffold_2122 dna:supercontig supercontig:...  48.1    1e-05
PHKE:scaffold_376 scf_22126_376.1_contig_1 dna:supercontig superc...  48.1    2e-05
PYUU:scaffold_2031 scf1117875582031 dna:supercontig supercontig:p...  48.1    2e-05
PYIR:scaffold_2435 pir_scaffold_2435 dna:supercontig supercontig:...  47.8    2e-05
PYIR:scaffold_2511 pir_scaffold_2511 dna:supercontig supercontig:...  47.4    2e-05
PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pi...  47.8    2e-05
PYAR:scaffold_1972 par_scaffold_1972 dna:supercontig supercontig:...  47.0    3e-05
PHIF:NW_003303565.1 Phytophthora infestans T30-4 supercont1.194 g...  46.6    4e-05
PYAR:scaffold_3482 par_scaffold_3482 dna:supercontig supercontig:...  46.6    4e-05
PYUU:scaffold_2012 scf1117875582012 dna:supercontig supercontig:p...  46.6    5e-05
PYAR:scaffold_2265 par_scaffold_2265 dna:supercontig supercontig:...  46.6    5e-05
PYAR:scaffold_2617 par_scaffold_2617 dna:supercontig supercontig:...  46.2    7e-05
PYIR:scaffold_2812 pir_scaffold_2812 dna:supercontig supercontig:...  45.8    8e-05
PYAP:scaffold_328 pag1_scaffold_328 dna:supercontig supercontig:p...  45.4    1e-04
PYIR:scaffold_973 pir_scaffold_973 dna:supercontig supercontig:pi...  45.4    1e-04
PHKE:scaffold_190 scf_22126_190.1 dna:supercontig supercontig:Phy...  44.7    2e-04
PYIR:scaffold_1332 pir_scaffold_1332 dna:supercontig supercontig:...  44.7    2e-04
PYIW:scaffold_783 piw_scaffold_783 dna:supercontig supercontig:pi...  44.3    3e-04
PLHA:NW_020189786.1 Plasmopara halstedii genome assembly, contig:...  44.3    3e-04
PYAP:scaffold_356 pag1_scaffold_356 dna:supercontig supercontig:p...  44.3    3e-04
ALCA:scaffold_116 AcNc2_CONTIG_116_length_69695 dna:supercontig s...  44.3    3e-04
PYAR:scaffold_55 par_scaffold_55 dna:supercontig supercontig:par_...  43.9    4e-04
PYAP:scaffold_192 pag1_scaffold_192 dna:supercontig supercontig:p...  43.9    5e-04
PYAP:scaffold_321 pag1_scaffold_321 dna:supercontig supercontig:p...  43.1    7e-04
PYAR:scaffold_2725 par_scaffold_2725 dna:supercontig supercontig:...  43.1    8e-04
PYIW:scaffold_569 piw_scaffold_569 dna:supercontig supercontig:pi...  43.1    8e-04
ALCA:scaffold_198 AcNc2_CONTIG_198_length_47010 dna:supercontig s...  43.1    9e-04
PYVX:scaffold_1989 pve_scaffold_1989 dna:supercontig supercontig:...  42.7    0.001
PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 ge...  42.4    0.001
PYAR:scaffold_266 par_scaffold_266 dna:supercontig supercontig:pa...  42.4    0.001
PYAR:scaffold_3952 par_scaffold_3952 dna:supercontig supercontig:...  41.6    0.002
PHCA:scaffold_47 PHYCAscaffold_47                                     41.6    0.002
PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 ...  41.6    0.002
SAPA:scaffold_44 supercont2.44 dna:supercontig supercontig:ASM151...  32.3    0.002
PYAR:scaffold_4639 par_scaffold_4639 dna:supercontig supercontig:...  40.8    0.004
PYAP:scaffold_1339 pag1_scaffold_1339 dna:supercontig supercontig...  40.8    0.005
PYAR:scaffold_5201 par_scaffold_5201 dna:supercontig supercontig:...  40.0    0.007
PYAR:scaffold_6624 par_scaffold_6624 dna:supercontig supercontig:...  39.7    0.010
PYAR:scaffold_4631 par_scaffold_4631 dna:supercontig supercontig:...  39.7    0.011
PYIR:scaffold_2176 pir_scaffold_2176 dna:supercontig supercontig:...  39.3    0.015
PYIW:scaffold_7 piw_scaffold_7 dna:supercontig supercontig:piw_sc...  39.3    0.016
PLHA:NW_020188473.1 Plasmopara halstedii genome assembly, contig:...  38.9    0.020
PHKE:scaffold_787 scf_22126_787.1_contig_1 dna:supercontig superc...  38.5    0.026
PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:p...  38.1    0.035
PYAP:scaffold_234 pag1_scaffold_234 dna:supercontig supercontig:p...  38.1    0.037
PYVX:scaffold_663 pve_scaffold_663 dna:supercontig supercontig:pv...  38.1    0.043
PYAR:scaffold_3827 par_scaffold_3827 dna:supercontig supercontig:...  37.7    0.045
PYVX:scaffold_1002 pve_scaffold_1002 dna:supercontig supercontig:...  37.0    0.084
PYAP:scaffold_566 pag1_scaffold_566 dna:supercontig supercontig:p...  33.9    0.11 
PYIR:scaffold_883 pir_scaffold_883 dna:supercontig supercontig:pi...  36.6    0.12 
PHRA:scaffold_105                                                     36.6    0.13 
PYVX:scaffold_2975 pve_scaffold_2975 dna:supercontig supercontig:...  35.4    0.21 
ALLA:FR824571 dna:supercontig supercontig:ENA1:FR824571:1:11669:1...  35.8    0.23 
PYAR:scaffold_6810 par_scaffold_6810 dna:supercontig supercontig:...  35.4    0.23 
PYAR:scaffold_9435 par_scaffold_9435 dna:supercontig supercontig:...  35.0    0.30 
PYIW:scaffold_1943 piw_scaffold_1943 dna:supercontig supercontig:...  35.4    0.36 
PYIW:scaffold_3717 piw_scaffold_3717 dna:supercontig supercontig:...  34.7    0.52 
PHIF:NW_003303719.1 Phytophthora infestans T30-4 supercont1.40 ge...  34.7    0.59 
PYIW:scaffold_1159 piw_scaffold_1159 dna:supercontig supercontig:...  34.3    0.81 
PYAR:scaffold_8021 par_scaffold_8021 dna:supercontig supercontig:...  33.5    0.98 
PHPA:scaffold_37 NW_008649023.1 Phytophthora parasitica INRA-310 ...  33.9    1.0  
PYAR:scaffold_356 par_scaffold_356 dna:supercontig supercontig:pa...  33.9    1.2  
PYIR:scaffold_4757 pir_scaffold_4757 dna:supercontig supercontig:...  32.7    2.0  
PYIR:scaffold_922 pir_scaffold_922 dna:supercontig supercontig:pi...  33.1    2.0  
ALLA:FR824130 dna:supercontig supercontig:ENA1:FR824130:1:88159:1...  33.1    2.2  
ALLA:FR824149 dna:supercontig supercontig:ENA1:FR824149:1:77927:1...  33.1    2.2  
PYIR:scaffold_5474 pir_scaffold_5474 dna:supercontig supercontig:...  32.3    2.7  
ALCA:scaffold_557 AcNc2_CONTIG_557_length_14333 dna:supercontig s...  32.7    3.1  
PYIR:scaffold_4165 pir_scaffold_4165 dna:supercontig supercontig:...  32.3    3.2  
PHIF:NW_003303663.1 Phytophthora infestans T30-4 supercont1.96 ge...  32.3    3.4  
PYIW:scaffold_5066 piw_scaffold_5066 dna:supercontig supercontig:...  32.3    3.5  
ALLA:FR824100 dna:supercontig supercontig:ENA1:FR824100:1:109355:...  32.0    5.2  
PLHA:NW_020188793.1 Plasmopara halstedii genome assembly, contig:...  31.2    6.0  
PHIF:NW_003303751.1 Phytophthora infestans T30-4 supercont1.8 gen...  31.2    7.8  
PYUU:scaffold_2039 scf1117875582039 dna:supercontig supercontig:p...  31.2    8.7  

>PHSO:scaffold_1
Length=13391543

 Score = 308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/146 (100%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -1

Query  1        MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
                MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP
Sbjct  2794025  MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  2793846

Query  61       IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
                IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL
Sbjct  2793845  IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  2793666

Query  121      GIKYVEGAYSWQVYKNCVALSKTATA  146
                GIKYVEGAYSWQVYKNCVALSKTATA
Sbjct  2793665  GIKYVEGAYSWQVYKNCVALSKTATA  2793588

 Score = 151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 1/142 (1%)
 Frame = +1

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L++QG  T  +  +W  ++GY SLRA  D  S Y V + A F CG T+   E QPIP
Sbjct  2790415  LAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS-YTVADGADFTCGFTNTNGEVQPIP  2790591

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 +++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+WLG+
Sbjct  2790592  DDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGKDYTIDYSSCTSTCTLYWFWLGV  2790771

Query  123      KYVEGAYSWQVYKNCVALSKTA  144
                +Y++  YSWQ+YK CV LS +A
Sbjct  2790772  RYLKNEYSWQIYKACVPLSTSA  2790837

 Score = 144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -1

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T  +  +W ++ GY +LRA +D  S Y V + A + CG T  K   QPIP
Sbjct  2791811  LAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTVADGADYYCGFTDIKGVAQPIP  2791635

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 + + +++GYT DGPCEVWLD T+V    NCH  F    +++DYS+C  SCTL WYWLG+
Sbjct  2791634  -DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGV  2791458

Query  123      KYVEGAYSWQVYKNCVALSKTA  144
                ++++  YSWQVYK CV LS +A
Sbjct  2791457  RFLKNEYSWQVYKACVPLSTSA  2791392

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 61/130 (47%), Gaps = 30/130 (23%)
 Frame = +2

Query  25       GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD---------  75
                GY+SLR MLD +         + DC  T  +T+  P+   S   T  +  D         
Sbjct  2592281  GYSSLRDMLDQQ---------VTDCANT--RTDVSPVDV-SGLTTMSWQNDQEQKGFIDS  2592424

Query  76       --GPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
                  GPCEVW+DDT V    +C  ++  G   +   D+S C   CTL +YWL +       +
Sbjct  2592425  HHGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALH----EPN  2592592

Query  131      WQVYKNCVAL  140
                WQ+YK CV +
Sbjct  2592593  WQIYKQCVPV  2592622

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 61/130 (47%), Gaps = 30/130 (23%)
 Frame = -1

Query  25       GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD---------  75
                GY+SLR MLD +         + DC  T  +T+  P+   S   T  +  D         
Sbjct  2595431  GYSSLRDMLDQQ---------VTDCANT--RTDVSPVDV-SGLTTMSWQNDQEQKGFIDS  2595288

Query  76       --GPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
                  GPCEVW+DDT V    +C  ++  G   +   D+S C   CTL +YWL +       +
Sbjct  2595287  HHGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALH----EPN  2595120

Query  131      WQVYKNCVAL  140
                WQ+YK CV +
Sbjct  2595119  WQIYKQCVPV  2595090

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 54/113 (48%), Gaps = 20/113 (18%)
 Frame = +2

Query  19       SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS----SFQTSG--Y  72
                S   + GY+SLR MLD +         + DC  T  +T+  P+  +     ++Q +    
Sbjct  2593688  SSFAKAGYSSLRDMLDQQ---------VTDCANT--RTDVSPVDVSDLTAMTWQNNPGVI  2593834

Query  73       TLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                T  GPCEVW+D+  +    NC   +      +   D+S C D CTL +YWL +
Sbjct  2593835  THRGPCEVWIDEIMMNHRDNCLAGNVAVYSMEISTDFSKCSDKCTLRFYWLAL  2593993

 Score = 40.8 bits (94),  Expect = 0.005, Method: Composition-based stats.
 Identities = 26/85 (31%), Positives = 39/85 (46%), Gaps = 13/85 (15%)
 Frame = -2

Query  32        MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS-SFQTSGYTLDGPCEVWLDDTKVAAG  90
                 MLD  SLY         C  T+     QPIP+N+ +  + G    G CE  L D K+   
Sbjct  10439074  MLDGMSLYDAA------CSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  10438913

Query  91        RNCHTQFPH------GQHEIDYSAC  109
                  +C++++ H       +  IDY +C
Sbjct  10438912  DDCYSEYSHLNVNVKTESSIDYLSC  10438838

 Score = 40.8 bits (94),  Expect = 0.005, Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 40/89 (45%), Gaps = 13/89 (15%)
 Frame = -2

Query  28       SLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS-SFQTSGYTLDGPCEVWLDDTK  86
                S   MLD  SLY         C  T+     QPIP+N+ +  + G    G CE  L D K
Sbjct  7957087  SPEPMLDGMSLYDAA------CSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKK  7956926

Query  87       VAAGRNCHTQFPH------GQHEIDYSAC  109
                +    +C++++ H       +  IDY +C
Sbjct  7956925  LLYADDCYSEYSHLNVNVKTESSIDYLSC  7956839

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  1       MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
               MALAYLQEQGVNTSIEAQSWMQ+HGY SLRAMLDDESLYKVTEEA+F+CGLTSP+TETQP
Sbjct  245125  MALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  244946

Query  61      IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
               IP+N+SFQTSGYTLDGPCEVWLDDTKV++GRNCHT+FPHGQHE+DYS+CG +CTL WYWL
Sbjct  244945  IPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWL  244766

Query  121     GIKYVEGAYSWQVYKNCVALSKTATA  146
               GIKY+EG YSWQVYKNCV LS   TA
Sbjct  244765  GIKYIEGIYSWQVYKNCVGLSTAPTA  244688

 Score = 146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (67%), Gaps = 1/142 (1%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L++QG  T  +  +W +++GY SLRA  D  S Y V++ A   CG T+   + QPIP
Sbjct  242059  LAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-YTVSDGADLTCGFTNINGDVQPIP  242235

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 ++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+WLG+
Sbjct  242236  DGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKYYTIDYSSCTSTCTLYWFWLGV  242415

Query  123     KYVEGAYSWQVYKNCVALSKTA  144
               +Y++  YSWQ+YK CV LS +A
Sbjct  242416  RYLKNEYSWQIYKACVPLSTSA  242481

 Score = 138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 91/142 (64%), Gaps = 2/142 (1%)
 Frame = -2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +   W + +GY +LR  +D  + Y VT+ A + CG T+     QPIP
Sbjct  243432  LAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIP  243256

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +++GYT DGPCEVWLD  +V    NCH       + +DYS+C  +CTL WYWLG+
Sbjct  243255  -DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGV  243079

Query  123     KYVEGAYSWQVYKNCVALSKTA  144
               +Y++ AYSWQ+YK C+ LS +A
Sbjct  243078  RYLKNAYSWQIYKACIPLSASA  243013

>PHRA:scaffold_56
Length=334739

 Score = 276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1       MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
               MALAYLQEQGVNTSIEAQ WMQ+HGYASLR+MLDDESLY+VTEEA+FDCGLTSPKTETQ 
Sbjct  161015  MALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQL  161194

Query  61      IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
               IP+NSSFQ+SGYTLDGPCEVWLDDTK AAGRNCHT+FPHGQH+IDYSACG +C L WYWL
Sbjct  161195  IPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWL  161374

Query  121     GIKYVEGAYSWQVYKNCVALSKTATA  146
               GIKYVEGAYSWQVYKNC+AL K ATA
Sbjct  161375  GIKYVEGAYSWQVYKNCIALGKEATA  161452

 Score = 150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L++QG +T  +  +W +E+GY SLRA  DD + Y V++ A F CG T    + Q IP
Sbjct  164012  LAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTVSDGADFTCGFTDINGDVQAIP  163836

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 ++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+W+G+
Sbjct  163835  DGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKDYTIDYSSCTSTCTLYWFWMGV  163656

Query  123     KYVEGAYSWQVYKNCVALSKTA  144
               +Y+  AYSWQVYK CV LS +A
Sbjct  163655  RYLNNAYSWQVYKACVPLSASA  163590

 Score = 141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 1/142 (1%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  +W + +GY +LRA +D    Y V + A + CG T+     Q IP
Sbjct  162610  LAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTVADGADYYCGFTNADATPQAIP  162786

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 ++ +++GYT DGPCEVWLD T+V    NCH       + IDYS+C  +CTL WYW+G+
Sbjct  162787  DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGV  162966

Query  123     KYVEGAYSWQVYKNCVALSKTA  144
               +Y++ AYSWQVYK CV LS +A
Sbjct  162967  RYLKNAYSWQVYKACVPLSASA  163032

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  1       MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
               MALAYLQEQG+NTSIEAQSWMQ+ GY+SLRAMLDDESLYKVTEEA+F+CGLTSP+TETQP
Sbjct  395277  MALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  395098

Query  61      IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
               IP+N+SFQTSGYTLDGPCE+WLDDTKVA+GRNCHT+FPHGQH++DYS+CG SC L WYWL
Sbjct  395097  IPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWL  394918

Query  121     GIKYVEGAYSWQVYKNCVALSKTATA  146
               GIKYVEG YSWQVYKNCV LSK  TA
Sbjct  394917  GIKYVEGIYSWQVYKNCVGLSKNPTA  394840

 Score = 128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 88/142 (62%), Gaps = 5/142 (4%)
 Frame = -3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L +L+ QG  T  +   W + +GY +LR  ++    Y V + A + CG T+     QP P
Sbjct  359086  LTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAPQPNP  358919

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +++GYT DGPCEVWLD T+V    NCH       + +DYS+C  +CTL WYWLG+
Sbjct  358918  -DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGV  358742

Query  123     KYVEGAYSWQVYKNCVALSKTA  144
               ++++ AYSWQ+YK C+ LS +A
Sbjct  358741  RFLKNAYSWQIYKACIPLSASA  358676

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -2

Query  1      MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
              MALAYLQEQGVNTSIE Q WM  HGY SLRAMLDDE+LYKVTEEALFDCGLTSPKTETQ 
Sbjct  60849  MALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQL  60670

Query  61     IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
              IP+NS+FQTSGYT+DGPCEVWLDD KVAAGRNCHT+FPHG H IDYS+CG+SCTLWWYWL
Sbjct  60669  IPTNSTFQTSGYTMDGPCEVWLDDKKVAAGRNCHTEFPHGMHSIDYSSCGNSCTLWWYWL  60490

Query  121    GIKYVEGAYSWQVYKNCVALSKTAT  145
              G+KY +  YSWQVYKNCV LSKTA+
Sbjct  60489  GVKYTDEGYSWQVYKNCVGLSKTAS  60415

 Score = 155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L++QG +T  +  +W  ++GYASLRA  DD S Y V++ A F CG T      QPIP
Sbjct  57565  LAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTVSDGADFTCGFTDINGAAQPIP  57741

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+W+G+
Sbjct  57742  DDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKDYTIDYSSCTSTCTLYWFWMGV  57921

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              +Y++  YSWQVYK CV LS +A
Sbjct  57922  RYLKNEYSWQVYKACVPLSASA  57987

 Score = 144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = -3

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ QG  T  +  +W + +GY +LRA +D    Y VT+ A + CG T+     Q IP
Sbjct  59114  LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  58938

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              S ++ +++GYT DGPCEVWLD T+V    NCH       + IDYS+C  +CTL WYWLG+
Sbjct  58937  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  58758

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              ++++  YSWQVYK CV LS +A
Sbjct  58757  RFLKNEYSWQVYKACVPLSASA  58692

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  1      MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
              MALAYLQEQGVNTSIEAQSWM++HGY SLRAMLDDESLY+VTEEA+F+CGLTSPKTETQP
Sbjct  95645  MALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQP  95466

Query  61     IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
              IP+N+SFQTSGYTLDGPCEVWLDDTKV+AGRNCHT+FP GQH++DYS+CG+SCTL WYWL
Sbjct  95465  IPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWL  95286

Query  121    GIKYVEGAYSWQVYKNCV  138
              GIKYVEG YSWQVYKNCV
Sbjct  95285  GIKYVEGIYSWQVYKNCV  95232

 Score = 147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = +2

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L++QG  T  +  +W Q++GY SLRA  +D + Y V++ A F CG T+   + Q IP
Sbjct  92810  LAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTVSDGADFTCGFTNKNGDVQAIP  92986

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                ++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+WLG+
Sbjct  92987  DANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKDYTIDYSSCTSTCTLYWFWLGV  93166

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              +Y++  YSWQ+YK CV LS +A
Sbjct  93167  RYLKNEYSWQIYKACVPLSASA  93232

 Score = 144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 2/142 (1%)
 Frame = -1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ QG  T  +   W + +GY +LRA +D    Y VT+ A + CG T+ K   QPIP
Sbjct  94153  LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTVTDGADYYCGFTNAKAAPQPIP  93977

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + + +++GYT DGPCEVWLD T+V    NCH  FP   + +DYS+C  SC L WYWLG 
Sbjct  93976  -DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGT  93800

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              ++++  +SWQVYK C+ LS +A
Sbjct  93799  RFLKNEHSWQVYKACIPLSSSA  93734

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  1        MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
                MALAYL+EQG+NTSIE QSWM++H Y SLRAMLDD+ LYKVTEEA+F+CGLTSPKTETQP
Sbjct  1846949  MALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKVTEEAIFECGLTSPKTETQP  1846770

Query  61       IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
                IP+N+SF TSGYTLDGPCEVWL++T V  GRNC+T+FP+G H++DYS CG+SC L WYWL
Sbjct  1846769  IPTNNSFVTSGYTLDGPCEVWLNNTMVITGRNCYTEFPNGHHQVDYSLCGNSCKLVWYWL  1846590

Query  121      GIKYVEGAYSWQVYKNCVALSKTA  144
                GIKYVEG YSWQVYKNC+ L   +
Sbjct  1846589  GIKYVEGIYSWQVYKNCINLGNKS  1846518

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = +2

Query  2       ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTET-QP  60
               ALAYLQEQG++TSIEAQSW QEHGY SLRAMLDD+SLY V+++A+FDCG TS  +ET Q 
Sbjct  161297  ALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQD  161476

Query  61      IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
               IP+N + ++SGYTLDGPCEVW DDT+V +GRNC T+FPHGQH++DYS+CGDSCTL WYWL
Sbjct  161477  IPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWL  161656

Query  121     GIKYVEGAYSWQVYKNCVALSKTATA  146
               GI+Y++G YSWQVYKNC+ L +  TA
Sbjct  161657  GIQYMDGIYSWQVYKNCIGLGRNVTA  161734

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             +AYL++QGV+T+IEAQ+W+ E GYA+LRA++DD+ LY VTEE LFDCGLT P TETQPIP
Sbjct  6548  VAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP  6727

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             +N SF TSGYTLDGPCE+W+D+T   AGRNCHT+FP G H IDYS CG+SC + W+WLGI
Sbjct  6728  TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGI  6907

Query  123   KYVEGAYSWQVYKNCVALSKTA  144
             KY    YSWQV+KNC+ LS +A
Sbjct  6908  KYQGERYSWQVFKNCINLSASA  6973

 Score = 153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +2

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V   A F CG T P    QPIP
Sbjct  7655  LAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  7834

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              +   +++GYT DGPCEVWLDDT+V    NCH       +++DYSAC  SCTL+WYWLG+
Sbjct  7835  -DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGV  8011

Query  123   KYVEGAYSWQVYKNCVALS  141
             +Y++  YSWQVYK CV +S
Sbjct  8012  RYLKQVYSWQVYKACVPIS  8068

 Score = 141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 4/143 (3%)
 Frame = +3

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L++QG  T  +  +W + +GY +LRA +D  S Y VT+ A   CG T      QPIP
Sbjct  13623  LAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTVTDGADQTCGFTEIDGTPQPIP  13799

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGD-SCTLWWYWLG  121
              +N  F+++GYT DGPCE+WLD T+V A  NCH         IDYS     +CTL+WYW+G
Sbjct  13800  AN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKDTAIDYSXXXXGTCTLYWYWMG  13973

Query  122    IKYVEGAYSWQVYKNCVALSKTA  144
              ++Y+  AYSWQVYKNCV LS +A
Sbjct  13974  VRYLNNAYSWQVYKNCVPLSTSA  14042

 Score = 135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = -1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L++QG +T  +  +W  ++GY SLRA +D  S Y VT+ A   CG T+     Q +P
Sbjct  14856  LAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTVTDGADQTCGWTNKDGTAQALP  14680

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +   +++GYT  GPCEVWLDDT V    NCH       +++DYS+C  +CTL+W+W+G+
Sbjct  14679  -DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKTYDLDYSSCTSTCTLYWFWMGV  14503

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              +Y+   YSWQVYKNCV LS +A
Sbjct  14502  RYLNNEYSWQVYKNCVPLSASA  14437

 Score = 102 bits (255),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  75    DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             DGPCE+WLDDT++  G NCH         +DYS+C  SCTL+W+W+G++Y++GAYSWQVY
Sbjct  9060  DGPCEIWLDDTRIFQGDNCHESVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVY  8881

Query  135   KNCVALSKTA  144
             KNCV LS +A
Sbjct  8880  KNCVPLSTSA  8851

 Score = 33.5 bits (75),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDES  37
             LA+L++QG  T  +  SW   +GY +LRA +D  S
Sbjct  9235  LAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAS  9131

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  85     TKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
              T+V A  NCH         IDYS+C  SCTL+WYW+G++Y++GAYSWQVYKNCV LS +A
Sbjct  12658  TRVYANDNCHAAISGKDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  12837

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ Q +NTS +   ++++ GYA+LRAM+DDE LY+V  +ALFDCG T P  E+QPIP
Sbjct  107114  LAFLENQKINTSADFAGFLKQKGYANLRAMMDDEKLYEVNLDALFDCGYTDPTYESQPIP  107293

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +N   +++GYT DGPCEVWLDD KV +G NCHT+FP    +IDYS C  SCTL WYW+G+
Sbjct  107294  TNGQIRSTGYTHDGPCEVWLDDVKVMSGENCHTEFPGKTFKIDYSTCKGSCTLRWYWMGL  107473

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               ++++  +SWQVYK CVALS   TA
Sbjct  107474  RFLKNKWSWQVYKECVALSDKPTA  107545

 Score = 155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEA-LFDCGLTSPKTETQPI  61
               L++L++ GV TS     +M+E GY++LRA++DD  LYKV   A  F CG T P   +Q I
Sbjct  108869  LSFLEKNGVKTSASVDGFMKEKGYSTLRALMDDSKLYKVNSNADNFLCGYTDPTKGSQVI  109048

Query  62      PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
               P +S+ +T+GYT  GPCEVW+D+ +V AG NCH Q      ++DYS C  SCT+ WYWLG
Sbjct  109049  PKDSTMRTTGYTHVGPCEVWIDNVRVIAGDNCHEQV-SNTTKVDYSNCKGSCTMRWYWLG  109225

Query  122     IKYVEGAYSWQVYKNCVALS  141
               ++Y++  +SWQVYKNC+AL+
Sbjct  109226  LRYLKKKWSWQVYKNCIALT  109285

 Score = 155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L++Q   T+ +  +++  + Y SLRA +++ +LY V   A F CG T    E QPIP
Sbjct  110531  LAFLEDQSFPTTADFNAYLTANKYTSLRAFMNNSTLYTVNASANFGCGFTKLDGERQPIP  110710

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +N   + +GYT DGPCE W++DTKV AG NCHT+ P   + +DYSAC  SC L  YW+GI
Sbjct  110711  TNGQMRLTGYTHDGPCETWMNDTKVFAGENCHTELPSISYSMDYSACKGSCILRRYWMGI  110890

Query  123     KYVEGAYSWQVYKNCVAL  140
               +YV+  YSWQVYK C  L
Sbjct  110891  RYVKNEYSWQVYKACTPL  110944

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +1

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QGVNTS +   +M++ GYA+LRA++DDE LY+V  +ALF+CG T P  E+QPIP
Sbjct  1299559  LAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIP  1299738

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                +  + +++GYT DGPCEVWLDD KV +G NCH +FP     +DYS+C  SCTL WYWLG+
Sbjct  1299739  TTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGV  1299918

Query  123      KYVEGAYSWQVYKNCVALSKTATA  146
                +Y++  YSWQ+YK CV+LS  A+ 
Sbjct  1299919  RYLKKRYSWQIYKECVSLSDNASG  1299990

 Score = 173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -3

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                +A+L+EQG+ TS +   +M++ GYA+LRAMLDD+ LY V  +AL +CG T P  E+QPIP
Sbjct  1303028  VAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP  1302849

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                  ++F ++GY L+GPCEVWLDD KV +  NCHT++P     +DYS+C  SC L WYWLGI
Sbjct  1302848  VTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGI  1302669

Query  123      KYVEGAYSWQVYKNCVAL  140
                + V   YSWQVYK CV+L
Sbjct  1302668  QPVNETYSWQVYKVCVSL  1302615

 Score = 166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = +1

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV   A F+CG T+     QPIP
Sbjct  1298095  LAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP  1298274

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                +N  F+T+GYT DGPCEVWLD+TKV +G NCH  FP   H + Y+AC  SCTL WYW+GI
Sbjct  1298275  AN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGI  1298448

Query  123      KYVEGAYSWQVYKNCVALSK  142
                ++++G +SWQVYK CV L +
Sbjct  1298449  RFLKGKHSWQVYKECVPLGR  1298508

 Score = 162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T+++  ++ +  GY +LRA +DD   YKV   A F CG T    + QPIP
Sbjct  1294424  LAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKVAAGADFQCGWTKLDGKRQPIP  1294603

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + +  +++GYT DGPCEVWLD T+V  G NCH++FP    +IDYS+C  SCTL WYW+GI
Sbjct  1294604  AGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTTFKIDYSSCKGSCTLRWYWMGI  1294780

Query  123      KYVEGAYSWQVYKNCVAL  140
                ++++G YSWQVYKNCV +
Sbjct  1294781  RFLKGKYSWQVYKNCVPI  1294834

 Score = 160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV   A F CG T    + QPIP
Sbjct  1288700  LAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKVAAGADFQCGWTKLDGKRQPIP  1288879

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + +  +++GYT DGPCEVWLD+T V  G NCH++FP   H+I Y++C  SCTL WYW+GI
Sbjct  1288880  AGT-IRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTTHKISYASCKGSCTLRWYWMGI  1289056

Query  123      KYVEGAYSWQVYKNCVAL  140
                ++++G YSWQVYKNCV +
Sbjct  1289057  RFLKGKYSWQVYKNCVPI  1289110

 Score = 159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 97/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEA-LFDCGLTSPKTETQPI  61
                L++L++ GV TS     +M+E GY +LR ++DD+ LYKV   A  F CG T P   +QPI
Sbjct  1301064  LSFLEKNGVKTSASVNGFMKEKGYNTLRDLMDDQKLYKVNSNADNFLCGYTDPTKGSQPI  1301243

Query  62       PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
                P +S+ +T+GYT  GPCEVW+DD KV AG NCH Q      ++DYS C   CT+ WYWLG
Sbjct  1301244  PKDSTMRTTGYTHVGPCEVWIDDVKVIAGDNCHEQV-SNTTKVDYSNCKGKCTMHWYWLG  1301420

Query  122      IKYVEGAYSWQVYKNCVALS  141
                +++++  +SWQVYKNC+AL+
Sbjct  1301421  LRFLKKKWSWQVYKNCIALT  1301480

 Score = 156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +3

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T+ +  ++ +  GY +LRA +DD+  Y V   A F+CG T      Q IP
Sbjct  1295961  LAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTVASGADFECGWTKLDGTRQSIP  1296140

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + +  +++GYT DGPCEVWLD T+V  G NCHT+F    H IDYS+C  SCTL WYW+GI
Sbjct  1296141  AGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTTHTIDYSSCKGSCTLRWYWMGI  1296317

Query  123      KYVEGAYSWQVYKNCVAL  140
                ++++G YSWQVYKNCV +
Sbjct  1296318  RFLKGEYSWQVYKNCVPI  1296371

>PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2249:1:3349:1 
REF
Length=3349

 Score = 168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = -3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             LA+L+ QG  T+ +  ++ +  GY +LRA +DD+S YKV + A F+CG T      QPIP
Sbjct  1847  LAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYKVADGADFECGWTKLAGTPQPIP  1668

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             S S+ +++GYT DGPCEVWLD T+V  G NCH++FP    +IDYS+C  SC L WYW+GI
Sbjct  1667  SASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPGTTFKIDYSSCKGSCVLRWYWMGI  1488

Query  123   KYVEGAYSWQVYKNCVALS  141
             ++++G YSWQVYKNCV ++
Sbjct  1487  RFLKGQYSWQVYKNCVPVT  1431

>PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.22, whole genome shotgun 
sequence
Length=998868

 Score = 165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  + +SW  E+GY SLR  +D  + Y+VT  A F CG T PK   QPIP
Sbjct  685441  LAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEVTSGADFSCGFTDPKGTPQPIP  685617

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  SCTL WYWLG+
Sbjct  685618  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGSCTLRWYWLGV  685797

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               ++++ +YSWQVYK C+ L+  A A
Sbjct  685798  RFLKNSYSWQVYKACIPLTGGAGA  685869

 Score = 162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = -3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  SW  E+ Y SLR  +D+ + Y+VT  A F CG T PK   QPIP
Sbjct  687049  LAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEVTSGADFSCGFTDPKGTPQPIP  686873

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLGI
Sbjct  686872  AGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYTVDYSSCKGTCTLRWYWLGI  686693

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               ++++  YSWQVYK C+ LS +  A
Sbjct  686692  RFLKNQYSWQVYKACIPLSGSGEA  686621

 Score = 161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ +G  T  +  +W +E+GY SLR  LD+   Y VT+ A F CG T PK   QPIP
Sbjct  682810  LAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPVTDGADFKCGFTDPKGTPQPIP  682634

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL+WYWLG+
Sbjct  682633  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLYWYWLGV  682454

Query  123     KYVEGAYSWQVYKNCVAL  140
               ++++  YSWQVYK C+ L
Sbjct  682453  RFLKNDYSWQVYKACIPL  682400

 Score = 156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG     +  +W +E+GY SLR  +D  + Y+VT  A F CG T+PK   QPIP
Sbjct  714250  LAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEVTPGADFSCGFTNPKGTPQPIP  714426

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +    +++GYT DGPCEV+LDDT V  G NCH +FP     IDYS+C  +CTL WYWLGI
Sbjct  714427  AQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKDCPIDYSSCKGTCTLRWYWLGI  714606

Query  123     KYVEGAYSWQVYKNCVAL  140
               ++++ AYSWQVYK C+ L
Sbjct  714607  RFLKNAYSWQVYKECIPL  714660

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 45/88 (51%), Gaps = 13/88 (15%)
 Frame = -1

Query  49      CGLTSPKTETQPIPSNS-----SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
               CG T    + QPIPS+      S +  G+   GPCEV++DD  VA G NC T FP G  +
Sbjct  454845  CGFTRMDVDPQPIPSDGNAKWRSNRDGGFGHLGPCEVYIDDNMVARGDNCETDFPGGDDK  454666

Query  104     --------IDYSACGDSCTLWWYWLGIK  123
                       +DY +C   CTL  YWL  +
Sbjct  454665  SSKPSIIPVDY*SCNGKCTLTLYWLAFE  454582

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +2

Query  2      ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
              ++A L++Q V TS +   ++++ GYASLRAMLDDE+LY V  +++F+CG T P  E+QPI
Sbjct  10847  SVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPI  11026

Query  62     PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
              P+N   + +GY  DGPCE+W+DD K+ +  NC   FP    ++DYS+C   CTL WY L 
Sbjct  11027  PTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALS  11206

Query  122    I-KYVEGAYSWQVYKNCVALSKTATA  146
              + K   G+YSW+VYKNCVALS   TA
Sbjct  11207  VSKTTGGSYSWEVYKNCVALSDEPTA  11284

 Score = 152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 98/145 (68%), Gaps = 2/145 (1%)
 Frame = +1

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEA-LFDCGLTSPKTETQPI  61
             L++L++ GV TS     +M++ GY++LRA++DD  LYK    A  F CG T P   +Q I
Sbjct  5245  LSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYKTNSNADNFLCGYTDPSKGSQVI  5424

Query  62    PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
             P +S+ +T+GYT  GPCEVW+DD +V AG NCH Q  +   ++DYS C   CT+ WYWLG
Sbjct  5425  PKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSN-TTKVDYSNCKGECTMRWYWLG  5601

Query  122   IKYVEGAYSWQVYKNCVALSKTATA  146
             ++Y++  +SWQVYKNC+AL+    A
Sbjct  5602  LRYLKKKWSWQVYKNCIALTGDGAA  5676

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             LA+L+ QG   + +  ++ +  GY +LR  +DD+  YKV +   F+CG +S K   QPIP
Sbjct  3627  LAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV-DGGNFECGWSSLKGTPQPIP  3803

Query  63    SNSSFQTSGYTLDGP  77
             +  + +++GYT DGP
Sbjct  3804  AGGALRSTGYTHDGP  3848

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  2     ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
              LA+L+ QG  T+ + +++ ++ GY +LR  +DD++ YKV +   F+CG ++ K   QPI
Sbjct  1117  PLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV-DGGDFECGWSTLKGTPQPI  1293

Query  62    P  62
             P
Sbjct  1294  P  1296

>PHCA:scaffold_7 PHYCAscaffold_7
Length=1368812

 Score = 163 bits (413),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = -2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  +W  E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  905878  LAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTVTNGADFSCGFTDPKGTPQPIP  905702

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG+
Sbjct  905701  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGV  905522

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               ++++ AYSWQVYK C+ L+ +  A
Sbjct  905521  RFLKNAYSWQVYKACIPLAGSGGA  905450

 Score = 159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = +3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ +G  T  +  +W  E+GY SLR  +D  + Y VTE A F CG T P    QPIP
Sbjct  908817  LAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPVTEGADFKCGFTDPNGTPQPIP  908993

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + IDYS+C  +CTL+W+WLG+
Sbjct  908994  AGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKGYTIDYSSCKGTCTLYWFWLGV  909173

Query  123     KYVEGAYSWQVYKNCVALS  141
               ++++  YSWQVYK C+ L+
Sbjct  909174  RFLKNDYSWQVYKACIPLT  909230

 Score = 158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  +W  E+GY SLR  +D  + Y V   A F CG T P    QPIP
Sbjct  901495  LAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTVRNGADFKCGYTDPNGTPQPIP  901671

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVW+DDT V  G NCH +FP   + IDYS C   CTL+WYWLG+
Sbjct  901672  AGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKGYTIDYSPCKGKCTLYWYWLGV  901851

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               ++++ +YSWQVYK C+ L+ +  A
Sbjct  901852  RFLKNSYSWQVYKECIPLAGSGGA  901923

 Score = 157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 93/139 (67%), Gaps = 1/139 (1%)
 Frame = -3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L +L+  G  T  +  +W +E+GY SLR  +D+   Y V+E A F CG T P    QPIP
Sbjct  876636  LTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPVSEGADFKCGFTDPNGTPQPIP  876460

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + ++ +++GYT DGPCEVW+DDT V  G NCH +FP   + IDYS C   CTL+WYWLG+
Sbjct  876459  AGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKDYTIDYSPCKGKCTLYWYWLGV  876280

Query  123     KYVEGAYSWQVYKNCVALS  141
               ++++  YSWQVYK C+ L+
Sbjct  876279  RFLKNRYSWQVYKECIPLT  876223

 Score = 107 bits (267),  Expect(2) = 7e-37, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  SW  E+ Y SLR  +D+   Y VT+ A F CG T PK   QPIP
Sbjct  904388  LAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAK-YTVTDGADFSCGFTDPKGTPQPIP  904564

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFP  98
               + ++ +++GYT DGPCEVWLDDT V  G NCH +FP
Sbjct  904565  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFP  904672

 Score = 67.8 bits (164),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  96      QFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                FP   + +DYS+C  +CTL WYWLGI++++  YSWQVYK C+ LS
Sbjct  904665  NFPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  904802

 Score = 32.7 bits (73),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  76      GPCEVWLDDTKVAAGRNC  93
               GPCEVW+DD +  + R+C
Sbjct  933234  GPCEVWVDDVRTMSSRDC  933287

>PHSO:scaffold_14
Length=1806347

 Score = 160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  +W +E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  819227  LAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPIP  819051

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 +  +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG+
Sbjct  819050  EGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGV  818871

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               ++++  YSWQVYK C+ L+  + A
Sbjct  818870  RFLKNDYSWQVYKACIPLTSGSMA  818799

 Score = 109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 77/132 (58%), Gaps = 3/132 (2%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  SW  ++GY SLR  +D ++ Y VT  A F CG T PK   QPIP
Sbjct  814027  LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  814203

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +  + +++GYT DGPCEVWLDDTKV  G NCH +FP   + +  +       L   W  +
Sbjct  814204  AGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPGKDYTVLVAGVQGVHPLVRIWRRL  814383

Query  123     KYVEGAYSWQVY  134
                 ++G   W+++
Sbjct  814384  DALDG--DWRIW  814413

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 47/139 (34%), Positives = 68/139 (49%), Gaps = 8/139 (6%)
 Frame = -2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  +W +E+GY +LR  +D ++ Y VT  A F CG T PK   QPIP
Sbjct  815746  LAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDVTSGADFSCGFTDPKGTPQPIP  815570

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                 +  +++GYT DG              R    Q  HG+  +       S  L       
Sbjct  815569  EGNKMRSTGYTHDGVARRHDGAGWRQLPREVPGQGLHGRLLVV*GLVHASLVL-------  815411

Query  123     KYVEGAYSWQVYKNCVALS  141
                 ++ +YSW+VYK C+ LS
Sbjct  815410  DGMKNSYSWKVYKACIPLS  815354

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = -3

Query  52      TSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC  109
               TSP     P    S F+  T     D P  VWLDDT V  G NCH +FP   + +DYS+C
Sbjct  815619  TSPAASPTPRAPLSPFRKVTRCAPRDTPTTVWLDDTMVLDGDNCHEKFPGKDYTVDYSSC  815440

Query  110     GDSCTLWWYWL  120
                 SCTL WYW+
Sbjct  815439  KGSCTLRWYWM  815407

 Score = 43.5 bits (101),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 29/57 (51%), Gaps = 5/57 (9%)
 Frame = +2

Query  49       CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG  100
                CG T      QPIPS+   +       G+T  GPCEV+LDD  V  G NC  ++  G
Sbjct  1038110  CGNTVVTGTPQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVLHGDNCEDEYKGG  1038280

 Score = 20.4 bits (41),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 4/26 (15%)
 Frame = +3

Query  109      CGDSCTLWWYWLGIKYVEGAYSWQVY  134
                C   CTL +YWL  +  +    WQ Y
Sbjct  1038318  CNGKCTLSFYWLAFQNEQ----WQAY  1038383

>PHRA:scaffold_267
Length=29552

 Score = 160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             LA+L+ +G  T  +  SW  E+GY SLR  +D+   Y V + A F CG T PK   QPIP
Sbjct  9411  LAFLENEGFTTQEDFASWRDENGYKSLRDFMDNAK-YNVADGADFSCGFTDPKGTPQPIP  9587

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLGI
Sbjct  9588  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGI  9767

Query  123   KYVEGAYSWQVYKNCVALS  141
             ++++  YSWQVYK C+ L+
Sbjct  9768  RFLKNDYSWQVYKECIPLT  9824

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  + ++W  E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  696989  LAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPIP  697165

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +  + +++GYT DGPCEVWLDD  V  G NCH +FP   + +DYS+C  +CTL WYWLG+
Sbjct  697166  AGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGV  697345

Query  123     KYVEGAYSWQVYKNCVALS  141
               ++++ +YSWQVYK C+ L+
Sbjct  697346  RFLKNSYSWQVYKACIPLT  697402

 Score = 119 bits (298),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  59      QPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWY  118
               QPIP+  + +++GYT DGPCEVWLDD  V  G NCH +FP   + +DYS+C  +CTL WY
Sbjct  673447  QPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWY  673626

Query  119     WLGIKYVEGAYSWQVYKNCVALS  141
               WLGI++++  YSWQVYK C+ L+
Sbjct  673627  WLGIRFLKNKYSWQVYKACIPLA  673695

>PHRA:scaffold_106
Length=147471

 Score = 159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 97/139 (70%), Gaps = 1/139 (1%)
 Frame = -1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ +G  T  +  +W  E+GY SLR  +D+ + Y VT  A F CG T PK   QPIP
Sbjct  13341  LAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSVTNGADFSCGFTDPKGTPQPIP  13165

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYW+G+
Sbjct  13164  ADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYTVDYSSCKGTCTLRWYWMGV  12985

Query  123    KYVEGAYSWQVYKNCVALS  141
              ++++  YSWQVYK C+ L+
Sbjct  12984  RFLKETYSWQVYKECIPLT  12928

>PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5024:1:718:1 
REF
Length=718

 Score = 149 bits (376),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 96/139 (69%), Gaps = 2/139 (1%)
 Frame = +1

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61
            LA+L+ QG  T+ +   +++  GY +LRA +DD+  YKV    A F+CG T+   + QPI
Sbjct  223  LAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPI  402

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
            P+  + +++GYT DGPCEVWLD+TKV +G NC+  FP   H I Y++C  SCTL WYW+G
Sbjct  403  PA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMG  579

Query  122  IKYVEGAYSWQVYKNCVAL  140
            +++++  +SWQVYK CV +
Sbjct  580  LRFLKNKWSWQVYKECVPI  636

>PHSO:scaffold_35
Length=32414

 Score = 158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = -3

Query  2      ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
               LA+L+ +G  T  +  +W +E+GY SLR  +D  + Y VT  A F CG T PK   QPI
Sbjct  18546  PLAFLENEGFTTQEDFTAWRKENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPI  18370

Query  62     PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
              P  +  +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG
Sbjct  18369  PEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLG  18190

Query  122    IKYVEGAYSWQVYKNCVALSKTATA  146
              +++++  YSWQVYK C+ L+  + A
Sbjct  18189  VRFLKNDYSWQVYKACIPLTSGSMA  18115

>PHSO:scaffold_5
Length=6830280

 Score = 158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = -3

Query  2       ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
                LA+L+ +G  T  +  +W +E+GY SLR  +D  + Y VT  A F CG T PK   QPI
Sbjct  682399  PLAFLENEGFTTQEDFTAWRKENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPI  682223

Query  62      PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
               P  +  +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG
Sbjct  682222  PEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLG  682043

Query  122     IKYVEGAYSWQVYKNCVALSKTATA  146
               +++++  YSWQVYK C+ L+  + A
Sbjct  682042  VRFLKNDYSWQVYKACIPLTSGSMA  681968

 Score = 38.1 bits (87),  Expect = 0.041, Method: Composition-based stats.
 Identities = 26/91 (29%), Positives = 39/91 (43%), Gaps = 13/91 (14%)
 Frame = +3

Query  32       MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS-SFQTSGYTLDGPCEVWLDDTKVAAG  90
                MLD  SLY         C  T+     QPIP+N+ +  + G    G CE  L D K+   
Sbjct  3040320  MLDGMSLYDAA------CSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  3040481

Query  91       RNCHTQFPH------GQHEIDYSACGDSCTL  115
                 +C++++ H       +  IDY      C +
Sbjct  3040482  DDCYSEYSHLNVNVKTESSIDYLCENGGCKM  3040574

>PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_113, whole genome shotgun sequence
Length=380982

 Score = 153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ Q   T+ +AQ++ +++ + +LR  +D+   Y V + A   CG T P    QPIP
Sbjct  94758  LAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAK-YTVVKGADPACGFTDPNGTPQPIP  94934

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              +N++ +++GYT DGPCEVWL++T+V +  NCH +FP   + IDYS+C D+C L WYWLG+
Sbjct  94935  ANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGKDYTIDYSSCKDNCLLRWYWLGV  95114

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              ++++  YSWQVYK C+ LS++A
Sbjct  95115  RFLKEKYSWQVYKACIPLSRSA  95180

>PHRA:scaffold_79
Length=220511

 Score = 152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 2/139 (1%)
 Frame = -1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ QG  T  +  +W +++GY +LR  +D  + Y VTE A + CG T P    QPIP
Sbjct  26081  LAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTDPNGTPQPIP  25905

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              +  + +++GYT DGPCEVWLD+T+V  G NCH QFP   + IDYS+C  +CTL WYW+G+
Sbjct  25904  A-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKDYPIDYSSCKGTCTLHWYWIGV  25728

Query  123    KYVEGAYSWQVYKNCVALS  141
              ++++ +YSWQVYK C++L+
Sbjct  25727  RFLKNSYSWQVYKECISLT  25671

>PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.20, whole genome shotgun 
sequence
Length=1049362

 Score = 147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  + +SW  ++GY +LR  ++  + Y VTE A F CG T+PK   QPIP
Sbjct  363656  LAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTVTEGADFSCGWTNPKGTPQPIP  363832

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               +    +++GYT +GPCE+W+ DT+V    NCH   P  ++ IDYS C  +C L+WYWLG+
Sbjct  363833  AGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKEYPIDYSPCKGNCVLYWYWLGV  364012

Query  123     KYVEGAYSWQVYKNCVALSKTAT  145
               ++++ +YSWQVYK C+ L+  +T
Sbjct  364013  RFLKNSYSWQVYKECIPLTTNST  364081

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 17/109 (16%)
 Frame = +3

Query  49      CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQF---PHG  100
               CG T    + QPIP++        +  G+T  GPCE++LDD  V  G +C  +F   P+G
Sbjct  581157  CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  581336

Query  101     QHE-----IDYSACGDSCTLWWYWLGIKYVE----GAYSWQVYKNCVAL  140
                 +     +D+S+C   C L  YWL  +  +    G Y+ +V  + V L
Sbjct  581337  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQWQTYGTYTCKVIGHAVQL  581483

>PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.66, whole genome shotgun 
sequence
Length=310063

 Score = 147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 94/143 (66%), Gaps = 3/143 (2%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T  +  +W +++GY +LR  +D  + Y VTE A + CG T PK   QPIP
Sbjct  163036  LAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTDPKGTPQPIP  162860

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYWL  120
               +  + +++GYT DGPCEVWLDD +V  G NCH   P   + IDYS+C     C L WYWL
Sbjct  162859  AGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWL  162680

Query  121     GIKYVEGAYSWQVYKNCVALSKT  143
               G+++++ +YSWQVYK C+ L+ T
Sbjct  162679  GVRFLKNSYSWQVYKECIPLTTT  162611

>PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.46, whole genome shotgun 
sequence
Length=493760

 Score = 147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 94/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             LA+L+ QG  T  +  +W +++GY +LR  +D  + Y VTE A + CG T PK   QPIP
Sbjct  3897  LAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTDPKGTPQPIP  3721

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYWL  120
             +  + +++GYT DGPCEVWLDD +V  G NCH   P   + IDYS+C     C L WYWL
Sbjct  3720  AGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWL  3541

Query  121   GIKYVEGAYSWQVYKNCVALSKT  143
             G+++++ +YSWQVYK C+ L+ T
Sbjct  3540  GVRFLKNSYSWQVYKECIPLTTT  3472

>PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_622.1:1:14582:1 
REF
Length=14582

 Score = 146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 89/139 (64%), Gaps = 1/139 (1%)
 Frame = -1

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             LA+L+ +G     +  +W  E+GY SLR  +D+   Y VT  A   CG T P    QPIP
Sbjct  3884  LAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK-YSVTSGADSACGFTDPNGTPQPIP  3708

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               ++ +++GYT DGPCEVW+DDT      NCH  FP   + IDYSAC  +CTL WYWLG+
Sbjct  3707  EGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKDYTIDYSACKGTCTLRWYWLGV  3528

Query  123   KYVEGAYSWQVYKNCVALS  141
             ++++ +YSWQVYK C+ L+
Sbjct  3527  RFLKNSYSWQVYKACIPLT  3471

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  97   FPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
            FP   + IDYSAC  +CTL WYWLG+++++ AYSWQVYK C+ L+
Sbjct  4    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  138

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCG  50
             LA+L+ +G     + ++W +E+GY SLR  +D+ + Y VT  A F+CG
Sbjct  5413  LAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN-AKYPVTSGADFNCG  5273

>PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_761.1_contig_1:1:9298:1 
REF
Length=9298

 Score = 146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = -2

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +A +W +++GY +LRA +D  + Y+VTE A + CG T P    QPIP
Sbjct  798  LAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQVTEGADYFCGWTDPNGTAQPIP  622

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + +++GYT DGPCEVW+D+T+V    NCH       + IDYSAC  +C L WYWLG+
Sbjct  621  EGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGV  442

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++ +YSWQVYK C+ L+
Sbjct  441  RFLKNSYSWQVYKACIPLT  385

>PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2165, whole genome shotgun sequence
Length=94632

 Score = 146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 1/142 (1%)
 Frame = +1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ Q   TS +   +++++ Y SLR  L   + Y VTE A  DCG T P    QPIP
Sbjct  34684  LAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRAN-YTVTEGADRDCGFTDPNGTPQPIP  34860

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              + ++ + +GYT DG CE+WLDDTKV +G NCH  FP     +DYS+C D+C ++WYWL +
Sbjct  34861  AGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKDCPVDYSSCKDNCVMYWYWLAV  35040

Query  123    KYVEGAYSWQVYKNCVALSKTA  144
              + ++  YSWQVYK C+ L+++ 
Sbjct  35041  RLLKNEYSWQVYKACIPLTRSG  35106

>PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3459:1:3265:1 
REF
Length=3265

 Score = 143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = +1

Query  4     AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63
             A L++QG  T+ +  ++++ + Y +LR  +D    YK    A F+CG T PK   QPIP 
Sbjct  2146  AKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  2325

Query  64    NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLG  121
             + +F+TSGYT +GPCE+W+DD +V  G NCH          +IDYSAC  +C L WYWLG
Sbjct  2326  DGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  2505

Query  122   IKYVEGAYSWQVYKNCVALS  141
             I+    +YSWQ+YK C+ LS
Sbjct  2506  IRPTGKSYSWQIYKACIPLS  2565

>PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_560:1:21458:1 
REF
Length=21458

 Score = 142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = +2

Query  4      AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63
              A L+ QG  T+ +  +++  +GY +LR  +D    YK  + A  +CG T P    QPIP+
Sbjct  12650  AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  12829

Query  64     NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLG  121
              N  F+TSGYT +GPCE+W+DD  V +G+NCH          +IDYSAC   C L WYWLG
Sbjct  12830  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  13009

Query  122    IKYVEGAYSWQVYKNCVALS  141
              I+ +   YSWQ+YK C+ L+
Sbjct  13010  IRPMGKKYSWQIYKACIPLA  13069

 Score = 130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 5/147 (3%)
 Frame = -1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61
              LA+L+ QGV  + +   ++++ G  +LR  +D+++ YKV    A F+CG T P    QPI
Sbjct  11240  LAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKVEAAGATFECGYTDPNGARQPI  11061

Query  62     PSNSSFQTSGYTLDGPCEVWLDDTKV--AAGRNCHTQFPHGQ--HEIDYSACGDSCTLWW  117
              PSN   +++GYT DGPCEVWLD+T+V  +   +CH     G   ++ID+S C  +C L W
Sbjct  11060  PSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIGQGMISYKIDFSKCKGNCMLRW  10881

Query  118    YWLGIKYVEGAYSWQVYKNCVALSKTA  144
              YWL  + +   +SWQVYK CV L  +A
Sbjct  10880  YWLAKRKIGSKWSWQVYKQCVPLKGSA  10800

 Score = 123 bits (308),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 6/150 (4%)
 Frame = -3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61
             LA+L+ QGV    +   +++  G  +LR  +D+++ YK+    A F+CG T+P    QPI
Sbjct  8496  LAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKIEARGASFECGYTNPNGARQPI  8317

Query  62    PSNSSFQTSGYTLDGPCEVWLDDTKVAAGR--NCHTQFPHG--QHEIDYSACGDSCTLWW  117
             P N   +++GYT DGPCEVWLD+T+V      NCH    +    ++ID+S C  +C L W
Sbjct  8316  PKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVGNKAVSYKIDFSKCKGNCMLRW  8137

Query  118   YWLGIKYVEG-AYSWQVYKNCVALSKTATA  146
             YWLG + + G  +SWQ+YK CV L  + TA
Sbjct  8136  YWLGKRLIGGKKWSWQIYKACVPLKGSGTA  8047

>PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4828:1:781:1 
REF
Length=781

 Score = 134 bits (336),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 89/141 (63%), Gaps = 3/141 (2%)
 Frame = +3

Query  3    LAYLQEQ-GVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
            +AYL+ Q G + + +   ++   G+ ++R  +D++ LY+   +A F CG T    E QPI
Sbjct  186  MAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYRPVSDADFKCGYTKLDGEPQPI  365

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYW  119
            P N   +T+GYT +GPCE+WLDD KV  G+NCH     G +  ++D+S+C   CT++WYW
Sbjct  366  PKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVASGMNFQKLDFSSCVGKCTMYWYW  545

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            +GI+    + SWQ+YK C+ L
Sbjct  546  MGIRGSGKSVSWQIYKECIPL  608

>PHCA:scaffold_67 PHYCAscaffold_67
Length=292061

 Score = 137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 94/144 (65%), Gaps = 1/144 (1%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L++L+++G  T      +  ++GY SLR  ++ ++ YKV++ A   CG + PK   Q IP
Sbjct  220769  LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  220593

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               S+ + +TSGYT DGPCE+W+ D    +  NCH   P    ++DYS CGDSC L+WYWLG+
Sbjct  220592  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  220413

Query  123     KYVEGAYSWQVYKNCVALSKTATA  146
               + ++G YSWQVYK C+ L K +T+
Sbjct  220412  RKLKGKYSWQVYKECIPLYK*STS  220341

 Score = 129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 1/138 (1%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L++L+++G  T      +  ++GY +LR  +D+   Y VT+ A   CG + P    Q IP
Sbjct  219761  LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIP  219585

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +TSGYT DGPCE+W+ D    +  NCH        ++DYS CGDSC L+WYWLG+
Sbjct  219584  EDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  219405

Query  123     KYVEGAYSWQVYKNCVAL  140
               +Y++  YSWQVYK C+ L
Sbjct  219404  RYLKKKYSWQVYKECIPL  219351

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 15/126 (12%)
 Frame = +1

Query  18      QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
               +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  G
Sbjct  112522  KSLKAANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  112683

Query  77      PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
               PCE+WLDD KV    +C +++ +   +I      DYS+C  G    + +YWL  + +   
Sbjct  112684  PCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKK  112863

Query  129     YSWQVY  134
                 WQ Y
Sbjct  112864  TVWQSY  112881

>PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.39, whole genome shotgun 
sequence
Length=634653

 Score = 136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L++L+++G  T      +  ++GY SLR  +D  + YKVTE A   CG T PK   Q IP
Sbjct  149937  LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  150113

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +T+GYT DGPCE+++ +    +  NCH   P    ++DYS CGDSC L+WYWLG+
Sbjct  150114  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  150293

Query  123     KYVEGAYSWQVYKNCVALSKTAT  145
               + ++G YSWQVYK C+ + K AT
Sbjct  150294  RKLKGKYSWQVYKECIPIYK*AT  150362

 Score = 134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = +3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L++L+++G  T      +  ++GY SLR  +D+ + Y VT+ A   CG T PK   Q IP
Sbjct  151119  LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  151295

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +TSGYT DGPCE+++ DT   +  NCH        ++DYSACGDSC L+WYWLG+
Sbjct  151296  EDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV  151475

Query  123     KYVEGAYSWQVYKNCVAL  140
               +Y++  YSWQVYK C+ L
Sbjct  151476  RYLKKKYSWQVYKECIPL  151529

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (47%), Gaps = 15/126 (12%)
 Frame = +2

Query  18     QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
              +S    + +  L+ ++DD S+Y        DCG T+P    QPIP++     S   +  G
Sbjct  68792  KSLKAANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHG  68953

Query  77     PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
              PC +WLDD  V    +C  ++ +   +I      DYS+C  G    + +YWL  + +   
Sbjct  68954  PCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKK  69133

Query  129    YSWQVY  134
                WQ Y
Sbjct  69134  TVWQSY  69151

>PHSO:scaffold_12
Length=2105860

 Score = 135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = -3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T      +  ++GY SLR  +D+   Y VTE A   CG T PK   Q IP
Sbjct  168827  LAFLENQGFQTQ*NFTQYQVDNGYKSLRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIP  168651

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               S+ + +TSGYT DGPCE+++ D    +  NCH        ++DYS CGDSCTL+WYWLG+
Sbjct  168650  SDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGV  168471

Query  123     KYVEGAYSWQVYKNCVAL  140
               +++   YSWQVYK C+ +
Sbjct  168470  RFLNNKYSWQVYKECIPI  168417

 Score = 127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 87/138 (63%), Gaps = 1/138 (1%)
 Frame = -2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L++L+++G  T      +  ++GY SLR  ++  + YK+T+ A   CG T PK   Q IP
Sbjct  167526  LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  167350

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +TSGYT DGPCE+++ D    +  NCH        ++DYS CGDSC L+WYWLG+
Sbjct  167349  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  167170

Query  123     KYVEGAYSWQVYKNCVAL  140
               + ++G +SWQVYK C+ L
Sbjct  167169  RKLKGKFSWQVYKECIPL  167116

 Score = 120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 2/138 (1%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG  T      +M ++GY SLR  +D+ + Y VT+ A   CG T P    Q IP
Sbjct  162331  LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  162155

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +TSG+T D PCE+++ D    +  NCH        ++DYSACGDSC L+WYWLG+
Sbjct  162154  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  161975

Query  123     KYVEGAYSWQVYKNCVAL  140
               ++++G  S QVYK C+ +
Sbjct  161974  RFIKG-IS*QVYKECIPI  161924

 Score = 95.1 bits (235),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -3

Query  51      LTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACG  110
               L  PK   Q IP ++  +T GYT DGPCE+WLD+T   +  +C    P+  + +DYS CG
Sbjct  210311  LDRPKRSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCG  210132

Query  111     DSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                SC ++WY LG+   +  YSW+VYK C+ L
Sbjct  210131  ASCVMYWYTLGVAKPDRVYSWEVYKECIPL  210042

 Score = 38.9 bits (89),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 1/55 (2%)
 Frame = -1

Query  1       MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPK  55
               M LAY ++QG NTS     W   +G+ +LR  +D+ + Y VT  A   CG T  K
Sbjct  210457  MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGN-YSVTSGAD*ACGWTDLK  210296

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 15/124 (12%)
 Frame = +2

Query  24     HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
              + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  GPCE+WL
Sbjct  95222  NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  95383

Query  83     DDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
              DD KV    +C +++ +   +I      DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  95384  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  95563

Query  135    KNCV  138
                 V
Sbjct  95564  SKFV  95575

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 15/120 (13%)
 Frame = +2

Query  24     HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
              + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  GPCE+WL
Sbjct  97634  NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  97795

Query  83     DDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
              DD KV    +C +++ +   +I      DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  97796  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  97975

>PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_354.1_contig_1:1:38044:1 
REF
Length=38044

 Score = 133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = +1

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              L++L+++G+ T      +  ++ YASLR  +D ++ YKV++ A   CG T PK   Q IP
Sbjct  14398  LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  14574

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + + +TSGYT DGPCE+++ D    +  NCH        ++DYSACGDSC L+WYWLG+
Sbjct  14575  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGV  14754

Query  123    KYVEGAYSWQVYKNCVAL  140
              + ++G+YSWQ+YK C+ L
Sbjct  14755  RKLKGSYSWQIYKECIPL  14808

>PHRA:scaffold_33
Length=496317

 Score = 133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               L++L+++G  T      +  ++GY SLR  LD ++ YKV++ A   CG + PK   Q IP
Sbjct  370657  LSFLEKEGFETQENFTQFQVDNGYTSLRDFLD-KAKYKVSDGADQACGWSDPKGIPQQIP  370833

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                + + +TSGYT DGPCE+++ D    +  NCH        ++DYS CGDSC L+WYWLG+
Sbjct  370834  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  371013

Query  123     KYVEGAYSWQVYKNCVAL  140
               +Y++G+YSWQVYK C+ L
Sbjct  371014  RYLKGSYSWQVYKECIPL  371067

 Score = 74.3 bits (181),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  92      NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               NCH        ++DYS CGDSC L+WYWLG +Y++G+YSWQVYK C+ L
Sbjct  175562  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  175416

 Score = 74.3 bits (181),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  92      NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               NCH        ++DYS CGDSC L+WYWLG +Y++G+YSWQVYK C+ L
Sbjct  171203  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  171057

 Score = 33.1 bits (74),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  51      LTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
               +  P    Q IP + +   SGYT DGPCE+++
Sbjct  175684  VVGPNGIPQQIPEDGTMSPSGYTHDGPCEIYM  175589

 Score = 33.1 bits (74),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  51      LTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
               +  P    Q IP + +   SGYT DGPCE+++
Sbjct  171325  VVGPNGIPQQIPEDGTMSPSGYTHDGPCEIYM  171230

 Score = 30.8 bits (68),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 30/52 (58%), Gaps = 1/52 (2%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSP  54
               L++L+++G  T      +  ++GY SLR  L D++ YKV++ A   C  + P
Sbjct  175824  LSFLEKEGFETQENFTQFQVDNGYTSLRDFL-DKAKYKVSDGADQACWWSDP  175672

 Score = 30.8 bits (68),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 30/52 (58%), Gaps = 1/52 (2%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSP  54
               L++L+++G  T      +  ++GY SLR  L D++ YKV++ A   C  + P
Sbjct  171465  LSFLEKEGFETQENFTQFQVDNGYTSLRDFL-DKAKYKVSDGADQACWWSDP  171313

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 65/136 (48%), Gaps = 15/136 (11%)
 Frame = -2

Query  18      QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
               +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  G
Sbjct  430832  KSLKTANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVG  430671

Query  77      PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
               PCE+WLDDTKV    +C +++ +   +I      DYS+C  G    + +YWL  + ++  
Sbjct  430670  PCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSK  430491

Query  129     YSWQVYKNCVALSKTA  144
                 WQ Y     L   A
Sbjct  430490  TVWQSYSKLFGLGMPA  430443

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 84/142 (59%), Gaps = 3/142 (2%)
 Frame = +2

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLY-KVTEEALFDCGLTSPKTETQPI  61
               LA+L+ QG     +   W  + GY +LR  +D       VT  A   CGLT  K   +PI
Sbjct  488834  LAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYTTSVTPGADQTCGLTELKGPPRPI  489013

Query  62      PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYW  119
               P +   +++GYT DGPC V+LDD  V    NCH + P   ++IDYS+C     CTL+W+W
Sbjct  489014  PKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLPGKSYKIDYSSCEKKGGCTLYWFW  489193

Query  120     LGIKYVEGAYSWQVYKNCVALS  141
               LGI++V+  +SWQVYK CV L+
Sbjct  489194  LGIRFVKSRWSWQVYKECVPLT  489259

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 86/142 (61%), Gaps = 3/142 (2%)
 Frame = -2

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDES-LYKVTEEALFDCGLTSPKTETQPI  61
                LA+L+ QG     +   W  ++GY  LR  +D    +  VT  A   CGLT  K   +PI
Sbjct  1575706  LAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGLTELKGPPRPI  1575527

Query  62       PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYW  119
                P + + +++GYT DGPC ++LDD  V    NCH   P   ++ID+S+C     CTL+W+W
Sbjct  1575526  PKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQKKGGCTLYWFW  1575347

Query  120      LGIKYVEGAYSWQVYKNCVALS  141
                LGI++V+  +SWQVYK C++L+
Sbjct  1575346  LGIRFVKSRWSWQVYKECISLT  1575281

 Score = 101 bits (251),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = -3

Query  41       VTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG  100
                VT  A   CGLT  K   +PIP +    ++GYT DGPC  +LDD  V    NCH      
Sbjct  1594320  VTSGAHQTCGLTEVKGSPRPIPKDGMVTSTGYTHDGPCAFYLDDVLVLEYPNCHESITSR  1594141

Query  101      QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                 H+ID+S+C     CTL+W+WLGI++V+  +SWQVYK C+ L+
Sbjct  1594140  THKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECIPLT  1594012

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -1

Query  41       VTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG  100
                VT  A   CGLT  K   +PI  +    ++GYT DGPC  +LDD  V    NCH      
Sbjct  1596296  VTPGADQTCGLTEVKGPPRPISKDGMVTSTGYTHDGPCAFYLDDVLVMEYDNCHESITSR  1596117

Query  101      QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                 H+ID+S+C      TL+W+WLGI++V+  +S Q YK C+ L+
Sbjct  1596116  THKIDFSSCQKKGGGTLYWFWLGIRFVKSRWSRQAYKECIPLT  1595988

>PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 
genomic scaffold, whole genome shotgun sequence
Length=4768765

 Score = 122 bits (305),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 86/142 (61%), Gaps = 3/142 (2%)
 Frame = -1

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYK-VTEEALFDCGLTSPKTETQPI  61
                LA+L+ QG     +  SW  ++GY +LR  +D  +    VT  A   CGLT      +PI
Sbjct  3545263  LAFLESQGFPCQADFNSWRAQNGYKNLRDFMDRGNYTTTVTPGAN*TCGLTKLNGPPRPI  3545084

Query  62       PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGD--SCTLWWYW  119
                P N   +++GY+ +GPC  +LDD  V    NCH + P   H+IDYS+C    SCTL+W+W
Sbjct  3545083  PKNGVIRSTGYSHEGPCAAYLDDVLVMEFDNCHEKIPGKTHKIDYSSCEKKGSCTLYWFW  3544904

Query  120      LGIKYVEGAYSWQVYKNCVALS  141
                LGI++V+  +SWQVYK CV L+
Sbjct  3544903  LGIRFVKSRWSWQVYKECVPLT  3544838

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 19/113 (17%)
 Frame = -2

Query  37       SLYKVTEEALFD--CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAA  89
                S+  V  E + D  CG T    + QPIPS+   +       G+T  GPCE+++DD  V  
Sbjct  3973437  SVKDVVLEMVKDKKCGYTRTDVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLH  3973258

Query  90       GRNCHTQFPHG--------QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                G +C  +FP G        +  +D+S+C   CTL  YWL  +  +    WQ Y
Sbjct  3973257  GDDCEAEFPGGPDGSNKMSEMPVDFSSCNGKCTLTIYWLAFQNTQ----WQSY  3973111

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 13/86 (15%)
 Frame = +3

Query  49       CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
                CG T    + QPIPS+   +       G+T  GPCE+++DD  V  G +C  +FP G   
Sbjct  3740901  CGYTRADVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLHGDDCEEEFPGGPNG  3741080

Query  101      -----QHEIDYSACGDSCTLWWYWLG  121
                     +  +D+S+C   CTL  YWLG
Sbjct  3741081  SNKMSEMPVDFSSCNGKCTLTIYWLG  3741158

 Score = 47.0 bits (110),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 8/58 (14%)
 Frame = +2

Query  74       LDGPCEVWLDDTKVAAGRNCHTQFPHGQHE--------IDYSACGDSCTLWWYWLGIK  123
                L GPCE+++DD  V    +C + +P G ++        +DYS+C  SC    YWLG +
Sbjct  3744938  L*GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNASCIFSIYWLGFQ  3745111

 Score = 24.3 bits (51),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = +3

Query  49       CGLTSPKTETQPIPSNSS  66
                CG T+ + E QPIP++  
Sbjct  3744789  CGFTTTEVEPQPIPTDGK  3744842

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (48%), Gaps = 13/86 (15%)
 Frame = +2

Query  49       CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
                CG T    + QP+PS+++ +       G+T  GPCE++LDD  V  G +C  ++  G   
Sbjct  3872540  CGNTLENGDAQPVPSDATVKWLGNGGGGFTHTGPCEIYLDDKMVLHGDDCEDEYKGGAVG  3872719

Query  101      -----QHEIDYSACGDSCTLWWYWLG  121
                        +D+S+C   C   W   G
Sbjct  3872720  STQTSDMPVDFSSCNGKCDAPWLAEG  3872797

 Score = 31.2 bits (69),  Expect = 8.7, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 5/50 (10%)
 Frame = -3

Query  53       SPKTETQPIPSNSSFQTSGYTLDGPCEVWLD--DTKVAAGRNCHTQFPHG  100
                SP+T   P P N+S  T GYT  G    WL    T V   R   + +PHG
Sbjct  3881648  SPRTLASPCPVNNSSHTEGYTSPGS---WLHVRSTSVQRRRKPSSYWPHG  3881508

>PHSO:scaffold_64
Length=40116

 Score = 120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = +3

Query  3      LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
              LA+L+ QG  T  + ++W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  37965  LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  38141

Query  63     SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
                 + +++GYT DGPCEVW+D+T+V  G NCH +     + IDYSAC  +CTL WYW
Sbjct  38142  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  38312

>PHSO:scaffold_4
Length=7609242

 Score = 119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -3

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T  + + W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  4374280  LAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  4374104

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
                   + +++GYT DGPCEVW+D+T+V  G NCH +     + IDYSAC  +CTL WYW
Sbjct  4374103  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  4373933

 Score = 119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = +1

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T  + + W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  4365013  LAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  4365189

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
                   + +++GYT DGPCEVW+D+T+V  G NCH +     + IDYSAC  +CTL WYW
Sbjct  4365190  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  4365360

 Score = 41.2 bits (95),  Expect = 0.004, Method: Composition-based stats.
 Identities = 26/85 (31%), Positives = 39/85 (46%), Gaps = 13/85 (15%)
 Frame = -3

Query  32       MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS-SFQTSGYTLDGPCEVWLDDTKVAAG  90
                MLD  SLY         C  T+     QPIP+N+ +  + G    G CE  L D K+   
Sbjct  2631757  MLDGMSLYDAA------CSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  2631596

Query  91       RNCHTQFPH------GQHEIDYSAC  109
                 +C++++ H       +  IDY +C
Sbjct  2631595  DDCYSEYSHMNVNVKTESSIDYLSC  2631521

>PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 
genomic scaffold, whole genome shotgun sequence
Length=313873

 Score = 114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  59      QPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWY  118
               QPIP+  + +++GYT DGPCEVWLDD  V  G NCH +FP   + +DYS+C  +CTL WY
Sbjct  267298  QPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWY  267477

Query  119     WLGIKYVEGAYSWQVYKNCVALSKTA  144
               WLGI++++  YSWQVYK C+ L+ + 
Sbjct  267478  WLGIRFLKNKYSWQVYKACIPLAGSG  267555

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               LA+L+ QG     + ++W  E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  267108  LAFLENQGFKPQQDFKAWRDENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPIP  267284

Query  63      SNSSFQTSG  71
               +  +   SG
Sbjct  267285  AGDAAAYSG  267311

>PHSO:scaffold_11
Length=2192408

 Score = 86.3 bits (212),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = -3

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                LA+L+ QG  T     +  +++GY +LR  +D    Y VT+ A + CG T+PK   QPIP
Sbjct  2022867  LAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWTNPKGTPQPIP  2022691

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH  99
                     +++GYT DGPCE+WLDD +V    NCH   PH
Sbjct  2022690  -----RSTGYTHDGPCEIWLDDVRVLESGNCHETIPH  2022595

 Score = 52.8 bits (125),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = -1

Query  104      IDYSACGDS--CTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                IDYS+C     CT+ WYWLG+++++ +YSWQVYK C+ L+
Sbjct  2022593  IDYSSCEKKGGCTMHWYWLGVRFLKNSYSWQVYKECIPLT  2022474

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 11/78 (14%)
 Frame = -2

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      QP+PS+   +       G+T  GPCEV++DD  V  G NC  +F  G   
Sbjct  645091  CGETLADASPQPVPSDGLVKWLGNGGGGFTHVGPCEVYIDDKMVVHGDNCEDEFQGGGVG  644912

Query  101     ---QHEIDYSACGDSCTL  115
                   + +DYS+C   CTL
Sbjct  644911  STLDNPVDYSSCNGKCTL  644858

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 59/137 (43%), Gaps = 36/137 (26%)
 Frame = +1

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL----------  74
               GY+SLR MLD +         + DC  T  + +  P+        +G T+          
Sbjct  989584  GYSSLRDMLDQQ---------VADCANT--RIDVSPV------DVAGLTVVTWENGNGIT  989712

Query  75      --DGPCEVWLDDTKVAAGRNCHTQFPHGQH---EIDYSACGDSCTLWWYWLGIKYVEGAY  129
                  GPCEVW+DD  V    +C   +  G       ++S C   CTL +YWL +   +   
Sbjct  989713  SHRGPCEVWVDDIVVNHQDDCVATYGAGTQIKVPANFSKCLGDCTLRFYWLALHEPK---  989883

Query  130     SWQVYKNCVALSKTATA  146
                WQ+YK CV +   + A
Sbjct  989884  -WQIYKQCVPIVNNSGA  989931

 Score = 46.6 bits (109),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 29/57 (51%), Gaps = 5/57 (9%)
 Frame = -1

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG  100
               CG T      QPIPS+   +       G+T  GPCE++LDD  V  G NC  +F  G
Sbjct  471020  CGNTLDNGAAQPIPSDGKVKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEFKGG  470850

 Score = 28.1 bits (61),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 17/36 (47%), Gaps = 4/36 (11%)
 Frame = -2

Query  106     YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
               YS+C   CTL  YWL  +  +    WQ Y   V  S
Sbjct  470821  YSSCNGDCTLTIYWLAFQNAQ----WQAYGKFVPTS  470726

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 32/61 (52%), Gaps = 8/61 (13%)
 Frame = -1

Query  71      GYTLDGPCEVWLDDTKVAAGRNCHTQFPHG--------QHEIDYSACGDSCTLWWYWLGI  122
               G+T  GPCEV++DD  VA G NC  +F  G            DYS+C   CTL  YWL  
Sbjct  498995  GFTHVGPCEVYIDDKMVAHGDNCEDEFKGGDVGSKETSDIPADYSSCNGKCTLTMYWLAF  498816

Query  123     K  123
               +
Sbjct  498815  Q  498813

 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Frame = -1

Query  59      QPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ  101
               Q IP++   +     + G+T  GPCE+++D+T V  G NC  ++P G 
Sbjct  500489  QAIPTDGMAKWLGNGSGGFTHVGPCEIYIDNTMVLHGDNCEDEYPGGD  500346

 Score = 29.3 bits (64),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 18/37 (49%), Gaps = 4/37 (11%)
 Frame = -2

Query  104     IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               IDYS+C   CTL  YWL  +  +     QVY  C   
Sbjct  500317  IDYSSCNGDCTLTIYWLAFQNEQ----*QVYSKCFGF  500219

>PHRA:scaffold_494
Length=11395

 Score = 72.4 bits (176),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  92    NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             NCH        ++DYS CGDSC L+WYWLG +Y++G+YSWQVYK C+ L
Sbjct  8297  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  8151

 Score = 62.4 bits (150),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -1

Query  1     MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
             + L++L+++G  T      +  ++GY SLR  LD ++ YKV++ A   CG + PK   Q 
Sbjct  8566  VILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD-KAKYKVSDGADQACGWSDPKGIPQQ  8390

Query  61    IPSNSSFQTSGYTLDGPCEVWL  82
             IP + +   SGYT DGPCE+++
Sbjct  8389  IPEDGTMSPSGYTHDGPCEIYM  8324

>PHRA:scaffold_2892
Length=2014

 Score = 72.4 bits (176),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  92    NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             NCH        ++DYS CGDSC L+WYWLG +Y++G+YSWQVYK C+ L
Sbjct  1661  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  1515

 Score = 62.4 bits (150),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -1

Query  1     MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
             + L++L+++G  T      +  ++GY SLR  LD ++ YKV++ A   CG + PK   Q 
Sbjct  1930  VILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD-KAKYKVSDGADQACGWSDPKGIPQQ  1754

Query  61    IPSNSSFQTSGYTLDGPCEVWL  82
             IP + +   SGYT DGPCE+++
Sbjct  1753  IPEDGTMSPSGYTHDGPCEIYM  1688

>PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_182:1:48098:1 
REF
Length=48098

 Score = 73.6 bits (179),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +3

Query  77    PCEVWLDDTKVAAGR--NCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
             PCEVW+D+T+V   +  NCH     G   ++ID+S C   C + WYWLG++ +   +SWQ
Sbjct  1740  PCEVWIDNTRVLGSKLGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQ  1919

Query  133   VYKNCVALSKTATA  146
             VYK C+ +  + TA
Sbjct  1920  VYKACIPIRASGTA  1961

 Score = 50.4 bits (119),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 1/59 (2%)
 Frame = +1

Query  19    SWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDG  76
             S+    G  +LR  +DD++ YKV    A F+CG T P    QPIP N   +++G+T DG
Sbjct  1564  SYFNSKGIKTLRHFMDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG  1740

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (51%), Gaps = 16/116 (14%)
 Frame = +1

Query  22    QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP-SNSSFQTSGYTLDGPCEV  80
             ++HG   LR+ +D     K+TE     CG +      +PIP +N+       T  GPCE 
Sbjct  4855  KQHGVKDLRSYID----AKITE-----CGDSLKDVSPKPIPKTNTVTFERALTHKGPCEF  5007

Query  81    WLDDTKVAAGRNCHTQFPHGQH-EIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVY  134
             W+DDT+V    +C   F       +DYS C G +C L +YWLG++  +    WQVY
Sbjct  5008  WIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQNSD----WQVY  5163

>PHRA:scaffold_9
Length=727265

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 18/134 (13%)
 Frame = +1

Query  19      SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLD  75
               S  + +GY+ +R +LD D SLY        DCG T P    +  PS  +++F + G    
Sbjct  217981  SLKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATF-SRGMVHA  218139

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSAC-GDSCTLWWYWLGIKYVEG  127
               GPCE+WLDDTKV +  NC   +  G  E       +DYS+C    CTL +YWL  + ++ 
Sbjct  218140  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  218319

Query  128     AYSWQVYKNCVALS  141
               +  WQVYKNCV L+
Sbjct  218320  STVWQVYKNCVPLT  218361

>PHRA:scaffold_4
Length=963095

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 72/136 (53%), Gaps = 16/136 (12%)
 Frame = +3

Query  19      SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
               S    +GY+ +R +LD D SLY        DCG T+P  T   P  +  +  + G    G
Sbjct  333126  SLKSSNGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVG  333287

Query  77      PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
               PCE+WLDDTKV +  NC   +  G  +       +DYS+C  S C L +YWL  + V+ +
Sbjct  333288  PCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSS  333467

Query  129     YSWQVYKNCVALSKTA  144
                 WQVYKNCV L+  A
Sbjct  333468  MVWQVYKNCVPLTGPA  333515

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 16/136 (12%)
 Frame = +2

Query  19      SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
               S  + +GY+ +R +LD D +LY        +CG T+P  T   P  +  +  + G    G
Sbjct  239777  SLKKSNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHAG  239938

Query  77      PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
               PCE+WLDDT V +  +C T +  G  E       +DYS+C  S C L +YWL  + V+  
Sbjct  239939  PCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSK  240118

Query  129     YSWQVYKNCVALSKTA  144
                 WQVYK+CV L+  A
Sbjct  240119  TVWQVYKDCVPLTGPA  240166

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 69/130 (53%), Gaps = 16/130 (12%)
 Frame = +3

Query  22      QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCE  79
                 +GY+ +R +LD D SLY        DCG T+P  T   P  +  +  + G    GPCE
Sbjct  331380  SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  331541

Query  80      VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
               +WLDDT V +  +C T +  G  +       +DYS+C  S C L +YWL  + V+    W
Sbjct  331542  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  331721

Query  132     QVYKNCVALS  141
               QVYK+CV L+
Sbjct  331722  QVYKDCVPLT  331751

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 18/127 (14%)
 Frame = +2

Query  29      LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPCEVWLDDT  85
               +R +LD D +LY        +CG T+P    +  PS  +++F + G    GPCE+WLDD 
Sbjct  236645  IRTLLDSDTTLYGA------NCGYTNPDASPKDPPSTGDATF-SRGIVHAGPCEIWLDDK  236803

Query  86      KVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNC  137
                V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC
Sbjct  236804  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNC  236983

Query  138     VALSKTA  144
               + LS  A
Sbjct  236984  IPLSGPA  237004

 Score = 75.1 bits (183),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 63/127 (50%), Gaps = 18/127 (14%)
 Frame = +2

Query  29      LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPCEVWLDDT  85
               +R M+D D  LY        DCG T PK   +  PS  +++F + G    GPCEVWLDD 
Sbjct  238262  IRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATF-SRGMVHAGPCEVWLDDE  238420

Query  86      KVAAGRNCHTQFPHGQH-------EIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
                V    +C + +  G          IDYS+C    C   ++WL ++  +    WQVYKNC
Sbjct  238421  MVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNC  238600

Query  138     VALSKTA  144
               V LS  A
Sbjct  238601  VPLSGPA  238621

 Score = 74.7 bits (182),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 16/130 (12%)
 Frame = +3

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
               + Y  L+ ++D     +       DCG T P  T + P    ++  + G    GPCE+WL
Sbjct  235167  NNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWL  235325

Query  83      DDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVY  134
               DD  V    +C + +  G  E       +DYS C    C L +YWL ++ ++G   WQ Y
Sbjct  235326  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSY  235505

Query  135     KNCVALSKTA  144
               KNC+ L+  A
Sbjct  235506  KNCIPLTGPA  235535

 Score = 52.0 bits (123),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 35/72 (49%), Gaps = 9/72 (13%)
 Frame = -3

Query  72      YTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS-CTLWWYWLGI  122
               +   GPCE+WLDDT V    +C   F    +         IDYS+C  S C L +YWL  
Sbjct  230421  FCRQGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYWLAF  230242

Query  123     KYVEGAYSWQVY  134
               +     Y WQ+Y
Sbjct  230241  QGSNDGYVWQIY  230206

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 10/71 (14%)
 Frame = -2

Query  74      LDGPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS-CTLWWYWLGIK-  123
               + GPCE+WLDDT V    +C   F    +         IDYS+C  S C   +YWL  + 
Sbjct  228493  VQGPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQG  228314

Query  124     YVEGAYSWQVY  134
                  G Y WQ+Y
Sbjct  228313  STSGKYVWQIY  228281

>PYAP:scaffold_1129 pag1_scaffold_1129 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_1129:1:6613:1 
REF
Length=6613

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 13/132 (10%)
 Frame = +1

Query  11    VNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-T  69
             + T  +  +  ++HG  +LRA L+ +            CG T+P  + +PIP +   +  
Sbjct  3643  IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  3795

Query  70    SGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGA  128
             S     GPCE+W D+T+V    +C+ +F    Q +IDYS C   C L +YWLG++  +G 
Sbjct  3796  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGG  3969

Query  129   YSWQVYKNCVAL  140
               WQ YKNCV L
Sbjct  3970  KRWQSYKNCVPL  4005

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = -2

Query  76   GPCEVWLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
            GPCE+W D+T+V    +C  +F    Q +IDYS C  +C L +YWLG++  +G   WQ Y
Sbjct  612  GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSY  439

Query  135  KNCVAL  140
            KNCV +
Sbjct  438  KNCVPI  421

>PHCA:scaffold_24 PHYCAscaffold_24
Length=787421

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 18/137 (13%)
 Frame = +3

Query  19      SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQ--PIPSNSSFQTSGYTLD  75
               S  + +GY+ +R +LD D  LY        +CG T P    +  P   +++F + G    
Sbjct  171984  SLKESNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATF-SRGMVHA  172142

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEG  127
               GPCE+WLDDTKV +  +C T +  G  E       +DYS+C  S C L +YWL  + V+ 
Sbjct  172143  GPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  172322

Query  128     AYSWQVYKNCVALSKTA  144
                  WQVYK+CV L+  A
Sbjct  172323  KIVWQVYKDCVPLTGPA  172373

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 64/131 (49%), Gaps = 15/131 (11%)
 Frame = +1

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVW  81
               ++ Y  +R ++D   +Y        DCG T PK T   P    ++  + G    GPCE+W
Sbjct  167662  KNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  167823

Query  82      LDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQV  133
               LDD  V    +C   +  G  E       +DYS+C    C L +YWL ++ ++G   WQ 
Sbjct  167824  LDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGKTVWQA  168003

Query  134     YKNCVALSKTA  144
               YKNC+ L+  A
Sbjct  168004  YKNCIPLTGPA  168036

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 16/126 (13%)
 Frame = +3

Query  29      LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
               +R +LD D  LY        DCG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  169116  IRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  169277

Query  87      VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
               V +  +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC+
Sbjct  169278  VLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  169457

Query  139     ALSKTA  144
                LS  A
Sbjct  169458  PLSGPA  169475

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 65/131 (50%), Gaps = 18/131 (14%)
 Frame = +1

Query  22      QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPC  78
               + +    +R M+D D  LY        DCG T PK + +  PS  +++F + G    GPC
Sbjct  170593  KSNNVKDIRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATF-SRGIVHAGPC  170751

Query  79      EVWLDDTKVAAGRNCHTQFPHGQH-------EIDYSACG-DSCTLWWYWLGIKYVEGAYS  130
               E+WLDD  V    +C + +  G          +DYS+C    C   +YWL ++  +    
Sbjct  170752  EIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTL  170931

Query  131     WQVYKNCVALS  141
               WQVYKNC+ L+
Sbjct  170932  WQVYKNCIPLT  170964

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 68/148 (46%), Gaps = 41/148 (28%)
 Frame = -1

Query  22      QEHGYAS-LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQT--------  69
               +E GYA+ +R +LD D +LY        +CG ++P  + +  PS+  ++F+         
Sbjct  161153  KEAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFERGLAHHVSI  160992

Query  70      -------SGYTLD------GPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSA  108
                      SG+ L+      GPCE+WLDD  V    +C   F    +         IDYS+
Sbjct  160991  GVLSGVLSGFFLNRHVRFQGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSS  160812

Query  109     CGDS-CTLWWYWLGIK-YVEGAYSWQVY  134
               C  S C   +YWL  +    G Y WQ+Y
Sbjct  160811  CSSSGCMFRFYWLAFQGSTSGKYVWQIY  160728

 Score = 31.6 bits (70),  Expect(2) = 0.022, Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 37/95 (39%), Gaps = 25/95 (26%)
 Frame = -2

Query  22      QEHGY-ASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSG--------  71
               +E+GY   +R +LD D +LY        DCG + P    +  PS+ +   S         
Sbjct  162688  KENGYDKDIRKLLDSDTNLYGA------DCGYSDPNATPKTPPSDGTATFSRGIAHHVRG  162527

Query  72      ---------YTLDGPCEVWLDDTKVAAGRNCHTQF  97
                        Y   GPCE+W+ D       +C   F
Sbjct  162526  LSPLCNLTYYLPQGPCEIWVGDKMALHDDDCAKTF  162422

 Score = 26.6 bits (57),  Expect(2) = 0.022, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 18/32 (56%), Gaps = 1/32 (3%)
 Frame = -1

Query  104     IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
               IDYS+C  S C   +YWL  +  +  Y  Q+Y
Sbjct  162365  IDYSSCPSSGCMFRFYWLAFQGSDNGYV*QIY  162270

>PHKE:scaffold_221 scf_22126_221.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_221.1:1:58736:1 
REF
Length=58736

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 73/138 (53%), Gaps = 16/138 (12%)
 Frame = -1

Query  19    SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
             S    +GY+ +R +LD D SLY        DCG T+P  T   P  +  +  + G    G
Sbjct  2630  SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVG  2469

Query  77    PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
             PCE+WLDDT V +  +C T +  G  +       +DYS+C  S C L +YWL  + V+ +
Sbjct  2468  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSS  2289

Query  129   YSWQVYKNCVALSKTATA  146
               WQVYK+CV L+  A+ 
Sbjct  2288  MVWQVYKDCVPLTGPASG  2235

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 16/123 (13%)
 Frame = -1

Query  29     LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
              +R + D D SLY        +CG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  53081  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  52920

Query  87     VAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              V    +C + +  G  E       +DYS+C    C   +YW+ ++ ++G   WQVYKNCV
Sbjct  52919  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  52740

Query  139    ALS  141
               L+
Sbjct  52739  PLT  52731

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 18/130 (14%)
 Frame = -3

Query  26     YASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPCEVWL  82
              Y+ +R + D D SLY        +CG T P    +  P+  +++F + G    G CE+WL
Sbjct  51429  YSDIRTLPDSDNSLYGA------NCGFTDPNATPKDPPTIGDATF-SCGMMHIGSCEIWL  51271

Query  83     DDTKVAAGRNCHTQFPHGQHE-------IDYSACGDSC-TLWWYWLGIKYVEGAYSWQVY  134
              DDT V +  +C   +     E       ID S C  S   L +YWL  + V+    WQVY
Sbjct  51270  DDTMVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVY  51091

Query  135    KNCVALSKTA  144
              K+CV L+  A
Sbjct  51090  KDCVPLTGPA  51061

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = +1

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQHE--------IDYSACGDS-CTLWWYWLGIKYVE  126
              GPCE+WLDDT V    +C   F    +E        +DYS+C  S C L +YWL  +  +
Sbjct  57631  GPCEIWLDDTMVLHNDDCEEAFGTSDYETIKSVMKPVDYSSCSSSGCMLRFYWLAFQGSK  57810

Query  127    -GAYSWQVY  134
               G Y WQ+Y
Sbjct  57811  TGKYVWQIY  57837

>PHSO:scaffold_2
Length=11587142

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 16/133 (12%)
 Frame = +3

Query  22       QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDG-PCE  79
                + +GY+ +R +LD D SLY        DCG T+P    +  P+      S   +   PCE
Sbjct  2559771  ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  2559932

Query  80       VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
                +WLDDT V +  +C T +  G  E       +DYS+C  S C L +YWL  + V+    W
Sbjct  2559933  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  2560112

Query  132      QVYKNCVALSKTA  144
                QVYK+CV L+  A
Sbjct  2560113  QVYKDCVPLTGPA  2560151

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 15/130 (12%)
 Frame = +3

Query  24       HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWL  82
                + Y  +R+++D   +Y        DCG T PK +    P++ +   S G    GPCE+WL
Sbjct  2546253  NNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWL  2546414

Query  83       DDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
                DD  V    +C + +  G  E       +DYS+C    C L +YWL ++ ++G   WQ Y
Sbjct  2546415  DDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAY  2546594

Query  135      KNCVALSKTA  144
                KNC+ L+  A
Sbjct  2546595  KNCIPLTGPA  2546624

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 16/126 (13%)
 Frame = +1

Query  29       LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
                +R +LD D  LY        +CG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  2550706  IRTLLDSDTKLYGA------NCGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  2550867

Query  87       VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
                V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC+
Sbjct  2550868  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  2551047

Query  139      ALSKTA  144
                 LS  A
Sbjct  2551048  PLSGPA  2551065

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 18/134 (13%)
 Frame = +2

Query  22       QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPC  78
                + +    +R M+D D  LY        DCG T PK + Q  P+  +++F + G    GPC
Sbjct  2558300  KANNVKDIRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATF-SRGIVHAGPC  2558458

Query  79       EVWLDDTKVAAGRNCHTQFPHGQH-------EIDYSACGDS-CTLWWYWLGIKYVEGAYS  130
                E+WLDD  V    +C + +  G          +DYS+C    C   +YWL ++  +    
Sbjct  2558459  EIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTY  2558638

Query  131      WQVYKNCVALSKTA  144
                WQVYKNC+ L+  A
Sbjct  2558639  WQVYKNCIPLTGPA  2558680

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 9/95 (9%)
 Frame = -3

Query  60       PIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS  112
                P   +++F + G    GPCE+WLDDT V +  +C T +  G  E       +DYS+C  S
Sbjct  2680104  PTTGDATF-SRGMVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQETASVFTPVDYSSCSTS  2679928

Query  113      -CTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 C L +YWL  + V+    WQVYK+CV L+  A+ 
Sbjct  2679927  GCMLRFYWLAFQGVDSEIVWQVYKDCVPLTGPASG  2679823

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 34/71 (48%), Gaps = 12/71 (17%)
 Frame = -2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQHE--------IDYSAC-GDSCTLWWYWL---GIK  123
                GPCE+WLDD  +    +C   F    +E        IDYS+C  + C L +YWL   G  
Sbjct  2543344  GPCEIWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRT  2543165

Query  124      YVEGAYSWQVY  134
                     Y WQ+Y
Sbjct  2543164  TGNSKYVWQIY  2543132

 Score = 40.0 bits (92),  Expect = 0.010, Method: Composition-based stats.
 Identities = 26/85 (31%), Positives = 39/85 (46%), Gaps = 13/85 (15%)
 Frame = +2

Query  32       MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS-SFQTSGYTLDGPCEVWLDDTKVAAG  90
                MLD  SLY         C  T+     QPIP+N+ +  + G    G CE  L D K+   
Sbjct  1607606  MLDGMSLYDAA------CSFTNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYA  1607767

Query  91       RNCHTQFPH------GQHEIDYSAC  109
                 +C++++ H       +  IDY +C
Sbjct  1607768  DDCYSEYSHLNVNVKTESFIDYLSC  1607842

 Score = 37.0 bits (84),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 30/69 (43%), Gaps = 10/69 (14%)
 Frame = +2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQH--------EID-YSACGDSCTLWWYWLGIK-YV  125
                GPCE+WLDDT V    +C   F    +         ID  S     C   +YWL  +   
Sbjct  2541395  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPID*SSCSSSGCMFRFYWLAFQGST  2541574

Query  126      EGAYSWQVY  134
                 G Y WQ+Y
Sbjct  2541575  SGKYVWQIY  2541601

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 70/136 (51%), Gaps = 16/136 (12%)
 Frame = +2

Query  19       SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
                S  + +GY+ +RA+LD D  LY        +CG T P  T   P  +  +  + G    G
Sbjct  1020596  SLKESNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAG  1020757

Query  77       PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGA  128
                PCE+WLDDT V +  +C T +  G  +       +DYS+C    C L +YWL  + V+  
Sbjct  1020758  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  1020937

Query  129      YSWQVYKNCVALSKTA  144
                  WQVYK+CV L+  A
Sbjct  1020938  MVWQVYKDCVPLTGPA  1020985

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 70/135 (52%), Gaps = 16/135 (12%)
 Frame = +3

Query  22       QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCE  79
                  +GY+ +R +LD D  LY        DCG T+P  T   P  +  +  + G    GPCE
Sbjct  1068759  SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  1068920

Query  80       VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
                +WLDDT V +  NC T +  G  +       +DYS+C  S C L +YWL  + V+    W
Sbjct  1068921  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  1069100

Query  132      QVYKNCVALSKTATA  146
                QVYK+CV L+  A+ 
Sbjct  1069101  QVYKDCVPLTGPASG  1069145

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 68/131 (52%), Gaps = 15/131 (11%)
 Frame = +2

Query  23       EHGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVW  81
                ++ Y  +R+++D   +Y        DCG T PK T ++P    ++  + G    GPCE+W
Sbjct  1014641  KNNYKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIW  1014802

Query  82       LDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQV  133
                LDD  V    +C + +  G  +       +DYS+C    C L +YWL ++ ++G   WQ 
Sbjct  1014803  LDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  1014982

Query  134      YKNCVALSKTA  144
                YKNC+ L+  A
Sbjct  1014983  YKNCIPLTGPA  1015015

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 16/126 (13%)
 Frame = +1

Query  29       LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
                +R +LD D SLY        DCG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  1016194  IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  1016355

Query  87       VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
                V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC+
Sbjct  1016356  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  1016535

Query  139      ALSKTA  144
                 LS  A
Sbjct  1016536  PLSGPA  1016553

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 18/131 (14%)
 Frame = +3

Query  22       QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPC  78
                + +    +R M+D D  LY        DCG T PK   +  PS  +++F + G    GPC
Sbjct  1018413  KSNNVKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATF-SRGIVHAGPC  1018571

Query  79       EVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSAC-GDSCTLWWYWLGIKYVEGAYS  130
                E+WLDD  V    +C + +  G  +       +DYS+C    C   +YWL ++  +    
Sbjct  1018572  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTL  1018751

Query  131      WQVYKNCVALS  141
                WQVYKNC+ LS
Sbjct  1018752  WQVYKNCIPLS  1018784

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 62/127 (49%), Gaps = 17/127 (13%)
 Frame = -3

Query  20       WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGP  77
                W  ++  ASL+  +   + Y      + +CG T  K   QP+PS+   Q  T G +  GP
Sbjct  1529232  WFTKNNVASLKEFI---TTYGTD---ISECGNTEKKGTAQPVPSDGYAQHDTLGNSHPGP  1529071

Query  78       CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
                CE+W DDT+V    NC   F  GQ      ID S C  S    +YWL +     A  WQV
Sbjct  1529070  CEIWCDDTRVFHDTNCVVTF-SGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQV  1528906

Query  134      YKNCVAL  140
                Y NCVAL
Sbjct  1528905  YINCVAL  1528885

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 49/101 (49%), Gaps = 11/101 (11%)
 Frame = -2

Query  46       LFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ--  101
                L +CG T      + +PS+   +  + G +  GPCEVW DDT+V    NC  +F  GQ  
Sbjct  1507420  LPECGNTKKNGTPRQLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDTNCAGKF-AGQVP  1507244

Query  102      --HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                    ID   C  S  L +YWL +        WQVY NCV L
Sbjct  1507243  TKIPIDLKTCKSSSELVFYWLALH----VQPWQVYINCVTL  1507133

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 9/70 (13%)
 Frame = -1

Query  74       LDGPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS-CTLWWYWLGIKY  124
                L GPCE+WLDD  V    +C   F    +         IDYS+C  S C   +YW+  + 
Sbjct  1010303  LQGPCEIWLDDKMVLHDDDCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQG  1010124

Query  125      VEGAYSWQVY  134
                 +  Y  Q+Y
Sbjct  1010123  SDNGYVRQIY  1010094

>PHCA:scaffold_93 PHYCAscaffold_93
Length=150113

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 15/127 (12%)
 Frame = -3

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
               + Y  +R+M+D  S+Y        DCG T P  T   P    ++  + G    GPCE+WL
Sbjct  144741  NNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWL  144580

Query  83      DDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
               DD  V    +C + +  G  +       +DYS+C    C L +YWLG++ ++G   WQ Y
Sbjct  144579  DDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAY  144400

Query  135     KNCVALS  141
               KNC+ L+
Sbjct  144399  KNCIPLT  144379

>PHCA:scaffold_98 PHYCAscaffold_98
Length=130742

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 71/138 (51%), Gaps = 16/138 (12%)
 Frame = +2

Query  19     SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDG  76
              S    +GY+ +R +LD D SLY        DCG T+     +  PS      S G    G
Sbjct  81206  SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVG  81367

Query  77     PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
              PCE+WLDDT V +  +C T +  G  +       +DYS+C  S C L +YWL  + V+ A
Sbjct  81368  PCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSA  81547

Query  129    YSWQVYKNCVALSKTATA  146
                WQVYK+CV L+  A+ 
Sbjct  81548  IVWQVYKDCVPLTGPASG  81601

>PHSO:scaffold_16
Length=803425

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 66/131 (50%), Gaps = 15/131 (11%)
 Frame = -3

Query  18      QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDG  76
                S    H Y  LR +LD+ ++Y        +CG T+P    QPIP+N  +  + G    G
Sbjct  551501  NSLKTSHNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTG  551340

Query  77      PCEVWLDDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGA  128
               PCE+WLDD KV A  +C++++ H       +  +DYS C     C + +YWLG + +   
Sbjct  551339  PCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKK  551160

Query  129     YSWQVYKNCVA  139
                 WQ Y   +A
Sbjct  551159  TVWQTYSTLLA  551127

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 16/126 (13%)
 Frame = -1

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDGPCEVWL  82
               + +  L+ MLDD SLY        DCG T P    QPIP++  +  + G    GPCE WL
Sbjct  554092  NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  553931

Query  83      DDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYS-WQV  133
               DD KV    +C++++ H       +  IDYS+C  G    + +YWLG + ++   + WQ 
Sbjct  553930  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  553751

Query  134     YKNCVA  139
               Y   + 
Sbjct  553750  YSTLLG  553733

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 16/126 (13%)
 Frame = +2

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDGPCEVWL  82
               + +  L+ MLDD SLY        DCG T P    QPIP++  +  + G    GPCE WL
Sbjct  557060  NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  557221

Query  83      DDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYS-WQV  133
               DD KV    +C++++ H       +  IDYS+C  G    + +YWLG + ++   + WQ 
Sbjct  557222  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  557401

Query  134     YKNCVA  139
               Y   + 
Sbjct  557402  YSTLLG  557419

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 15/121 (12%)
 Frame = -3

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDGPCEVW  81
                H Y  LR +LDD S Y        +CG T+P     PIP+N  +  + G    GPCE+W
Sbjct  542999  SHNYKDLRTLLDDTSKYGP------NCGYTNPNGTP*PIPTNGKAIFSRGLIHTGPCEIW  542838

Query  82      LDDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQV  133
               LD+ KV A  +C+ ++ H       +  +DYS C     C + +Y L  + +     WQ 
Sbjct  542837  LDNKKVMAADDCYNRYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYCLAFQALGKKTVWQT  542658

Query  134     Y  134
               Y
Sbjct  542657  Y  542655

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 16/131 (12%)
 Frame = +2

Query  14      SIEA-QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
               S+E  +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S  
Sbjct  521924  SVEVFKSLKSANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRA  522085

Query  73      TLD-GPCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIK  123
                +  GPCE+WLD+TKV    +C +++ +   +I      DYS+C  G    + +YWL  +
Sbjct  522086  LVHVGPCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQ  522265

Query  124     YVEGAYSWQVY  134
                ++    WQ Y
Sbjct  522266  GLDSKTVWQSY  522298

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (50%), Gaps = 15/125 (12%)
 Frame = -1

Query  19      SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGP  77
               S+   + +  L+ ++DD S+Y        DCG T P    QPIP++     S G    GP
Sbjct  524497  SFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGP  524336

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSAC--GDSCTLWWYWLGIKYVEGAY  129
               CE+WLDD KV +  +C++++ +   +      +DYS+C  G    +  Y LG + +    
Sbjct  524335  CEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKT  524156

Query  130     SWQVY  134
                WQ Y
Sbjct  524155  VWQSY  524141

>PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 
genomic scaffold, whole genome shotgun sequence
Length=4722445

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 16/126 (13%)
 Frame = -3

Query  29       LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
                +R +LD D SLY        DCG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  3772778  IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  3772617

Query  87       VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
                V    +C + +  G  E       +DYS+C    C L +YWL ++ ++G   WQVYKNC+
Sbjct  3772616  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  3772437

Query  139      ALSKTA  144
                 LS  A
Sbjct  3772436  PLSGPA  3772419

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 67/131 (51%), Gaps = 15/131 (11%)
 Frame = -3

Query  23       EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVW  81
                ++ +  +R+++D   ++        +CG T PK +    PS+ +   S G    GPCE+W
Sbjct  3774350  KNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIW  3774189

Query  82       LDDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQV  133
                LDD  V    +C + +  G  +       +DYS+C    C L +YWL ++ ++G   WQ 
Sbjct  3774188  LDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQA  3774009

Query  134      YKNCVALSKTA  144
                YKNC+ L+  A
Sbjct  3774008  YKNCIPLTGPA  3773976

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 16/129 (12%)
 Frame = -3

Query  22       QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCE  79
                + +    +R M+D D  LY        DCG T PK T   P  +  +  + G    GPCE
Sbjct  3770612  KSNNIKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCE  3770451

Query  80       VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSAC-GDSCTLWWYWLGIKYVEGAYSW  131
                +WLDD  V    +C + +  G  +       +DYS+C    C   +YWL ++  +    W
Sbjct  3770450  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLW  3770271

Query  132      QVYKNCVAL  140
                QVYKNC+ L
Sbjct  3770270  QVYKNCIPL  3770244

 Score = 60.8 bits (146),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 15/127 (12%)
 Frame = -2

Query  19       SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDG  76
                SW  ++   S++        +K     + +CG T      QP+PS+   +  + G +  G
Sbjct  2171475  SWFTKNNVDSVK------DFFKKYVPEVPECGNTKKNGTPQPLPSDGYVKHDSLGNSHPG  2171314

Query  77       PCEVWLDDTKVAAGRNCHTQFP---HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
                PCEVW DD +V    NC  +F      +  ID   C  S  L +YWL + +V+    WQV
Sbjct  2171313  PCEVWCDDIRVFHDMNCAGKFAGEVPTKVPIDMKTCKSSSELVFYWLAL-HVQ---PWQV  2171146

Query  134      YKNCVAL  140
                Y NCV L
Sbjct  2171145  YINCVTL  2171125

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 35/83 (42%), Gaps = 9/83 (11%)
 Frame = +1

Query  61       IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS  112
                +P       S   + GPCE+WLDD  V    +C   F    H         IDYS+C  S
Sbjct  3795940  LPE*QKVLNSRILMQGPCEIWLDDKMVLHDDDCEKIFGTADHMTQKSILKPIDYSSCSAS  3796119

Query  113      -CTLWWYWLGIKYVEGAYSWQVY  134
                 C   +YW+  +     Y  Q+Y
Sbjct  3796120  GCVYRFYWIAFQGSNNGYVRQIY  3796188

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 2/52 (4%)
 Frame = +2

Query  48       DCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQF  97
                +CG T      QP+PS+   +  + G +  GPCEVW DDT+V    NC  +F
Sbjct  2170709  ECGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDINCAGKF  2170864

 Score = 40.4 bits (93),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = -1

Query  104      IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                +DYS C  S C L +YWL  + V+    WQVYK+CV+L+
Sbjct  3570697  VDYSLCSTSGCMLRFYWLAFQGVDSDMVWQVYKDCVSLT  3570581

 Score = 24.3 bits (51),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  77       PCEVWLDDTKVAAGRNC  93
                P E+WLDDT V +  +C
Sbjct  3570791  PFEIWLDDTMVLSHDDC  3570741

 Score = 35.8 bits (81),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  115      LWWYWLGIKYVEGAYSWQVYKNCVALS  141
                L +YWL ++ ++G   WQVYK C+ LS
Sbjct  3736431  LRFYWLALQRLDGKTYWQVYKICIPLS  3736511

>PYAP:scaffold_216 pag1_scaffold_216 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_216:1:44217:1 
REF
Length=44217

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 15/139 (11%)
 Frame = -3

Query  10    GVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQT  69
             G  T  +  +  ++ G   LR+ L+D+            CG T+P  + +PIP +   + 
Sbjct  2104  GFKTGAQYAAEAKKRGIKDLRSFLEDKGPL---------CGNTNPNAKAKPIPKDGLIKF  1952

Query  70    SGYTLD--GPCEVWLDDTKVAAGRNCHTQF-PHGQHEIDYSACGDSCTLWWYWLGIKYVE  126
                TL+  GPCE W+D+T+V    +C     P  Q +++ SAC   C L +YWLG++  +
Sbjct  1951  KS-TLEHAGPCEFWVDNTRVFQNDDCEKLLGPAKQVKVNLSACKGKCMLRFYWLGLQ--D  1781

Query  127   GAYSWQVYKNCVALSKTAT  145
             G   WQ YKNCV +  + T
Sbjct  1780  GGKRWQSYKNCVPMGSSGT  1724

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 13/121 (11%)
 Frame = +3

Query  22     QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEV  80
              ++ G  +LRA L+ +           +CG T+P  + +PIPS+   +  S     GPCEV
Sbjct  34410  KKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEV  34562

Query  81     WLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
              W D+T V +  +C  +F    Q +IDYS C  +C L +YWLG++  +G   WQ YKNCV 
Sbjct  34563  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  34736

Query  140    L  140
              +
Sbjct  34737  I  34739

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 13/118 (11%)
 Frame = +2

Query  25     GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVWLD  83
              G+  LR+ L+D+            CG + P    +PIPS+ + +  S     GPCEVWLD
Sbjct  25664  GFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLD  25816

Query  84     DTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +T+     +C   F      ++D+ AC  SC L +YWLG++  +G   WQ YKNC+ L
Sbjct  25817  NTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  25984

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 13/121 (11%)
 Frame = -3

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEV  80
            ++ G   LR+ L+ +            CG +    + + IP + + +  S     GPCE+
Sbjct  730  KKRGIKDLRSFLESKGPV---------CGNSLINAKAKAIPGDGTIKFASTLEHPGPCEI  578

Query  81   WLDDTKVAAGRNCHTQFPHGQH-EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
            WLD+T+V    +C  +F      +I++SAC   CTL +YWLG++  +G   WQ YKNC+ 
Sbjct  577  WLDNTRVFQNDDCEKKFGSATSTKINFSACKGKCTLRFYWLGLQ--DGGKRWQSYKNCIP  404

Query  140  L  140
            L
Sbjct  403  L  401

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 23/131 (18%)
 Frame = -1

Query  22    QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQTSGYTLD--GP  77
             ++ G   LR+ L+ +            CG T+P    + IP +    FQ+   TL+  GP
Sbjct  3660  KKRGIKDLRSFLESKGPV---------CGNTNPNARAKAIPGDGMVKFQS---TLEHPGP  3517

Query  78    CEVWLDDTKVAAGRNCHTQFPHGQH---EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             CE+WLD+T+V    +C      GQ    ++++SAC   C + +YWLG++  +    WQ Y
Sbjct  3516  CEIWLDNTRVYQNDDCEKSL--GQSTSVKVNFSACKGKCMMRFYWLGLQ--DSGTRWQSY  3349

Query  135   KNCVALSKTAT  145
             KNC+ L  + T
Sbjct  3348  KNCIPLGGSGT  3316

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 62/123 (50%), Gaps = 14/123 (11%)
 Frame = +1

Query  22     QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEV  80
              ++ G+  LR+ L+D+            CG T+P  + + +PS+S    S   +  GPCE+
Sbjct  38209  KDKGFKDLRSFLEDKGPA---------CGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCEL  38361

Query  81     WLDDTKVAAGRNCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              W+DDT V    +C  +F        +D+S+C   C L +YWLG++  +    WQ Y   +
Sbjct  38362  WIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSYSTYI  38535

Query  139    ALS  141
              A S
Sbjct  38536  AES  38544

 Score = 38.5 bits (88),  Expect = 0.028, Method: Composition-based stats.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 8/59 (14%)
 Frame = +2

Query  83     DDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
              DD KVA G +          ++++SAC + C L +YWLG++  +     Q YKNC+ L+
Sbjct  23096  DDCKVAFGSSTPG------FKVNFSACKNKCMLRFYWLGLQ--DKGQRMQSYKNCIPLA  23248

>PHKE:scaffold_949 scf_22126_949.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_949.1_contig_1:1:5261:1 
REF
Length=5261

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 16/123 (13%)
 Frame = +2

Query  29    LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
             +R MLD D  LY        DCG T PK   +  P++ +   S G    GPCE+WLDD  
Sbjct  2669  IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  2830

Query  87    VAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
             V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNCV
Sbjct  2831  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  3010

Query  139   ALS  141
              LS
Sbjct  3011  PLS  3019

>PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_289, whole genome shotgun sequence
Length=778693

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -2

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWL  82
               + +  +R+++D   +Y        DCG T P       PSN     S G    GPCE+WL
Sbjct  550065  NNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWL  549904

Query  83      DDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVY  134
               DD  V    +C   +  G  E       +DYS+C  D C L +YWL ++ ++G   WQ Y
Sbjct  549903  DDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAY  549724

Query  135     KNCVALSKTA  144
               KNC+ L+  A
Sbjct  549723  KNCIPLNGPA  549694

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
               + + S R+++D   +Y        DCG T P  T   P    ++  +      G CE+W+
Sbjct  557062  NNFKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWI  556901

Query  83      DDTKVAAGRNCHTQFPHGQHE-------IDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVY  134
               +   V    +C + +     +       IDYS+C GD C L +YWL ++ +     WQ Y
Sbjct  556900  NKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAY  556721

Query  135     KNCVALSKTA  144
               KNC+++  ++
Sbjct  556720  KNCISIKGSS  556691

 Score = 41.2 bits (95),  Expect = 0.004, Method: Composition-based stats.
 Identities = 29/101 (29%), Positives = 44/101 (44%), Gaps = 15/101 (15%)
 Frame = -2

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
               + + + R++LD + +Y        DCG T P  T   P    ++  + G    G CEVW+
Sbjct  560601  NNFKNARSLLDSDPVYGA------DCGYTDPNGTPVDPPSDGTATFSRGIAHVGRCEVWI  560440

Query  83      DDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTL  115
               D+       +C   F +G  E       IDYS C  D C +
Sbjct  560439  DEKIALQKDDCQAAFGNGTIEYKSVLKPIDYSLCDKDKCLM  560317

>PHCA:scaffold_50 PHYCAscaffold_50
Length=475612

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 66/131 (50%), Gaps = 13/131 (10%)
 Frame = +3

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
               M    Y SL+  ++D+ +  V +E   +CG T+PK   QP+P      S     G+T   
Sbjct  150993  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  151169

Query  75      DGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCEVW DDT+V    NC   FP    +   D  AC  S  L  YW+ +     + SWQ
Sbjct  151170  EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH----SPSWQ  151337

Query  133     VYKNCVALSKT  143
               VY NC AL KT
Sbjct  151338  VYINCAALEKT  151370

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 13/126 (10%)
 Frame = -3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
              Y SL+ +  D++   V+  A   CG   PK E QP+P +    S   + G+T   +GPCE
Sbjct  97193  YKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCE  97017

Query  80     VWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
              VW DD +     NC T FP    +   D  AC  + TL +YW+ +     + +WQVY NC
Sbjct  97016  VWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH----SDTWQVYVNC  96849

Query  138    VALSKT  143
                L KT
Sbjct  96848  APLEKT  96831

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 66/129 (51%), Gaps = 15/129 (12%)
 Frame = +2

Query  26      YASLRAMLDDESLYKVTEEAL-FDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPC  78
               Y SL+ +++D  L KVT      +CG T+P    QP+P      +     G+T   +GPC
Sbjct  149699  YKSLKEVIND--LGKVTSSDFTMECGYTNPDETPQPLPETYVEWAHGSGEGFTPSHEGPC  149872

Query  79      EVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
               EVW DD +V    NC   +P    ++ Y   AC  +  L +YWL +     + +WQVY N
Sbjct  149873  EVWCDDVRVFQDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALH----SSTWQVYTN  150040

Query  137     CVALSKTAT  145
               C AL KT +
Sbjct  150041  CAALEKTTS  150067

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 59/123 (48%), Gaps = 12/123 (10%)
 Frame = -2

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--D  75
                +   Y SL+A++DD++   VT  A   CG   P    QP+P+    S   + G+T   +
Sbjct  100170  FKASSYKSLKALIDDKAKVTVTG-ATLTCGSADPNGPAQPLPATLEWSHSDSEGFTPSHE  99994

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCE W DDT V    NC   F     E+ Y  S C  +  L +YW+ +       +WQV
Sbjct  99993   GPCEAWCDDTMVFNDENCAANFKTAPAEMPYEKSKCSGASKLTFYWMAMH----GPTWQV  99826

Query  134     YKN  136
               Y N
Sbjct  99825   YVN  99817

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 65/131 (50%), Gaps = 13/131 (10%)
 Frame = -1

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
                +   Y+SL+ +++D++   VT+ A   CG   P    Q +P+     +   + G+T   
Sbjct  152719  FESSSYSSLKELINDKATITVTD-ATLTCGACDPDETAQALPATYVEWAHSDSEGFTASH  152543

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCEVW DD +V  G +C   +      +  D+ AC  S  L +YWL +     + +WQ
Sbjct  152542  EGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH----SSTWQ  152375

Query  133     VYKNCVALSKT  143
               VY NC  L  T
Sbjct  152374  VYVNCAPLEST  152342

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 12/122 (10%)
 Frame = +1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
               Y+S++  + D+    V   A  +CGLT P    Q +P+    +   T G+T   +GPCE 
Sbjct  147130  YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  147306

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W DDT+V    NC   F     ++ Y  + C  S  L +YWL +     + +WQ+Y NC 
Sbjct  147307  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH----SSTWQIYVNCA  147474

Query  139     AL  140
               AL
Sbjct  147475  AL  147480

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 13/126 (10%)
 Frame = -3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y SL+ ++   +   VT+ A   CG  +P    QP+P      S   T G+T   +GPCE
Sbjct  154094  YTSLKDLITSLATVTVTD-ATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPCE  153918

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQVY NC
Sbjct  153917  VWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYVNC  153750

Query  138     VALSKT  143
                 L  T
Sbjct  153749  APLEST  153732

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 13/126 (10%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y SL+ ++   +   VT+ A   CG   P    Q +P+     S   + G+T   +GPCE
Sbjct  142879  YTSLKDLITSLATVTVTD-ATLTCGSCDPGETAQALPATYVEWSHSSSEGFTSSHEGPCE  142703

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DDT+V    +C   +     E+ Y   AC  S TL +YWL +     + +WQVY NC
Sbjct  142702  VWCDDTRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQVYVNC  142535

Query  138     VALSKT  143
                 L  T
Sbjct  142534  APLEST  142517

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 9/121 (7%)
 Frame = +1

Query  26      YASLRAMLDDESLYKVTE---EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
               Y+SL+ + D   + +      +A  +CG + P    + +P+   ++  GY+  GPCEVW 
Sbjct  139342  YSSLKDLADKTMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFGYSHQGPCEVWC  139521

Query  83      DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               DD    +  NC   +P     + Y    C  +  +  YW+ +        WQ+Y NCV L
Sbjct  139522  DDKLAFSDTNCALHYPEVPANLPYDVDVCTGAKMMQSYWIALH----GLPWQLYLNCVRL  139689

Query  141     S  141
               S
Sbjct  139690  S  139692

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 55/131 (42%), Gaps = 14/131 (11%)
 Frame = -2

Query  21     MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNS---SFQTSGYTL  74
                E  Y SL+ ++D     +       A  +CG +      + +PS     +  T G+  
Sbjct  95304  FNESSYTSLKDLVDKTGELQTLSPFGTATLECGFSLANGTARDLPSEYVEWNQLTEGH--  95131

Query  75     DGPCEVWLDDTKVAAGRNCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              DGPCEVW DD       NC   +P    Q   D S C  +  L  YW+ +        WQ
Sbjct  95130  DGPCEVWCDDVLAFEDDNCAVNYPENPSQWPYDVSKCQGASRLTAYWIALH----GLPWQ  94963

Query  133    VYKNCVALSKT  143
              VY NCV L+ +
Sbjct  94962  VYINCVPLTGS  94930

 Score = 52.0 bits (123),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 44/94 (47%), Gaps = 6/94 (6%)
 Frame = +2

Query  50      GLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--S  107
               G ++   + Q +P+   +     +  GPCEVW DDT V    NC   +P    ++ Y  S
Sbjct  108659  GFSTVDGKAQALPAQVEWDFFTASHQGPCEVWCDDTLVFENYNCAVDYPDTPAKLPYDKS  108838

Query  108     ACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                C  +  L  YW+ +     +  WQVY NC  LS
Sbjct  108839  KCSGASMLTSYWIALH----STPWQVYTNCAPLS  108928

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 55/130 (42%), Gaps = 17/130 (13%)
 Frame = +3

Query  13      TSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
               TS++   W  E        +++ +SLY     A  +CG +      + +P    +     
Sbjct  114648  TSLKELVWKNE--------VVNTDSLYGT---ATIECGYSWTNGTARDLPDEVQWDKLTT  114794

Query  73      TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYS  130
                 DGPCE+W DDT V + +NC   +P       Y  +AC     L   WL +     +  
Sbjct  114795  GHDGPCEIWCDDTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTTIWLALH----SPP  114962

Query  131     WQVYKNCVAL  140
               WQV+ NC  L
Sbjct  114963  WQVFTNCAPL  114992

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (46%), Gaps = 22/140 (16%)
 Frame = -2

Query  12      NTSIEAQSWMQ---EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF-  67
               + +I  +S+++   +  Y +L+ M+ D+ +  V+      CG T P   +    +++ + 
Sbjct  141246  DPAINIKSFLEHFKKSKYKTLKDMIVDKQVL-VSGGPTASCGFTVPDQTSYGALNDTVYW  141070

Query  68      -------QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH------EIDYSACGDSCT  114
                      +  G+   GPCEVW DD +     NC   + +  +       ID S C D+  
Sbjct  141069  GRSDDITKDQGFVHPGPCEVWCDDNRAQQDNNCMETYNNAGNVGAAPVPIDKSVCTDAKR  140890

Query  115     LWWYWLGIKYVEGAYSWQVY  134
               L +YW+G+       +WQVY
Sbjct  140889  LTFYWIGMH----GPTWQVY  140842

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 6/99 (6%)
 Frame = +2

Query  45      ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI  104
               A  +CG +      + +P+   +     + +GPCEVW DDT V    NC   +     ++
Sbjct  136190  ATAECGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKL  136369

Query  105     DYSA--CGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                Y A  C  +  L   WL +     A+ WQVY NC  L+
Sbjct  136370  PYDASKCEGASMLTSIWLALH----AHPWQVYTNCAPLT  136474

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 31/67 (46%), Gaps = 6/67 (9%)
 Frame = +3

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCEVW DDT V    NC   +P     + Y  + C  +  L  YW+ +        WQV
Sbjct  113076  GPCEVWCDDTLVFEDWNCAVTYPETPANLPYDKAKCSGASMLTSYWIALHTT----PWQV  113243

Query  134     YKNCVAL  140
               Y NC  L
Sbjct  113244  YTNCAPL  113264

>PHRA:scaffold_29
Length=529199

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 67/129 (52%), Gaps = 13/129 (10%)
 Frame = +3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y+SL+  + D+ L  V +E   +CG T+P    QP+P      S     G+T   +GPCE
Sbjct  472533  YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  472709

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DDT+V    NC   FP    ++ Y   AC  S  L  YW+ +     + SWQVY NC
Sbjct  472710  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH----SASWQVYINC  472877

Query  138     VALSKTATA  146
                AL KT ++
Sbjct  472878  AALEKTTSS  472904

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 67/129 (52%), Gaps = 13/129 (10%)
 Frame = -3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y+SL+  ++D++   VT  A   CG   PK E QP+P +    S   + G+T   +GPCE
Sbjct  437592  YSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  437416

Query  80      VWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DD +     +C   +P    Q   D  AC  S TL +YW+ +     + +WQVY NC
Sbjct  437415  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH----SSTWQVYVNC  437248

Query  138     VALSKTATA  146
                 L+ T ++
Sbjct  437247  APLASTTSS  437221

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 13/128 (10%)
 Frame = -2

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
                +   Y+SL+  +DD++   VT+  L  CG   P    QP+P      +   + G+T   
Sbjct  474364  FESSSYSSLKEFIDDKATITVTDATL-TCGACDPDETAQPLPETYVEWAHSDSEGFTASH  474188

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCEVW DD +V    +C   F     ++  D+ AC  S  L +YWL +     + +WQ
Sbjct  474187  EGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH----SSTWQ  474020

Query  133     VYKNCVAL  140
               VY NC  L
Sbjct  474019  VYVNCAPL  473996

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 72/144 (50%), Gaps = 22/144 (15%)
 Frame = +2

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTE-EALFDCGLTSPKTETQPIP--------  62
               NT+  A+ + +   Y SL+ M+ D  L KVT  +   +CG T+P    QP+P        
Sbjct  471200  NTAAFAKGF-EASKYTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAH  471370

Query  63      -SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYW  119
                S   F +S    +GPCEVW DD +V    +C   +     ++  D+ AC  +  L +YW
Sbjct  471371  GSGEGFTSSH---EGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYW  471541

Query  120     LGIKYVEGAYSWQVYKNCVALSKT  143
               L +     + +WQVY NC AL KT
Sbjct  471542  LALH----SSTWQVYTNCAALEKT  471601

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 12/123 (10%)
 Frame = -2

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
               Y SL+A++DD++   VT  A   CG   P    Q +P     S  ++ G+T   +GPCEV
Sbjct  442258  YKSLKALIDDKAKVTVTG-ATLTCGTADPAAAAQALPKTVEWSHSESEGFTASHEGPCEV  442082

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W DD +     NC   F     E+ Y  S C  +  L +YW+ +       SWQVY NC 
Sbjct  442081  WCDDVRAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWMAMH----GPSWQVYVNCA  441914

Query  139     ALS  141
                LS
Sbjct  441913  NLS  441905

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 12/122 (10%)
 Frame = +2

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
               Y+S++  + D     V + A  +CGLT P    QPIP     +   T G+T   +GPCE 
Sbjct  466739  YSSIKEFVTDLGQI-VADGANIECGLTDPNETPQPIPDELEWTHSDTEGFTSSHEGPCEA  466915

Query  81      WLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W D T+V    +C   F     ++  D + C  +  L +YWL +     + +WQVY NC 
Sbjct  466916  WCDGTQVFHDTDCAAHFTTAPAKMPYDQAGCSGASRLTFYWLALH----SSTWQVYVNCA  467083

Query  139     AL  140
               AL
Sbjct  467084  AL  467089

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 13/126 (10%)
 Frame = -3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y SL+ ++   +   VT+  L  CG   P    Q +P+     S   T G+T   +GPCE
Sbjct  475821  YTSLKDLITGLATVTVTDATL-TCGSCDPDETAQALPAEYVEWSHSSTEGFTSSHEGPCE  475645

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQVY NC
Sbjct  475644  VWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYVNC  475477

Query  138     VALSKT  143
                 L  T
Sbjct  475476  APLETT  475459

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 59/123 (48%), Gaps = 13/123 (11%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y SL+ ++   +   VT+ A   CG   P    Q +P+     S   T G+T   +GPCE
Sbjct  462434  YTSLKDLITGLATVTVTD-ATLTCGSCDPDETAQALPAEYVEWSHSSTEGFTSSHEGPCE  462258

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQVY NC
Sbjct  462257  VWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYVNC  462090

Query  138     VAL  140
                 L
Sbjct  462089  APL  462081

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 53/121 (44%), Gaps = 9/121 (7%)
 Frame = +3

Query  26      YASLRAMLDDESLYKVTE---EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
               Y SL+ + D   + +      +A  +CG + P    + +P+   +   G +  GPCEVW 
Sbjct  458172  YTSLKNLADKTMVLQSLNPFGKATAECGFSLPNGTARNLPAEVQWHDFGLSHQGPCEVWC  458351

Query  83      DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               DD      +NC   +P     + Y    C  +  +  YW+ +        WQ+Y NCV L
Sbjct  458352  DDKLAFMDQNCALNYPEVPASLPYDVDVCAGASMMQSYWIALH----GLPWQLYLNCVPL  458519

Query  141     S  141
               +
Sbjct  458520  T  458522

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 53/119 (45%), Gaps = 10/119 (8%)
 Frame = +2

Query  26      YASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDD  84
               Y SL+ +  D ++L    + A  +CG +      Q +P+   +     +  GPCEVW DD
Sbjct  451517  YKSLKELAWDSQTL---ADGASNECGFSVVDGTAQDLPAEVQWDFFTASHQGPCEVWCDD  451687

Query  85      TKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
               T V    NC   +P     + Y  + C  S  L  YW+ +        WQVY NC  L+
Sbjct  451688  TLVFENWNCAVDYPETPANLPYDKAKCASSSVLTSYWIALHTTP----WQVYTNCAPLT  451852

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 55/131 (42%), Gaps = 17/131 (13%)
 Frame = +3

Query  13      TSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
               TS++   W  E        +++ +S+Y     A  +CG +      + +P    +     
Sbjct  453321  TSLKELVWKNE--------VVNTDSIYGT---ATIECGFSWTNGTARDLPDEVQWDKLTT  453467

Query  73      TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYS  130
                 DGPCE+W DDT   + +NC   +P       Y  +AC     L   WL +     +  
Sbjct  453468  GHDGPCEIWCDDTLAFSDQNCAVNYPDTPASFPYDKAACEGKSMLTAIWLAVH----SPP  453635

Query  131     WQVYKNCVALS  141
               WQV+ NC  LS
Sbjct  453636  WQVFTNCAPLS  453668

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 60/128 (47%), Gaps = 19/128 (15%)
 Frame = -3

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF--QTSGYTLD---  75
               +++  Y S++AM++D  +  V ++A   CG + P   +    +++ +  +    TLD   
Sbjct  460689  LKKSSYKSVKAMIEDNQVL-VADDATASCGFSDPAQTSYGALNDTIYWGRNDDLTLDEGF  460513

Query  76      ---GPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSACGDSCTLWWYWLGIKYVE  126
                  GPCE W D  +     NC   +     +      ID S C ++  L +YW+ +    
Sbjct  460512  VHMGPCETWCDGNQAQQDMNCQVTYTPASGKGAAPVPIDSSVCKNAKRLTFYWVAM---H  460342

Query  127     GAYSWQVY  134
               GA +WQVY
Sbjct  460341  GA-TWQVY  460321

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 6/99 (6%)
 Frame = +3

Query  45      ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI  104
               A  +CG +      + +P+   +     + +GPCEVW DDT V    NC   +     ++
Sbjct  455265  ATAECGFSLANGTARDLPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKL  455444

Query  105     --DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                 D S C  +  L   WL +     A  WQVY NC  L+
Sbjct  455445  PYDVSKCKGASMLTSIWLALH----ALPWQVYTNCAPLT  455549

>PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.4, whole genome shotgun 
sequence
Length=2787191

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 13/126 (10%)
 Frame = -3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y+SL+  + D+ +  V+++   +CG T+P    QP+P      S     G+T   +GPCE
Sbjct  493665  YSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCE  493489

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DDT+V    NC   FP    ++  D+ AC  S  L  YW+ +     + SWQVY NC
Sbjct  493488  VWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH----SPSWQVYINC  493321

Query  138     VALSKT  143
                AL KT
Sbjct  493320  AALEKT  493303

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 12/122 (10%)
 Frame = +3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---QTSGYTL--DGPCEV  80
               Y SL+A +DD++   VT  A   CG   P    QP+P    +   ++ G+T   +GPCE 
Sbjct  552645  YKSLKAFIDDKAKITVTG-ATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEA  552821

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W D  +V    NC   F     E+ Y  S C  + TL +YW+ +       +WQVY NC 
Sbjct  552822  WCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMH----GPTWQVYVNCA  552989

Query  139     AL  140
                L
Sbjct  552990  PL  552995

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 12/127 (9%)
 Frame = +1

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---QTSGYTL--D  75
                +   Y SL+A++DD++   +   A   CG+  PK   QP+P+   +   ++ G+T   +
Sbjct  539203  FESSKYKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHE  539379

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCEVW D  +V    NC   +     E+ Y  S C  +  L  YW+ +       SWQV
Sbjct  539380  GPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMH----GPSWQV  539547

Query  134     YKNCVAL  140
               Y NC  L
Sbjct  539548  YVNCAPL  539568

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 13/128 (10%)
 Frame = +2

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y SL+  + D++   V+  A   CG   PK E QP+P +    S   + G+T   +GPCE
Sbjct  566606  YKSLKEYVTDKAKIIVSG-ATLTCGSCDPKQEPQPMPKSTVEWSHSDSEGFTPSHEGPCE  566782

Query  80      VWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DD +     +C  H      +   D  AC  + TL +YW+ +     + SWQVY NC
Sbjct  566783  VWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAMH----SSSWQVYVNC  566950

Query  138     VALSKTAT  145
                 L+KT +
Sbjct  566951  APLAKTTS  566974

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 13/131 (10%)
 Frame = +2

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
                +   ++SL+ ++++++   V++ A   CG   P    QP+P      +   + G+T   
Sbjct  491933  FESSSFSSLKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASH  492109

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCE+W DD +V  G +C   +     ++  D+ AC  S  L +YWL +     + +WQ
Sbjct  492110  EGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLALH----SSTWQ  492277

Query  133     VYKNCVALSKT  143
               VY NC  L  T
Sbjct  492278  VYVNCAPLEST  492310

 Score = 63.5 bits (153),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 61/126 (48%), Gaps = 13/126 (10%)
 Frame = +3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTLDGPCE  79
               Y SL+ +++  +   VT+ A   CG   P    QP+P      S+SS +    + +GPCE
Sbjct  502650  YTSLKELINALATITVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  502826

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DD +     +C   +     E+ Y   AC  + TL +YWL +     + +WQVY NC
Sbjct  502827  VWCDDVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYINC  502994

Query  138     VALSKT  143
                 L  T
Sbjct  502995  APLEST  503012

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 51/103 (50%), Gaps = 11/103 (11%)
 Frame = -3

Query  45      ALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEVWLDDTKVAAGRNCHTQFPH  99
               A   CGLT+P    QP+P     +   T G+T   +GPCE W D T+V    NC   F  
Sbjct  498150  ANLQCGLTNPDETAQPLPDEIEWTHSDTEGFTSSHEGPCEAWCDGTQVFQDTNCAAHFTT  497971

Query  100     GQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                  ++  D + C  +  L +YWL +     + +WQVY NC AL
Sbjct  497970  APAKMPYDKAGCSGANRLTFYWLALH----SSTWQVYVNCAAL  497854

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 19/128 (15%)
 Frame = +3

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF--------QTSGY  72
                ++  Y S+R M++D+ +  V+++A   CG +SP+  +    +++ +        Q  G 
Sbjct  504234  FEKSKYKSIRTMIEDKQVL-VSDDATATCGFSSPEKTSYGALNDTVYWGRNDDITQDEGL  504410

Query  73      TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSACGDSCTLWWYWLGIKYVE  126
                  GPCEVW DD +     NC   +     +      ID S C D+  L ++W+G+    
Sbjct  504411  VHPGPCEVWCDDNRAQQDMNCMKTYTPASGKGAAPIPIDKSVCTDAKRLTFFWIGM---H  504581

Query  127     GAYSWQVY  134
               GA +WQVY
Sbjct  504582  GA-TWQVY  504602

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 54/121 (45%), Gaps = 9/121 (7%)
 Frame = -3

Query  26      YASLRAMLDDESLYKVTE---EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
               Y SL+ + D   + +      +A  +CG + P    + +P+   ++  GY+  GPCEVW 
Sbjct  506538  YTSLKDLADKTMVLQSLNPFGKATKECGFSIPNGSKRNLPAQVQWKDFGYSHQGPCEVWC  506359

Query  83      DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               DD       NC   +P     + Y    C  +  +  YW+ +        WQ+Y NCV L
Sbjct  506358  DDKLAFMDTNCALHYPEVPAFLPYDIDVCIGAKMIQSYWIALH----GLPWQLYLNCVPL  506191

Query  141     S  141
               +
Sbjct  506190  T  506188

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 55/131 (42%), Gaps = 14/131 (11%)
 Frame = +3

Query  21      MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNS---SFQTSGYTL  74
                 E  Y SL+ ++D     +       A  +CG +      + +PS     +  T G+  
Sbjct  568668  FNESSYTSLKDLVDKTGEVQTLSPFGTATLECGFSLANGTARDLPSEYVEWNQLTEGH--  568841

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               DGPCEVW DD       NC   +P    +   D S C  +  L  YW+ +        WQ
Sbjct  568842  DGPCEVWCDDVLAFEDDNCAVNYPESPSKWPYDVSKCSGASRLTAYWIALH----GLPWQ  569009

Query  133     VYKNCVALSKT  143
               VY NCV L+ +
Sbjct  569010  VYINCVPLTGS  569042

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 15/123 (12%)
 Frame = -1

Query  26      YASLRAML------DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
               Y SL+ ++      + +SLY     A  +CG +      + +P    +       DGPCE
Sbjct  511028  YTSLKELVWENEVVNTDSLYGT---ATIECGYSWTNGTARDLPDEVQWDKLTTGHDGPCE  510858

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               +W DDT V + +NC   +P       Y  +AC     L   WL +     +  WQV+ NC
Sbjct  510857  IWCDDTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTAIWLALH----SPPWQVFTNC  510690

Query  138     VAL  140
                 L
Sbjct  510689  APL  510681

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 6/68 (9%)
 Frame = -2

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCEVW DDT V    NC   +P     + Y  + C  S  L  YW+ +        WQV
Sbjct  512584  GPCEVWCDDTLVFENWNCAVDYPETPANLPYDKAKCKGSSVLTSYWIALHTTP----WQV  512417

Query  134     YKNCVALS  141
               Y NC  L+
Sbjct  512416  YTNCAPLT  512393

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 6/99 (6%)
 Frame = -3

Query  45      ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI  104
               A  +CG +      + +P+   +     + +GPCEV  DDT+V    NC   +     ++
Sbjct  509391  ATAECGFSLANGTARALPAEVEWNQLTSSHEGPCEV*CDDTRVFEDWNCALDYTSDPAKL  509212

Query  105     DY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                Y  S C  +  L   WL +     A  WQVY NC  L+
Sbjct  509211  PYDVSKCEGASMLTSIWLALH----ALPWQVYTNCAPLT  509107

>PHRA:scaffold_89
Length=200592

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 17/111 (15%)
 Frame = -2

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T    + QPIP++   +       G+T  GPCE+++DDT V  G +C  ++P G   
Sbjct  124508  CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  124329

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +  +DYS+C   CTL  YWL  +  +    WQ Y NCV+L  + +A
Sbjct  124328  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSA  124188

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 17/99 (17%)
 Frame = -1

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      QPIPS+   +       G+T  GPCE++LDDT V    NC   +P G   
Sbjct  129429  CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  129250

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +DYS+C   CTL  YWL  +  +    WQ Y
Sbjct  129249  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAY  129145

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 50/105 (48%), Gaps = 17/105 (16%)
 Frame = -1

Query  47      FDCGLTSPKTETQPIPSNS-----SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ  101
               + CG T    + + I ++           G+T  GPCE++LDDT +  G NC  ++  G 
Sbjct  123195  YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  123016

Query  102     HE--------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
                +        IDYS+C  +CTL  YWLG +  +    WQ Y   V
Sbjct  123015  DDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ----WQAYSEWV  122893

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 17/99 (17%)
 Frame = +2

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      Q +P++   +       G+T  GPCE+++DD  V  G NC   +P G   
Sbjct  112364  CGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDVG  112543

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +DYS+C   CT   YWL  +  +    WQ Y
Sbjct  112544  STVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAY  112648

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 20/35 (57%), Gaps = 4/35 (11%)
 Frame = -2

Query  104     IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               IDYS+C  +CTL  YWLG +  +    WQ Y   V
Sbjct  194978  IDYSSCNGACTLAIYWLGFQNEQ----WQAYSEWV  194886

>PHKE:scaffold_155 scf_22126_155.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_155.1:1:75875:1 
REF
Length=75875

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 66/132 (50%), Gaps = 15/132 (11%)
 Frame = +2

Query  21     MQEHGYASLRAMLDDESLYKVT-EEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL-  74
              M    Y SL+  +  ++  KVT  E   +CG T+PK   QP+P      S     G+T  
Sbjct  41090  MAASKYTSLKEFMAAKA--KVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSS  41263

Query  75     -DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYS--ACGDSCTLWWYWLGIKYVEGAYSW  131
               +GPCEVW DDT+V    NC   FP    ++ Y   AC  S  L  YW+ +     + SW
Sbjct  41264  HEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH----SPSW  41431

Query  132    QVYKNCVALSKT  143
              QVY NC AL KT
Sbjct  41432  QVYINCAALEKT  41467

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 13/126 (10%)
 Frame = -3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTLDGPCE  79
              Y SL+ +++D +   VT+ A   CG   P    QP+P      S+SS +    + +GPCE
Sbjct  44280  YTSLKELINDLATITVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  44104

Query  80     VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
              VW DD +V   ++C   +     E+  D+ AC  + TL +YWL +     + +WQVY NC
Sbjct  44103  VWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQVYVNC  43936

Query  138    VALSKT  143
                L  T
Sbjct  43935  APLETT  43918

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 15/132 (11%)
 Frame = -3

Query  21     MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
               +   Y+SL+  ++D++   VT+ A   CG   P    Q +P      +   + G+T   
Sbjct  42903  FESSSYSSLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASH  42727

Query  75     DGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
              +GPCEVW DDT+V    +C   +T  P  Q   D+ AC  S T+  YWL +     + +W
Sbjct  42726  EGPCEVWCDDTRVFQDDDCAADYTTAP-AQLPFDHDACLGSSTVTLYWLALH----SSTW  42562

Query  132    QVYKNCVALSKT  143
              QVY NC  L  T
Sbjct  42561  QVYVNCAPLETT  42526

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 14/123 (11%)
 Frame = +2

Query  26     YASLRAMLDDESLYK-VTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCE  79
              Y+SL+  +   SL + V   A  +CGLT P    QP+P +   +   T G+T   +GPCE
Sbjct  31124  YSSLKDFV--TSLGQIVATGANIECGLTDPNETPQPLPDHLEWTHSDTEGFTSSHEGPCE  31297

Query  80     VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               W DDT+V    NC   F     ++ Y  + C  +  L +YW+ +     + +WQVY NC
Sbjct  31298  AWCDDTRVFKDENCAAHFTTAPAKMPYDDAGCDGASRLTFYWVALH----SPTWQVYANC  31465

Query  138    VAL  140
               AL
Sbjct  31466  AAL  31474

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 15/132 (11%)
 Frame = +1

Query  21     MQEHGYASLRAMLDDESLYKVTEEA-LFDCGLTSPKTETQPIPSN----SSFQTSGYTL-  74
               +   Y+SL+ ++ D  L K+T  +   +CG T+P    QP+P      +   + G+T  
Sbjct  39685  FESSKYSSLKELVTD--LGKLTSTSYTTECGYTNPDETAQPLPDTYVEWAHSDSEGFTPS  39858

Query  75     -DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSW  131
               +GPCEVW DD +V    +C   +     ++  D+ AC  S  L  YWL +     + +W
Sbjct  39859  HEGPCEVWCDDVRVFQDDDCAAHYTTAPAKLPYDHDACLGSSRLTLYWLALH----SSTW  40026

Query  132    QVYKNCVALSKT  143
              QVY NC AL  T
Sbjct  40027  QVYTNCAALEST  40062

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 13/131 (10%)
 Frame = -3

Query  21     MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
               +   Y SL+ ++   +   VT+ A   CG   P    QP+P+     S   + G+T   
Sbjct  23832  FESSSYTSLKELISALATVTVTD-ATLTCGSCDPDETAQPLPATYVEWSHSDSEGFTSSH  23656

Query  75     DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              +GPCEVW DD +V    +C   +     E+  D  AC  + TL ++WL +     + +WQ
Sbjct  23655  EGPCEVWCDDVRVFQDDDCAVDYTSAPAELPYDRDACLGASTLTFFWLALH----SSTWQ  23488

Query  133    VYKNCVALSKT  143
              VY NC  L  T
Sbjct  23487  VYVNCAPLEAT  23455

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 55/130 (42%), Gaps = 17/130 (13%)
 Frame = +2

Query  13     TSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
              TS++   W  E        +++ +SLY     A  +CG +      + +P    +     
Sbjct  14759  TSLKDLVWKNE--------VVNTDSLYGT---ATIECGYSWTNGTARDLPDEVQWDKLTT  14905

Query  73     TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYS  130
                DGPCE+W DDT V A +NC   +P       Y  +AC     L   WL +     +  
Sbjct  14906  GHDGPCEIWCDDTLVFADQNCAVNYPDSPASFPYNKAACKGKSMLTAIWLAVH----SPP  15073

Query  131    WQVYKNCVAL  140
              WQV+ NC  L
Sbjct  15074  WQVFTNCAPL  15103

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 53/126 (42%), Gaps = 9/126 (7%)
 Frame = +1

Query  21     MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGP  77
                E  Y SL+ ++   +  +  E    A  +CG +      + +P    +     + +GP
Sbjct  18103  FNESSYTSLKDLITKTAEVQTMETFGTATLECGFSLANGTARGLPEEVEWSQLTSSHEGP  18282

Query  78     CEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
              CEVW DDT V    NC   +     ++ Y  S C  +  L  YWL +        WQVY 
Sbjct  18283  CEVWCDDTLVFEDWNCALDYTSDPAKLPYDSSKCSGTSMLTSYWLALH----GLPWQVYI  18450

Query  136    NCVALS  141
              NC  L+
Sbjct  18451  NCAPLT  18468

 Score = 52.0 bits (123),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (42%), Gaps = 9/120 (8%)
 Frame = +3

Query  26     YASLRAMLDDESLYKVTE---EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
              Y SL+ + D   + +      +A  +CG +      + +P    +   G +  GPCEVW 
Sbjct  19815  YTSLKDLADKTMVLQTLSPFGKATAECGFSIKNGTARALPKEVQWHDFGLSHQGPCEVWC  19994

Query  83     DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              D       +NC   +P     + Y  S C  +  +  YW+ +        WQ+Y NC+ L
Sbjct  19995  DGKLAFEDKNCALNYPEVPASLPYDKSVCEGASMMQSYWIAVH----GLPWQLYLNCIPL  20162

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 30/67 (45%), Gaps = 6/67 (9%)
 Frame = +2

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
              GPCEVW DDT      NC   +P     + Y  + C  S  L  YW+ +        WQ+
Sbjct  12923  GPCEVWCDDTLTFEDENCALNYPDTPANLPYDKAKCAGSAVLTSYWIALHTTP----WQI  13090

Query  134    YKNCVAL  140
              Y NC  L
Sbjct  13091  YTNCAPL  13111

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 19/128 (15%)
 Frame = -1

Query  21     MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSP-KTETQPIPSNSSFQTS-------GY  72
              +++  Y SL+AM++   +  V+++A   CG T P +T    +     F  S       G+
Sbjct  22127  LKKSPYKSLKAMINANQVL-VSKDATPTCGFTDPDQTHYGALNDTIIFGRSPDVSIAEGF  21951

Query  73     TLDGPCEVWLDDTKVAAGRNCHTQF-PH-----GQHEIDYSACGDSCTLWWYWLGIKYVE  126
                 GPCE W DD +V    +C   + P          I  +AC ++  L +YW+G+    
Sbjct  21950  VHPGPCETWCDDNQVQQNMHCDEAYNPKSGGGGAPMPIKKAACANAKRLTFYWIGMH---  21780

Query  127    GAYSWQVY  134
                 +WQVY
Sbjct  21779  -GPTWQVY  21759

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 6/99 (6%)
 Frame = +3

Query  45     ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI  104
              A  +CG +      + +P+   +     + +GPCEVW DDT V    NC   +     ++
Sbjct  16545  ATAECGFSLTNGTARDLPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKL  16724

Query  105    --DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                D S C  +  L   WL +     A  WQVY NC  L+
Sbjct  16725  PYDVSKCEGASMLTSVWLALH----ALPWQVYTNCAPLT  16829

>PHRA:scaffold_1234
Length=7828

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 17/111 (15%)
 Frame = -2

Query  49    CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
             CG T    + QPIP++   +       G+T  GPCE+++DDT V  G +C  ++P G   
Sbjct  4842  CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  4663

Query  101   -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                  +  +DYS+C   CTL  YWL  +  +    WQ Y NCV L  + +A
Sbjct  4662  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSA  4522

 Score = 60.5 bits (145),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 50/105 (48%), Gaps = 17/105 (16%)
 Frame = -3

Query  47    FDCGLTSPKTETQPIPSNS-----SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ  101
             + CG T    + + I ++           G+T  GPCE++LDDT +  G NC  ++  G 
Sbjct  2744  YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  2565

Query  102   HE--------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              +        IDYS+C  +CTL  YWLG +  +    WQ Y   V
Sbjct  2564  DDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ----WQAYSEWV  2442

>PHRA:scaffold_418
Length=13567

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 17/111 (15%)
 Frame = +1

Query  49     CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
              CG T    + QPIP++   +       G+T  GPCE+++DDT V  G +C  ++P G   
Sbjct  12499  CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  12678

Query  101    -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                   +  +DYS+C   CTL  YWL  +  +    WQ Y NCV L  + +A
Sbjct  12679  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSA  12819

>PYIW:scaffold_7003 piw_scaffold_7003 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_7003:1:774:1 
REF
Length=774

 Score = 74.3 bits (181),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 14/116 (12%)
 Frame = +3

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEV  80
            +E G+ +LR+ ++D+            CG T P  + + IPS++  + S   +  GPCE+
Sbjct  183  KEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCEL  335

Query  81   WLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
            W+DDT+V    NC   F       +ID+SAC   C L W+WLG++  +    WQVY
Sbjct  336  WIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  497

>PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 
genomic scaffold, whole genome shotgun sequence
Length=4595942

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 15/126 (12%)
 Frame = -1

Query  24       HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
                + +  L+ ++DD S+Y        DCG T P  + QPIP +     S   +  GPCE+WL
Sbjct  2065280  NKFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWL  2065119

Query  83       DDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
                DDTKV    +C +++ +   +I      DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  2065118  DDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  2064939

Query  135      KNCVAL  140
                   V L
Sbjct  2064938  SKLVVL  2064921

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 14/100 (14%)
 Frame = -1

Query  18       QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
                +S    + +  L+ ++DD S+Y        DCG T P  + QPIP +     S   +  G
Sbjct  2062526  KSLKTANNFKDLKTLMDDTSVYGT------DCGFTDPNGKAQPIPKDGKATFSRALVHVG  2062365

Query  77       PCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLW  116
                PCE+WLDDTKV    +C +++         +   + C+LW
Sbjct  2062364  PCEIWLDDTKVLYEDDCFSKY-------GKTRTSNRCSLW  2062266

>PHCA:scaffold_22 PHYCAscaffold_22
Length=843021

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 69/134 (51%), Gaps = 15/134 (11%)
 Frame = +3

Query  18      QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
               +S    + +  L+ ++DD S+Y        DCG T+P    QPIP++     S   +  G
Sbjct  399276  KSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVG  399437

Query  77      PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
               PCE+WLDDTKV    +C++++ +   +I      DYS+C  G    + +YWL  + V+G 
Sbjct  399438  PCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGK  399617

Query  129     YSWQVYKNCVALSK  142
                 WQ Y   + L +
Sbjct  399618  TVWQSYSKFLVLFR  399659

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 15/120 (13%)
 Frame = +1

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
               + +  L+ ++DD S+Y        DCG T P  + QPIPS+     S   +  GPCE+WL
Sbjct  396625  NNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWL  396786

Query  83      DDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
               DDTKV    +C++++ +   +I      DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  396787  DDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  396966

>PHKE:scaffold_250 scf_22126_250.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_250.1:1:52150:1 
REF
Length=52150

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 62/122 (51%), Gaps = 12/122 (10%)
 Frame = -2

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
              Y SL+A++DD++   V+  A   CG   P    QP+PS    S   + G+T   +GPCE 
Sbjct  45282  YKSLKALIDDKAKITVSG-ATLTCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHEGPCEA  45106

Query  81     WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              W DD +V    NC   FP    E+ Y  S+   +  L +YW+ +       SWQVY NC 
Sbjct  45105  WCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH----GPSWQVYVNCA  44938

Query  139    AL  140
              AL
Sbjct  44937  AL  44932

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 59/123 (48%), Gaps = 12/123 (10%)
 Frame = +2

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
              Y +L+A++DD++   V   A   CG   P    QP+P+    +   + G++   +GPCE 
Sbjct  17300  YKTLKALIDDKTKISV-PGATLTCGSADPNAAPQPLPAKLEWAHSDSEGFSPSHEGPCEA  17476

Query  81     WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              W D T+V    NC   F      + Y  S C  +  L ++W+ +       SWQVY NC 
Sbjct  17477  WCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAMH----GPSWQVYVNCA  17644

Query  139    ALS  141
               LS
Sbjct  17645  TLS  17653

 Score = 63.2 bits (152),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 59/122 (48%), Gaps = 12/122 (10%)
 Frame = +3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
              Y SL+  ++D++   VT  A  +CG   P    QP+P     S   + G+T   +GPCEV
Sbjct  12819  YKSLKEYVEDKAKITVTG-ATLECGSCDPDQTPQPVPKTVEWSHSDSEGFTASHEGPCEV  12995

Query  81     WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              W D T+     NC   F     E+ Y  S C  +  L +YW+ +     + +WQVY NC 
Sbjct  12996  WCDGTRAFQDDNCPAHFTMIPAELPYEQSKCTGASRLTFYWMAMH----SDTWQVYVNCA  13163

Query  139    AL  140
               L
Sbjct  13164  PL  13169

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 55/131 (42%), Gaps = 14/131 (11%)
 Frame = +1

Query  21     MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNS---SFQTSGYTL  74
                E  Y SL+ ++D     +       A  +CG +      + +PS     +  T G+  
Sbjct  20104  FNESSYTSLKDLVDQTGEVQTLSPFGTATLECGFSLANGTARDLPSQYVEWNQLTEGH--  20277

Query  75     DGPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              DGPCEVW DD       NC   +P    Q   D S C  +  L  YW+ +        WQ
Sbjct  20278  DGPCEVWCDDVLAFQDDNCAVNYPESPSQWPYDVSKCSSASQLTAYWIALH----GLPWQ  20445

Query  133    VYKNCVALSKT  143
              VY NCV L+ +
Sbjct  20446  VYINCVPLTGS  20478

>PYVX:scaffold_563 pve_scaffold_563 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_563:1:19577:1 
REF
Length=19577

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 65/133 (49%), Gaps = 18/133 (14%)
 Frame = +2

Query  20    WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDGP  77
             W  E+G +SL+        Y      + +CG T      QP+PS+  +   T G +  GP
Sbjct  9590  WFTENGISSLKE-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGP  9748

Query  78    CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
             CE+W DDT+V    NC T F  GQ      ID + C  S    +YWL +     A  WQV
Sbjct  9749  CEIWCDDTRVFNSTNCVTDF-SGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQV  9913

Query  134   YKNCVALSKTATA  146
             Y NCVAL  T+++
Sbjct  9914  YINCVALDGTSSS  9952

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 62/127 (49%), Gaps = 18/127 (14%)
 Frame = +1

Query  20    WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGP  77
             W   +G +SL+        Y  T  +  +CG T      QP+PS+   Q  T G +  GP
Sbjct  7756  WFTANGISSLKE-------YITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGP  7914

Query  78    CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
             CE+W DDT+V    NC T+F  GQ      ID + C  S    +YWL +     A  WQV
Sbjct  7915  CEIWCDDTRVFTSTNCVTEF-SGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQV  8079

Query  134   YKNCVAL  140
             Y NCVAL
Sbjct  8080  YINCVAL  8100

>PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.12, whole genome shotgun 
sequence
Length=1504206

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 17/111 (15%)
 Frame = -3

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T    + +PIP++   +       G+T  GPCE+++DD  V  G NC   FP G   
Sbjct  393055  CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  392876

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +  +D+S+C   CTL  YWLG +  +    WQ Y NCV L  + +A
Sbjct  392875  SEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSA  392735

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 17/111 (15%)
 Frame = +2

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T    + +PIP++   +       G+T  GPCE+++DD  V  G NC   FP G   
Sbjct  384671  CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  384850

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +  +D+S+C   CTL  YWLG +  +    WQ Y NCV L  + +A
Sbjct  384851  SEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSA  384991

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 17/100 (17%)
 Frame = -1

Query  48      DCGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG--  100
               +CG T      QPIPS+   +       G+T  GPCE++LDD  V  G NC  ++P G  
Sbjct  457821  ECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDV  457642

Query  101     ------QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                        +DYS+C + CTL  YWL  +      +WQ Y
Sbjct  457641  GSTVTSDMPVDYSSCTEDCTLTIYWLAFQNA----NWQAY  457534

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 17/109 (16%)
 Frame = -2

Query  49      CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQF---PHG  100
               CG T    + QPIP++        +  G+T  GPCE++LDD  V  G +C  +F   P+G
Sbjct  454769  CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  454590

Query  101     QHE-----IDYSACGDSCTLWWYWLGIKYVE----GAYSWQVYKNCVAL  140
                 +     +D+S+C   C L  YWL  +  +    G Y+ +V  + V L
Sbjct  454589  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQWQTYGTYTCKVIGHAVQL  454443

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 17/109 (16%)
 Frame = -2

Query  49      CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQF---PHG  100
               CG T    + QPIP++        +  G+T  GPCE++LDD  V  G +C  +F   P+G
Sbjct  446564  CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  446385

Query  101     QHE-----IDYSACGDSCTLWWYWLGIKYVE----GAYSWQVYKNCVAL  140
                 +     +D+S+C   C L  YWL  +  +    G Y+ +V  + V L
Sbjct  446384  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQWQTYGTYTCKVIGHAVQL  446238

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 12/74 (16%)
 Frame = +1

Query  74      LDGPCEVWLDDTKVAAGRNCHTQFPHGQHE--------IDYSACGDSCTLWWYWLGIKYV  125
               L GPCE+++DD  V    +C + +P G ++        +DYS+C  +C    YWLG +  
Sbjct  432805  L*GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNGNCIFSIYWLGFRNA  432984

Query  126     EGAYSWQVYKNCVA  139
               +    WQ Y  C  
Sbjct  432985  Q----WQAYSTCAV  433014

>PHSO:scaffold_10
Length=2388181

 Score = 75.1 bits (183),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 13/126 (10%)
 Frame = -3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
               Y+SL+  ++D+ +  V+ +   +CG T P    QP+P      S     G+T   +GPCE
Sbjct  455351  YSSLKEFMNDK-MELVSADFTKECGYTKPDEAAQPLPETYVEWSHGSGEGFTSSHEGPCE  455175

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW D+T+V    NC   FP    ++ Y   AC  S  L  YW+ +     + SWQVY NC
Sbjct  455174  VWCDETRVFQDDNCPKNFPAAPAKLPYDRDACMGSSRLTIYWIALH----SPSWQVYINC  455007

Query  138     VALSKT  143
                AL KT
Sbjct  455006  AALEKT  454989

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 61/123 (50%), Gaps = 12/123 (10%)
 Frame = +3

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
               Y SL+  +DD++   VT  A   CG+  P    QP+P+    S   + G+T   +GPCE 
Sbjct  493029  YKSLKEFIDDKAKITVTG-ATLTCGIAEPDAAAQPVPAKLEWSHSDSEGFTSSHEGPCEA  493205

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W DDT+V    NC   F     E+ Y  S C  +  L +YW+ +       +WQVY NC 
Sbjct  493206  WCDDTRVFNDENCAANFKTAPAEMPYESSKCSGAKMLTFYWMAMH----GPTWQVYVNCA  493373

Query  139     ALS  141
                LS
Sbjct  493374  PLS  493382

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 66/131 (50%), Gaps = 13/131 (10%)
 Frame = +3

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
                +   Y+SL+ +++D++   VT+ A   CG+  P    QP+P      +   + G+T   
Sbjct  453552  FESSSYSSLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASH  453728

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCEVW DD +V    +C   +     E+ Y   AC  S TL +YWL +     + +WQ
Sbjct  453729  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQ  453896

Query  133     VYKNCVALSKT  143
               VY NC  L  T
Sbjct  453897  VYVNCAPLEAT  453929

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 64/131 (49%), Gaps = 13/131 (10%)
 Frame = +3

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTL  74
                +   Y SL+ +++D++   VT+  L  CG   P    QP+P      S+SS +    + 
Sbjct  452127  FEASSYTSLKELINDKATITVTDATL-TCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSH  452303

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
                GPCEVW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQ
Sbjct  452304  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQ  452471

Query  133     VYKNCVALSKT  143
               VY NC  L  T
Sbjct  452472  VYINCAPLEST  452504

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 17/125 (14%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEAL-FDCGLTSPKTETQPIPSN----SSFQTSGYTLDGPCEV  80
               Y SL+ ++ D  L KVT      +CG T+P    QP+P      +     G+T   PCEV
Sbjct  456778  YTSLKELITD--LGKVTSSDFTMECGYTTP----QPLPET*VEWAHGSGEGFTSSRPCEV  456617

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W DDT+V    +C   F     ++ Y   AC  +  L +YWL +     + +WQVY NC 
Sbjct  456616  WCDDTRVFRDDDCAAHFTTAPAKVPYDRDACLGASRLTFYWLALH----SSTWQVYTNCA  456449

Query  139     ALSKT  143
               AL KT
Sbjct  456448  ALKKT  456434

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 13/128 (10%)
 Frame = +3

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTL  74
                +   Y SL+ +++D++   VT+ A   CG   P    QP+P      S+SS +    + 
Sbjct  465501  FEASSYTSLKELINDKATITVTD-ATLTCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSH  465677

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
                GPCEVW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQ
Sbjct  465678  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQ  465845

Query  133     VYKNCVAL  140
               VY NC  L
Sbjct  465846  VYINCAPL  465869

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 12/122 (10%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
               Y+S++  + D     V   A  +CGLT P    QP+P     +   T G+T   +GPCE 
Sbjct  460543  YSSIKEFVTDLGQI-VANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCEA  460367

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W D+T+V    +C   +     ++ Y  + C  +  L +YWL +     + +WQVY +C 
Sbjct  460366  WCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDCA  460199

Query  139     AL  140
               AL
Sbjct  460198  AL  460193

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (45%), Gaps = 9/121 (7%)
 Frame = -2

Query  26      YASLRAMLDDESLYKVTE---EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
               Y SL+ + D   + +      +A  +CG +      + +P+   ++  GY+  GPCEVW 
Sbjct  469134  YTSLKDLADKTMVLQSLSPFGKATAECGFSLANGTARDLPAQVEWKDFGYSHQGPCEVWC  468955

Query  83      DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               DD       NC   +P    ++ Y    C  +  +  YW+ +        WQ+Y NCV L
Sbjct  468954  DDKLAFEDDNCALHYPEVPAKLPYDVDVCAGASMIQSYWIALH----GLPWQLYLNCVPL  468787

Query  141     S  141
               +
Sbjct  468786  T  468784

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (48%), Gaps = 22/146 (15%)
 Frame = +1

Query  12      NTSIEAQSWMQ---EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF-  67
               + +I  +S+++   +  Y S++AM++D  +  V+++A   CG + P   +    +++ + 
Sbjct  467137  DPTINVESFVENFKKSKYKSVKAMIEDNQVL-VSKDATASCGFSDPAQTSYGALNDTIYW  467313

Query  68      -QTSGYTLD------GPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSACGDSCT  114
                +    TLD      GPCE W DD +     NC   +     +      ID S C ++  
Sbjct  467314  GRNDDLTLDEGFVHMGPCETWCDDNRSQQDMNCQVTYTPASGKGAAPVPIDNSVCKNAKR  467493

Query  115     LWWYWLGIKYVEGAYSWQVYKNCVAL  140
               L +YW+ +    GA +WQVY  C + 
Sbjct  467494  LTFYWVAM---HGA-TWQVYSKCCSF  467559

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 56/131 (43%), Gaps = 14/131 (11%)
 Frame = +2

Query  21      MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNS---SFQTSGYTL  74
                 E  Y SL+ ++D  +  +       A  +CG +      + IPS     +  T G+  
Sbjct  573059  FNESSYTSLKDLVDKTAEVQTLSPFGTATLECGFSLANGSARDIPSEYVEWNQLTEGH--  573232

Query  75      DGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               DGPCEV+ DD       NC    P    Q   D S C  +  L  YW+ +        WQ
Sbjct  573233  DGPCEVYCDDVLAFENDNCAENLPGSPSQWPYDVSKCEGASRLTAYWIALH----GLPWQ  573400

Query  133     VYKNCVALSKT  143
               VY NCV L+++
Sbjct  573401  VYINCVPLTRS  573433

 Score = 37.7 bits (86),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (43%), Gaps = 6/68 (9%)
 Frame = -1

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
               DGP E+W DD    + +N    +P       Y  +AC     L   W+ +     +  WQ
Sbjct  474751  DGPLEIWCDDVLAFSDQNAAVNYPGSPATFPYDKAACEGKSRLTTIWMALH----SPPWQ  474584

Query  133     VYKNCVAL  140
               V+ NC  L
Sbjct  474583  VFTNCAPL  474560

 Score = 28.1 bits (61),  Expect(2) = 5.1, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 4/82 (5%)
 Frame = -3

Query  45      ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA---GRNCHTQFPHGQ  101
               A  +CG +      + +P    +     + +GP EVW DDT V         +T FP  +
Sbjct  472103  ATAECGFSLANGTARDLPEQVEWNQLTSSHEGPIEVWCDDTLVFKDWYAALDYTGFP-AK  471927

Query  102     HEIDYSACGDSCTLWWYWLGIK  123
                  D S C  +  L   WL + 
Sbjct  471926  LPYDVSKCKGASMLTSVWLALP  471861

 Score = 21.2 bits (43),  Expect(2) = 5.1, Method: Compositional matrix adjust.
 Identities = 7/14 (50%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = -1

Query  128     AYSWQVYKNCVALS  141
               A  W+VY NC  L+
Sbjct  471859  ALPWRVYTNCAPLT  471818

>PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 
genomic scaffold, whole genome shotgun sequence
Length=2319577

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 13/126 (10%)
 Frame = -3

Query  26       YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
                Y SL+  ++D ++  V E+   +CG T+P    QP+P      S     G+TL  +GPCE
Sbjct  1058849  YKSLKEFMND-NMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCE  1058673

Query  80       VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
                V+ D+T+V    NC   FP    ++  D+ AC  S  L  YW+ +     + SWQVY NC
Sbjct  1058672  VYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH----SPSWQVYINC  1058505

Query  138      VALSKT  143
                  L KT
Sbjct  1058504  APLEKT  1058487

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 63/131 (48%), Gaps = 13/131 (10%)
 Frame = +2

Query  21       MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
                 +   Y SL+ +++  +   VT+ A   CG   P    QP+P      S   T G+T   
Sbjct  1081781  FESSSYTSLKQLINALATVTVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSTEGFTSSH  1081957

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                +GPCEVW DD +V    +C   +     E+  D+ AC  + TL +YWL +     + +WQ
Sbjct  1081958  EGPCEVWCDDVRVFQDNDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQ  1082125

Query  133      VYKNCVALSKT  143
                VY NC  L  T
Sbjct  1082126  VYINCAPLEST  1082158

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 53/107 (50%), Gaps = 11/107 (10%)
 Frame = -3

Query  41       VTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEVWLDDTKVAAGRNCHT  95
                V   A   CGLT P    QP+P     +   T G+T   +GPCE W DDT+V    NC  
Sbjct  1071320  VATGANLQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCDDTQVFQDTNCAA  1071141

Query  96       QFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                 F     ++ Y  +AC  +  L +YWL +     + +WQVY NC AL
Sbjct  1071140  HFTTAPAKLPYNKAACSGASRLAFYWLALH----SSTWQVYANCAAL  1071012

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 61/131 (47%), Gaps = 13/131 (10%)
 Frame = +3

Query  21       MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
                 +   Y SL+ +++  +   VT+  L  CG   P    QP+P      S   T G+T   
Sbjct  1046829  FESSSYTSLKELINALTTVTVTDATL-TCGSCDPDETAQPLPETYVEWSHSSTEGFTSSH  1047005

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
                +GP EVW DD +    RNC   +     ++ Y   AC  + TL +YWL +     + +WQ
Sbjct  1047006  EGP*EVWCDDVRAFQDRNCAADYTSAPAKLPYDRDACLGTSTLTFYWLALH----SSTWQ  1047173

Query  133      VYKNCVALSKT  143
                VY NC  L  T
Sbjct  1047174  VYINCAPLEST  1047206

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 11/120 (9%)
 Frame = +2

Query  26       YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP-----SNSSFQTSGYTLDGPCEV  80
                Y S++ ++DD++   VT  A   CG+  P T  QP+P     S+S  +    T + PCEV
Sbjct  1220720  YKSIKEVIDDKAKIIVTG-ATLTCGIADPNTTPQPLPDKVEWSHSEGEGFTSTHESPCEV  1220896

Query  81       WLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                W D  +V    NC  QF   +   + S C  +  L  YW+ +       SWQVY NC  L
Sbjct  1220897  WCDMKRVFYDDNCAAQF-TAELPYEKSKCSGASVLTMYWMAMH----GPSWQVYVNCAPL  1221061

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 12/122 (10%)
 Frame = +2

Query  26       YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---QTSGYTL--DGPCEV  80
                Y SL+A +DD++   V+  A   CG   P    QP+P+   +   ++ G+T   +GPCE 
Sbjct  1247384  YKSLKAFIDDKAKITVSG-ATLTCGNAEPDATAQPLPAKLEWYHSESEGFTASHEGPCEA  1247560

Query  81       WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
                W D+ +V    NC   F      + Y    C  +  L ++W+ +       +WQVY NC 
Sbjct  1247561  WCDNERVFHDENCAAHFTTAPAVMPYEKRKCAGASKLTFFWMAMH----GPTWQVYVNCA  1247728

Query  139      AL  140
                 L
Sbjct  1247729  TL  1247734

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 9/121 (7%)
 Frame = +3

Query  26       YASLRAMLDDESLYKVTE---EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
                Y SL+ + D   + +      +A  +CG ++PK   + +P+   ++  GY+  GPCEVW 
Sbjct  1105266  YTSLKDLADKTMVLQSLSPFGKATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPCEVWC  1105445

Query  83       DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                DD       NC   +P     + Y    C  +  +  YW+ +        WQ+Y NC  L
Sbjct  1105446  DDKLAFMDTNCALHYPEVPAYLPYDIDVCVGAKMIQSYWIALH----GLPWQLYLNCAPL  1105613

Query  141      S  141
                +
Sbjct  1105614  T  1105616

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 15/123 (12%)
 Frame = +1

Query  26       YASLRAML------DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
                Y SL+ ++      + +SLY     A  +CG +      + +P    +       DGPCE
Sbjct  1089856  YTSLKELVWKNEVVNTDSLYGT---ATIECGFSWTNGTARDLPDEVQWDKLTTGHDGPCE  1090026

Query  80       VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
                +W DDT V A +NC   +P       Y  +AC     L   WL +     +  WQV+ NC
Sbjct  1090027  IWCDDTLVFADQNCAVNYPDSPASFPYDKAACEGKSMLTAIWLALH----SPPWQVFTNC  1090194

Query  138      VAL  140
                  L
Sbjct  1090195  APL  1090203

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 16/140 (11%)
 Frame = +2

Query  17       AQSW--MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNS---SFQ  68
                AQ W    +  Y SL+ ++D  +  +       A  +CG +      + +PS     +  
Sbjct  1286870  AQHWTAFNKSTYTSLKDLVDKTAKVETLSPFGMATLECGFSLANGTARDLPSEYVEWNQL  1287049

Query  69       TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVE  126
                T G+  DGPCEVW DD       NC   +P    +   D   C  +  L  YW+ +    
Sbjct  1287050  TEGH--DGPCEVWCDDVLAFGDDNCAVNYPETPSKWPFDVYKCSGASRLTAYWIALH---  1287214

Query  127      GAYSWQVYKNCVALSKTATA  146
                    WQV+ NCV L+ +  +
Sbjct  1287215  -GLPWQVFINCVPLTGSVNS  1287271

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 55/127 (43%), Gaps = 14/127 (11%)
 Frame = +1

Query  26       YASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSN----SSFQTSGYTL--DGPC  78
                Y SL+    D++   V   A   CG   PK     P P +    S   + G+T   +GPC
Sbjct  1284592  YTSLKEFFTDKAKIGV-PGATLTCGSCDPK*RSAAPCP*STIEWSHSASEGFTPSHEGPC  1284768

Query  79       EVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
                EVW  + +     NC  H          D  AC  + TL +YW+ +     + SWQVY N
Sbjct  1284769  EVWCGNVRTFQDDNCPAHYTMVPAVLPFDREACMGATTLTFYWMAMH----SESWQVYVN  1284936

Query  137      CVALSKT  143
                C  L KT
Sbjct  1284937  CAPLEKT  1284957

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 19/118 (16%)
 Frame = +2

Query  31       AMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF--------QTSGYTLDGPCEVWL  82
                AM++D  +  V+++A   CG +SP+  +    +++ +           G+   GPCE W 
Sbjct  1160303  AMINDNQVL-VSDDATATCGFSSPEKTSHGALNDTIYWGRNDDITMDEGFVHPGPCETWC  1160479

Query  83       DDTKVAAGRNCHTQF--PHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                D+T++     C   +  P G+      ID + C D+  L +YW+G+       +WQVY
Sbjct  1160480  DNTRIQQDMTCMETYNTPSGKGAAPIPIDNAKCTDAKRLTFYWIGMH----GSTWQVY  1160641

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 61/146 (42%), Gaps = 9/146 (6%)
 Frame = +2

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                ++Y  + G NT     +      Y SL+ +  D    K+   A  +CG +      + +P
Sbjct  1088282  MSYTTDPGSNTKAYWTA-FNASKYKSLKELSWDSQ--KLEGSASNECGFSLVDGTPRDLP  1088452

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWL  120
                    +     +  GPCEVW DDT V    NC   +P     + Y  + C  +  L  YW+
Sbjct  1088453  DEVQWDFFTASHQGPCEVWCDDTLVFENWNCAVDYPETPANLPYDKAKCKGAAMLTSYWI  1088632

Query  121      GIKYVEGAYSWQVYKNCVALSKTATA  146
                 +        WQVY NC  L+  +++
Sbjct  1088633  ALHTT----PWQVYTNCAPLTGASSS  1088698

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 7/73 (10%)
 Frame = +3

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                +GPCE+W DD +V  G +C   +     ++  D+ AC  S  L  YW+ +     + +WQ
Sbjct  1057350  EGPCEIWCDDVRVFQGNDCAADYTTAPAKLPYDHDACLGSSVL-NYWMALH----SSTWQ  1057514

Query  133      VYKNCVALSKTAT  145
                VY NC  L  T +
Sbjct  1057515  VYVNCAPLESTTS  1057553

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 62/144 (43%), Gaps = 20/144 (14%)
 Frame = +3

Query  16       EAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF--------  67
                + Q   ++  Y SLRA ++D  +  V+ EA   CG +SP+  +    +N+ +        
Sbjct  1083201  QRQVHYKKSKYKSLRAGIEDNQVL-VSSEAPASCGFSSPEQTSYGAVNNTVYWDRSDDIT  1083377

Query  68       QTSGYTLDGPCEVWLDDTKVAAGRNCHTQF--PHGQH----EIDYSACGDSCTLWWYWLG  121
                   G+   GPCEVW  D +          +  P G+      ID S C ++  L ++W  
Sbjct  1083378  VGEGFVHPGPCEVWCGDNRAHQDMTGDKTYNPPPGKGAAPVPIDKSLCKEATRLTFFW--  1083551

Query  122      IKYVEGAYSWQVYKNCVALSKTAT  145
                  Y+ G   WQ+Y   +     AT
Sbjct  1083552  --YMHGPM-WQIYSKLLRSCHLAT  1083614

 Score = 35.4 bits (80),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = +2

Query  31       AMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLDGPCEVWLDD  84
                AM++D  +  V+++A   CG +SP+  +    +++ +       T G+   GPCE W DD
Sbjct  1113338  AMINDNQVL-VSDDATATCGFSSPEKTSYGALNDTIYWGRKDVMTLGFGHPGPCETWCDD  1113514

Query  85       TKVAAGRNCHTQF--PHGQHE  103
                 ++     C   +  P G+ +
Sbjct  1113515  KRIQQDMTCMETYNTPSGKDD  1113577

 Score = 35.0 bits (79),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 35/69 (51%), Gaps = 7/69 (10%)
 Frame = -1

Query  31       AMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLDGPCEVWLDD  84
                AM++D  +  V+++A   CG +SP+  +    +++ +       T G+   GPCE W DD
Sbjct  1166140  AMINDNQVL-VSDDATATCGFSSPEKTSYGALNDTIYWGRKDVMTLGFGHPGPCETWCDD  1165964

Query  85       TKVAAGRNC  93
                 ++     C
Sbjct  1165963  KRIQQDMTC  1165937

>PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 
genomic scaffold, whole genome shotgun sequence
Length=3552875

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  84       DTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
                DT   +  NCH        ++DYSACGD+C L+WYWLG++Y++  YSWQVYK C++
Sbjct  2704661  DTLALSSLNCHESITDQTFKLDYSACGDTCVLYWYWLGVRYLKKKYSWQVYKECIS  2704494

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -2

Query  3        LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
                L++L+++G  T      +  ++GY SL   +D  + YKV++ A   CG T PK   Q IP
Sbjct  2748808  LSFLEKEGFKTQENFTQFQVDNGYKSLLDFMD-RAKYKVSKGADQACGWTDPKGIPQQIP  2748632

Query  63       SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFP  98
                 + + +T+GYT DGPCE+++ +    +  NCH   P
Sbjct  2748631  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIP  2748524

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  103      EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSK  142
                ++DYS CGDSC ++WYWLG++ ++G YSWQVYK C+ + K
Sbjct  2743289  KLDYSGCGDSCIIYWYWLGVRKLKGKYSWQVYKECIPVYK  2743170

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 7/87 (8%)
 Frame = -2

Query  18       QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDG  76
                +S    + +  LR ++DD S+Y        DCG T+P    QPIPS+     S      G
Sbjct  2827996  KSLKAANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKATFSRALVHHG  2827835

Query  77       PCEVWLDDTKVAAGRNCHTQFPHGQHE  103
                PC +WLDD  V    +C  ++ +   E
Sbjct  2827834  PCGIWLDDKMVLYEDDCFAKYGNENQE  2827754

>PYIR:scaffold_155 pir_scaffold_155 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_155:1:48358:1 
REF
Length=48358

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 6/123 (5%)
 Frame = -2

Query  19    SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GP  77
             +W     +A++      E+L    E+    CG T+P    + IPS+S  + S   +  GP
Sbjct  2862  NWKDPKNFATVSKQKGFETLRSYIEDKGALCGRTNPNASPKAIPSDSVVKFSRAIVHPGP  2683

Query  78    CEVWLDDTKVAAGRNCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY-  134
             CE+WLDD +V    NC   F       +ID+S+C  SC L W+WLG++  +    WQVY 
Sbjct  2682  CEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYS  2509

Query  135   KNC  137
             K+C
Sbjct  2508  KSC  2500

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = -2

Query  10    GVNTSIEA--QSWMQEHGYASLRAMLDDESLYK--VTEEALFDCGLTSPKTETQPIPSNS  65
             G +T+I+A  Q++  +  Y SL+ ++ D  +    + + A   CGLT  KT  QP+P+  
Sbjct  7857  GTDTNIKAYVQAFKAQTKYTSLKQLIMDNYVEAGTIPDRA---CGLTD-KTYAQPLPAEV  7690

Query  66    SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYV  125
              +Q   +   GPCEVW DDT      +C T +P  +   D S C     LW  +L +   
Sbjct  7689  EWQAGQHP--GPCEVWCDDTLAFHDDDCATNYPGIKLPYDRSKCVGKKVLWSMFLAMHVP  7516

Query  126   EGAYSWQVYKNCVAL  140
             +    WQVY  C A+
Sbjct  7515  Q----WQVYMGCTAI  7483

 Score = 56.2 bits (134),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +2

Query  74    LDGPCEVWLDDTKVAAGRNCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
             L GPCE+WLDD +V    NC   F       +ID+S+C  SC L W+WLG++  +    W
Sbjct  5903  LQGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERW  6076

Query  132   QVY  134
             QVY
Sbjct  6077  QVY  6085

 Score = 27.7 bits (60),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 27/49 (55%), Gaps = 9/49 (18%)
 Frame = +1

Query  22    QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS  70
             +E GY++LR+ ++D+            CG T+P    + IPS+++ + S
Sbjct  5668  KEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFS  5787

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = -1

Query  74   LDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
            L GPCE+WLD+ +V    NC   F       +ID+S+C  +C L ++WLG++  +    W
Sbjct  541  L*GPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRW  368

Query  132  QVY  134
            QVY
Sbjct  367  QVY  359

>PHCA:scaffold_2 PHYCAscaffold_2
Length=1925921

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 17/111 (15%)
 Frame = +1

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T    + QPIPS+   +       G+T  GPCE+++DD  V  G +C  +FP G   
Sbjct  382513  CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKG  382692

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +  +D+S+C   CTL  YWL  +  +    WQ Y NCV L    +A
Sbjct  382693  SDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPLQGDGSA  382833

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 17/111 (15%)
 Frame = +1

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T    + QPIPS+   +       G+T  GPCE+++DD  V  G +C  +FP G   
Sbjct  353650  CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDG  353829

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +  +D+S+C   CTL  YWL  +  +    WQ Y NCV L    +A
Sbjct  353830  SDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPLQGDGSA  353970

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 12/94 (13%)
 Frame = -3

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      QPIPS+   +       G+T  GPCE+++DD  V  G NC  +F  G   
Sbjct  351288  CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDTS  351109

Query  101     QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                 +IDYS+C  +C L  YWLG +  +    WQ Y
Sbjct  351108  DMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAY  351019

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 46/99 (46%), Gaps = 17/99 (17%)
 Frame = +3

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      QPIPS+   +       G+T  GPCEV+LDD  V  G NC  +F  G   
Sbjct  347799  CGNTLADGAAQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVVHGDNCEEEFKGGDVG  347978

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +DYSAC   CTL  YWL  +  +    WQ Y
Sbjct  347979  STETSDMTVDYSACNGKCTLTIYWLAFQNAQ----WQAY  348083

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 51/104 (49%), Gaps = 17/104 (16%)
 Frame = -2

Query  48      DCGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG--  100
               +CG T      QP+P++   +       G+T  GPCE+++DDT V  G NC  ++P G  
Sbjct  427768  ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  427589

Query  101     ------QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
                        +DYS+C   CTL  YWLG +  +    WQ Y   +
Sbjct  427588  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYSTLI  427469

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 17/99 (17%)
 Frame = -1

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH-  102
               CG T      QPIPS+   +       G+T  GPCE+++DD  V  G +C  +FP G   
Sbjct  363518  CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHRGPCEIYIDDKMVLHGDDCEEEFPGGSDG  363339

Query  103     -------EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +D+S+C  +C L  YWLG +  +    WQ Y
Sbjct  363338  SDKTSDMPVDFSSCNGNCMLTIYWLGFQNEQ----WQSY  363234

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 45/99 (45%), Gaps = 17/99 (17%)
 Frame = -3

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      QPIPS+   +       G+T  GPCE++LDD  V  G +C  +F  G   
Sbjct  391605  CGNTLADGPAQPIPSDGKVKWLGNNGGGFTHTGPCEIYLDDKMVLHGDDCEDEFQGGDVG  391426

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +D+S+C   C L  YWL  +  +    WQ Y
Sbjct  391425  SKKTSDMTVDFSSCIGKCLLTIYWLAFQNAQ----WQTY  391321

 Score = 41.2 bits (95),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%)
 Frame = +3

Query  49      CGLTSPKTETQPIPSNSSFQTSG-----YTLDGPCEVWLDDTKVAAGRNC  93
               CG T      QPIPS+   + +G     +T  GPCE+ +DD  V  G NC
Sbjct  355440  CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHSGPCEICIDDKMVLHGDNC  355589

 Score = 28.9 bits (63),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 4/32 (13%)
 Frame = +2

Query  103     EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               +IDYS+C  +C L  YWLG +  +    WQ Y
Sbjct  355640  KIDYSSCNGNCMLTIYWLGFQNAQ----WQAY  355723

>SAPA:scaffold_31 supercont2.31 dna:supercontig supercontig:ASM15154v2:supercont2.31:1:358087:1 
REF
Length=358087

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = +1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GY--TLDGPCEVW  81
               + +L+A LD             DCG+T P    QP+PS   +     G+  +  GPCE+W
Sbjct  132778  FKTLKAFLD-------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELW  132936

Query  82      LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                D+T+V    NC   +P G   ID S C  +  L   WL +   E    WQVYKNCV LS
Sbjct  132937  CDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  133104

Query  142     KTA  144
                 A
Sbjct  133105  GAA  133113

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = +1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GY--TLDGPCEVW  81
               + +L+A LD          +  DCG+T      QP+PS   +     G+  +  GPCE+W
Sbjct  137533  FKTLKAFLD-------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQGPCELW  137691

Query  82      LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                D+ +V    NC   +P+G   ID S C  +  L   WL +   +    WQVYKNCV LS
Sbjct  137692  CDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ----WQVYKNCVNLS  137859

Query  142     KTA  144
                 A
Sbjct  137860  GAA  137868

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 66/144 (46%), Gaps = 14/144 (10%)
 Frame = -1

Query  4       AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63
               +Y Q+   NT ++  +  +   + +L A +D +++          CG+T+     QP+PS
Sbjct  135493  SYNQDPAWNT-LQFTTQFKASPFRTLAAFVDSQNVASCGR-----CGITNAIGAAQPLPS  135332

Query  64      NSSFQTS--GYTL--DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
                  +     G+    +GPCEVW D T+V    NC      G   ID + C  +  L   W
Sbjct  135331  VLKWANGQEGFVASHEGPCEVWCDSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLW  135152

Query  120     LGIKYVEGAYSWQVYKNCVALSKT  143
               L +       SWQVY NCV LS +
Sbjct  135151  LALH----TPSWQVYINCVPLSGS  135092

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 32/59 (54%), Gaps = 4/59 (7%)
 Frame = +2

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               GPCE+W D+T+V    NC      G   ID + C  + TL ++WL +     + SWQVY
Sbjct  142742  GPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLALH----SSSWQVY  142906

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 4/59 (7%)
 Frame = +2

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               GPCE+W D+T+V    +C    P G   ID S C  +  L   W+ +   +    WQ Y
Sbjct  210596  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAY  210760

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 33/72 (46%), Gaps = 4/72 (6%)
 Frame = -1

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               S ++F    +   GPCE+W D+T+V    +C    P G   ID S C  +  L   W+ +
Sbjct  208654  STNAFDLRTHMD*GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMAL  208475

Query  123     KYVEGAYSWQVY  134
                  +    WQ Y
Sbjct  208474  HTPQ----WQAY  208451

>PYIR:scaffold_152 pir_scaffold_152 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_152:1:48504:1 
REF
Length=48504

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 12/120 (10%)
 Frame = +2

Query  25     GYASLRAM-LDDESLYKVTEEALFDCGLTS---PKTETQPIPSNSSFQTSGYTLDGPCEV  80
              GY SLR + L ++ +Y  + +   +CGLT+    K  T P   N +F  SG+T  GPCE+
Sbjct  47816  GYTSLRDLILANQDMYDESTDK--ECGLTTLDEAKRTTMPASGNITF--SGFTHPGPCEL  47983

Query  81     WLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              W DD K+    NC   +P G+   D + C  +     +W+G+        WQVY NCV L
Sbjct  47984  WCDDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVH----GSPWQVYTNCVYL  48151

>PHSO:scaffold_15
Length=1143705

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 67/135 (50%), Gaps = 15/135 (11%)
 Frame = +2

Query  17      AQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTL  74
               A  W  ++  ASL+     E + K   + + +CG T  K   QP+PS+   Q  T G + 
Sbjct  573254  ADDWFTKNNVASLK-----EYITKYGTD-ISECGNTEKKGLAQPVPSDGYAQHDTLGSSH  573415

Query  75      DGPCEVWLDDTKVAAGRNCHTQFP---HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
                GPCE+W DDT+V    NC  ++      +  ID S C  S    +YWL +     A  W
Sbjct  573416  PGPCEIWCDDTRVFHNTNCAQEYAGEVPTKLPIDVSTCKASSEFVFYWLALH----AQPW  573583

Query  132     QVYKNCVALSKTATA  146
               QVY NCVAL  TA A
Sbjct  573584  QVYINCVALDGTAAA  573628

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 51/107 (48%), Gaps = 13/107 (12%)
 Frame = +2

Query  46      LFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNC--HTQFPHGQ  101
               + +CG T      QP+P +   +  T G +  GPCE+W DDT+V    +C    +F  GQ
Sbjct  579398  IAECGNTKKNGTPQPVPEDGFVKHDTLGTSHPGPCEIWCDDTRVFHNVDCGLSGEF-AGQ  579574

Query  102     H----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                     ID + C  S  L +YWL +        WQVY NCV L   A
Sbjct  579575  APTSLPIDVATCKASSQLVFYWLALH----VQPWQVYINCVTLDGKA  579703

>PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_121:1:49194:1 
REF
Length=49194

 Score = 57.8 bits (138),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = -3

Query  72     YTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSAC--GDSCTLWWYWLGIK  123
              + L GPCE+WLDDT V    +C++ +     +      IDYS+C  G    + +YWL  +
Sbjct  17647  FGLQGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFNIDYSSCNSGGCKEMRFYWLAFQ  17468

Query  124    YVEGAYSWQVY  134
               V+GA  WQVY
Sbjct  17467  GVDGATKWQVY  17435

 Score = 40.0 bits (92),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 6/47 (13%)
 Frame = -1

Query  18     QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN  64
              +S   E G + +R++LDD S+Y        DCG T+P    QPIP++
Sbjct  17856  KSLASEKGVSQIRSLLDDTSIYGA------DCGFTNPSGTAQPIPTD  17734

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 37/147 (25%)
 Frame = -1

Query  19     SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--------  70
              S  +E+G +++R++LDD S+Y        DCG T+P    Q IP++S+   S        
Sbjct  19974  SLKEENGLSNIRSLLDDTSIYGA------DCGYTNPDGTAQDIPTDSTATFSRGMVHVVS  19813

Query  71     ---------------GYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSAC  109
                                  GPCE+WLDDT V +  +C++ +     +      +DYS+C
Sbjct  19812  HSRCS*WSGWC*IGLAXXXXGPCEIWLDDTMVLSEDDCYSLYGGDDQDVKSVFPVDYSSC  19633

Query  110    --GDSCTLWWYWLGIKYVEGAYSWQVY  134
                G    + +YWL  + V+    WQVY
Sbjct  19632  DSGGCSEMRFYWLAFQGVDDETVWQVY  19552

 Score = 46.6 bits (109),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 7/81 (9%)
 Frame = -1

Query  61     IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ-----HEIDYSACGDS-CT  114
              +  N     S   L GPCE+WLDDT      +C++ +   +       +DYS C  S C+
Sbjct  24501  VEQNRGLT*SNNVLQGPCEIWLDDTLAMYNDDCYSAYGGDEDVKSVFPVDYSTCESSGCS  24322

Query  115    -LWWYWLGIKYVEGAYSWQVY  134
               + +YWL  + V+    WQVY
Sbjct  24321  EMRFYWLAFQGVDDETVWQVY  24259

 Score = 41.6 bits (96),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 9/58 (16%)
 Frame = -3

Query  9      QGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS  66
              Q V T IE +   +E G  ++R+ LDD S+Y        DCG T P    QPIPS S+
Sbjct  24694  QSVTTYIELK---EEKGVTNIRSFLDDTSIYGA------DCGYTDPDGTAQPIPSTST  24548

 Score = 48.9 bits (115),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 8/76 (11%)
 Frame = -2

Query  74     LDGPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSACGDS-CTLW-WYWLGIKYV  125
              L GPCE+WLDDT V    +C++ +     +      +DYS+C  S C++  +YWL  + V
Sbjct  22121  LQGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGV  21942

Query  126    EGAYSWQVYKNCVALS  141
              +    WQVY     LS
Sbjct  21941  DDETVWQVYSKFGFLS  21894

 Score = 37.0 bits (84),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 26/48 (54%), Gaps = 6/48 (13%)
 Frame = -3

Query  19     SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS  66
              S  +E G   +R++LDD S+Y        DCG T P    Q IP++S+
Sbjct  22339  SLAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDST  22214

 Score = 45.8 bits (107),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 8/71 (11%)
 Frame = -1

Query  74     LDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSACGDS-CT-LWWYWLGIKYV  125
              L GPCE+WLDDT V    +C+T +     +I      DYS C  + C  + +YWL  + +
Sbjct  27213  LQGPCEIWLDDTMVLHDDDCYTTYGGEDQDIKSVFPVDYSVCETTGCKEMRFYWLAFQGL  27034

Query  126    EGAYSWQVYKN  136
               G   WQVY  
Sbjct  27033  SGKTVWQVYSK  27001

 Score = 35.0 bits (79),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 6/34 (18%)
 Frame = -2

Query  31     AMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN  64
              ++LDD S+Y        DCG T P  E QPIP++
Sbjct  27416  SLLDDTSIYGA------DCGFTDPDGEAQPIPTD  27333

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = -1

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQ-----HEIDYSACGDS-CTLWWYWLGIKYVEGAY  129
              GPCE+WLDDT V    +C   +   Q       +DYS+C  S C L +YWL ++ ++G  
Sbjct  28977  GPCEIWLDDTMVMYNDDCQAAYGGEQDIKSVFPVDYSSCSSSGCMLRFYWLALQGIDGEV  28798

Query  130    SWQVY  134
               WQVY
Sbjct  28797  VWQVY  28783

>PYVX:scaffold_639 pve_scaffold_639 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_639:1:17349:1 
REF
Length=17349

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 8/108 (7%)
 Frame = -3

Query  36    ESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNC  93
             + +  +   A  +CG T      QP+PS+   +F  S   + GPCEVWLDDTKVA+  +C
Sbjct  2305  DVIRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDC  2129

Query  94    HTQFPHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              + +      IDYS C G SC L W WL          W+++ NCV +
Sbjct  2128  WSTYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  1997

>PYAP:scaffold_289 pag1_scaffold_289 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_289:1:35482:1 
REF
Length=35482

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = +3

Query  41     VTEEALFDCGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFP  98
              + E A   CG T      QPIP++   +F  S   + GPCEVWLD+TKVA+ + C  +FP
Sbjct  14391  LAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWKEFP  14567

Query  99     HGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              + + ++D++ C   SC L W W+          W+ + NCV
Sbjct  14568  NKRIKVDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCV  14678

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 10/96 (10%)
 Frame = -1

Query  49     CGLTSPKTETQPIPSNSSFQ---TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEID  105
              CG T P    QPIP++   Q   T+ +   GPCE+WLD   VA+ + C  ++P  + ++D
Sbjct  12754  CGKTDPNGAVQPIPADGYVQLQITAAHI--GPCELWLDGEMVASAKQCVKEYPDRKIKVD  12581

Query  106    YSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +S C  S C L W WL          W++Y NCV +
Sbjct  12580  FSKCKSSKCQLRWVWLATHN----SPWEIYDNCVTV  12485

>PYAR:scaffold_88 par_scaffold_88 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_88:1:34485:1 
REF
Length=34485

 Score = 72.0 bits (175),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 12/119 (10%)
 Frame = +2

Query  23    EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
             + G+ +LRA L+D+            CG T P  + +P         S     GPCE+WL
Sbjct  3722  DKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWL  3874

Query  83    DDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             DD+      +C  +F      ++D+SAC  SC L +YWLG++       WQ YKNC+ L
Sbjct  3875  DDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPL  4045

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 13/119 (11%)
 Frame = +2

Query  24    HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVWL  82
              G+ +LR+ L+ +            CG +    + +PIPS+   +  S     GPCE+WL
Sbjct  2450  KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFASTLEHPGPCEIWL  2602

Query  83    DDTKVAAGRNCHTQFPHGQH-EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             D+T      +C  QF      ++++SAC  SC L +YWLG++  +    WQ YKNCV L
Sbjct  2603  DETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  2773

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  76   GPCEVWLDDTKVAAGRNCHTQFPHGQH-EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
            GPCE+WLD+T V    +C  +F      +I++SAC  SC L +YWLG++  +    WQ Y
Sbjct  461  GPCEMWLDETMVFHNDDCKKEFGSSTSVKINFSACKGSCMLRFYWLGLQ--DSGTRWQSY  634

Query  135  KNCVAL  140
            KNCV L
Sbjct  635  KNCVPL  652

>PHRA:scaffold_51
Length=360848

 Score = 72.0 bits (175),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 67/133 (50%), Gaps = 10/133 (8%)
 Frame = -2

Query  10     GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
              GVN ++   ++   + GY SL A +  ++ LY    +   DCGLT  K   +     S  
Sbjct  38740  GVNGTLNFFKATFPDKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKL  38567

Query  68     QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
                SG+T  GPCEVW DDTKV    +C T++P     I Y  S C D+  L  YW+G+   
Sbjct  38566  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLH--  38393

Query  126    EGAYSWQVYKNCV  138
                   WQVY +CV
Sbjct  38392  --GDPWQVYTDCV  38360

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 17/130 (13%)
 Frame = -3

Query  15     IEAQSWMQEHGYASLRAMLD-DESLY--KVTEEALFDCGLTS-PKTETQPIPSNSSFQTS  70
               EAQ      GY SL   ++ ++ LY   + E+    CG T    T  Q +P+ +   T 
Sbjct  40461  FEAQ--FNSSGYNSLGQFIETNQVLYSDNIDEQ----CGYTVYDDTARQTMPATNLTHT-  40303

Query  71     GYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGA  128
              G+T  GPCEVW DDT V    +C   +P     I Y  S C D+     YWL    V GA
Sbjct  40302  GFTHPGPCEVWCDDTVVLFEYDCQATYPDIPAGIPYDESLCADANRFTIYWLA---VHGA  40132

Query  129    YSWQVYKNCV  138
                WQVY +CV
Sbjct  40131  -PWQVYTDCV  40105

>PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 
genomic scaffold, whole genome shotgun sequence
Length=3114892

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 10/133 (8%)
 Frame = -1

Query  10       GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
                G N +I   ++ +   G  SL A++  ++ LY  + E   DCGLT+ K   +     S  
Sbjct  1481374  GPNGAINIIKANLATKGGGSLGALIAKNQKLY--SSEVDPDCGLTTFKDSARSKLPASQL  1481201

Query  68       QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYV  125
                + +G+T  GPCEVW DDTKV    +C T+FP    +I  D S C  +  L  YWL +   
Sbjct  1481200  EYTGFTHPGPCEVWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVH--  1481027

Query  126      EGAYSWQVYKNCV  138
                     WQVY +CV
Sbjct  1481026  --GEQWQVYSDCV  1480994

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = -3

Query  10       GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
                GVN ++   ++     GY SL A +  ++ LY    +   DCGLT  K   +     S  
Sbjct  1519643  GVNGTLNFFKATFPTKGYKSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASQL  1519470

Query  68       QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
                + +G+T  GPCEVW DDTKV +  +C T++     +I Y  + C  +  L  YWL +   
Sbjct  1519469  EHTGFTHTGPCEVWCDDTKVLSDYDCQTKYSAIPAKIPYDEAKCAKANRLTIYWLALH--  1519296

Query  126      EGAYSWQVYKNCV  138
                     WQ Y +CV
Sbjct  1519295  --GDPWQEYTDCV  1519263

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  25       GYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQ-PIPSNSSFQTSGYTLDGPCEVWL  82
                GY SL   +  ++ LY  + +   DCG T  K   +  +P+    + +G+T  GPCE+W 
Sbjct  1541392  GYDSLGQFIAKNQELY--SSDIDPDCGWTVYKDSARSALPTQ--LEYTGFTHPGPCEIWC  1541225

Query  83       DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                DDTK+    +C T++P    +I Y  S C ++  L  +W+GI        WQ+Y +CV L
Sbjct  1541224  DDTKLLFDYDCWTKYPAIPAKIPYDKSKCANANRLTIFWIGIH----GTPWQIYTDCVWL  1541057

>APAS:scaffold_33 supercont1.33 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.33:1:657536:1 
REF
Length=657536

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 16/136 (12%)
 Frame = +2

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
               + +IE    +++  +ASLRA +D +           +CGLT      + +PS+S  +   
Sbjct  121484  DNTIEFTRQLKKSSFASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAH  121645

Query  69      -TSGYTL--DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYV  125
                + G+ L  +GPCE+W D T+V    NC    P G   I+ S C  S  L   WL +   
Sbjct  121646  GSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS  121825

Query  126     EGAYSWQVYKNCVALS  141
               +    WQVYKNCV L+
Sbjct  121826  Q----WQVYKNCVRLT  121861

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 66/136 (49%), Gaps = 16/136 (12%)
 Frame = +2

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
               + +I     +++  +ASLRA +D +           +CGLT      + +PS+S  +   
Sbjct  125441  DNTIAFTRQLKKSSFASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAH  125602

Query  69      -TSGYTL--DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYV  125
                + G+ L  +GPCE+W D T+V    NC    P G   I+ S C  S  L   WL +   
Sbjct  125603  GSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS  125782

Query  126     EGAYSWQVYKNCVALS  141
               +    WQVYKNCV L+
Sbjct  125783  Q----WQVYKNCVRLT  125818

 Score = 60.5 bits (145),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 4/66 (6%)
 Frame = +1

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               +GPCEVW D+T V    NC    P G  +ID + C  +  +   W+ +  V+    WQVY
Sbjct  108190  EGPCEVWCDNTVVFQNDNCARNVPSGNMQIDVAKCSGAKKMVVLWIALHAVD----WQVY  108357

Query  135     KNCVAL  140
               KNCVAL
Sbjct  108358  KNCVAL  108375

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 4/68 (6%)
 Frame = -1

Query  73      TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               T +GPCEVW DD+ V    NC    P G   +D   C  + +L  YWL +   +    WQ
Sbjct  248867  THNGPCEVWCDDSIVFQDDNCPLHEPSGLLRVDMDKCRKAKSLVIYWLALHSPQ----WQ  248700

Query  133     VYKNCVAL  140
               VY NCVAL
Sbjct  248699  VYLNCVAL  248676

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 66/138 (48%), Gaps = 15/138 (11%)
 Frame = -1

Query  12      NTSIE--AQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-  68
               NTS +  A ++ ++   +S + + D   L          CG+T+P    + I ++ + + 
Sbjct  136964  NTSPQDNAAAFTRQFQASSFKTLRD---LVLANPSTCGSCGITNPNGTPRQINADGTVKW  136794

Query  69      ---TSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIK  123
                  + G+  + +GPCEVW D  +V    NC     +G  +ID + C  +  L  YWL + 
Sbjct  136793  AHGSEGFISSHEGPCEVWCDTDRVFQNDNCARNAANGIVKIDVAKCKRAIHLVVYWLALH  136614

Query  124     YVEGAYSWQVYKNCVALS  141
                     +WQ+Y NCV L+
Sbjct  136613  VP----TWQIYLNCVRLA  136572

 Score = 38.9 bits (89),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 4/69 (6%)
 Frame = +2

Query  69      TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGA  128
               T+ +T     EV     +V +  NC    P G   I+ + C  S  L++ WL +      
Sbjct  140828  TAAFTSGRRREVGTWGRRVYSNENCARNIPDGGMPINVATCNGSKRLFFLWLAMH----T  140995

Query  129     YSWQVYKNC  137
                SWQVYKNC
Sbjct  140996  SSWQVYKNC  141022

>PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.9, whole genome shotgun 
sequence
Length=1651025

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 9/121 (7%)
 Frame = +1

Query  21      MQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
               +   G  SL A++  ++ LY  + +   DCGLT+ K   +     S  + +G+T  GPCE
Sbjct  538327  LPTKGGGSLGALIAKNQKLY--SSDVDPDCGLTTFKESARSKLPASQLEYTGFTHPGPCE  538500

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               VW DDTKV    +C T+FP    +I Y  S C ++  L  YWL +        WQVY +C
Sbjct  538501  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVH----GEQWQVYSDC  538668

Query  138     V  138
               V
Sbjct  538669  V  538671

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 10/133 (8%)
 Frame = +2

Query  10      GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
               GVN ++   ++     GY SL A +  ++ LY    +   DCGLT  K   +     S  
Sbjct  523961  GVNGTLNFFKATFPTKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASQL  524134

Query  68      QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
               + +G+T  GPCEVW DDTKV    +C T++P    +I Y  S C ++  L  YWL +   
Sbjct  524135  EYTGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLALH--  524308

Query  126     EGAYSWQVYKNCV  138
                    WQVY +CV
Sbjct  524309  --GDPWQVYTDCV  524341

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +2

Query  25      GYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLD  83
               GY SL   +  ++ LY    +   DCG T  K   +     +  + +G+T  GPCE+W D
Sbjct  509258  GYDSLGQFIAKNQELYSSDIDP--DCGWTIYKDSARSELPEAQLEYTGFTHPGPCEIWCD  509431

Query  84      DTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               DTK+    +C T++P    +I Y  S C D+  L  YW+GI  V     WQ+Y +CV L
Sbjct  509432  DTKLLFDYDCWTKYPAIPAKIPYDKSKCADANRLTIYWIGIHGVP----WQIYTDCVWL  509596

 Score = 32.3 bits (72),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 1/29 (3%)
 Frame = +3

Query  59      QPIPSNSSFQTSGYTLDGPCEVWLDDTKV  87
               + IPS +   T G+T  GPCEV  DDTKV
Sbjct  522288  RTIPSTNLMHT-GFTHPGPCEVCCDDTKV  522371

>PYIR:scaffold_1319 pir_scaffold_1319 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1319:1:8199:1 
REF
Length=8199

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 14/119 (12%)
 Frame = -1

Query  25    GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEVWLD  83
             G+A+ RA L+              CG T      +PIPS+++ + S   +  GPCE+W+D
Sbjct  5934  GFATTRAFLESRGP---------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWID  5782

Query  84    DTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             +T+V    +C   F       +ID+SAC  SC L +YWLG++  +G   +Q Y  C+AL
Sbjct  5781  NTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLAL  5611

>PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1535:1:8373:1 
REF
Length=8373

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 14/128 (11%)
 Frame = -2

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
             ++   Y S+RA++DD++++   +EA  +CG+TSP    QP+P      S   + G+T   
Sbjct  6914  LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  6741

Query  76    -GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              GPCEVW DD       NC   +     E  ID++ C  +  L   WL +     + +WQ
Sbjct  6740  QGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SSTWQ  6573

Query  133   VYKNCVAL  140
             +Y NC  L
Sbjct  6572  IYINCAPL  6549

 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 30/144 (21%), Positives = 62/144 (43%), Gaps = 16/144 (11%)
 Frame = +2

Query  2     ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
              +A+     +N     +++  +  + +L+ +++      +  +A   CG T P   ++P+
Sbjct  4928  GVAFNTAPSINMENFIKNFKTDTRHPNLKTLVEKNQKV-INAKADAKCGWTDPSKTSEPL  5104

Query  62    PSNS-----SFQTSG--YTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACG  110
               +S     +F+ +G  +   GPCE W D+  V    +C  ++          ID + C 
Sbjct  5105  EGSSIIYGRNFEGTGEGFVHPGPCETWCDNVMVQQEMHCDEKYNVANKAAIIPIDAAKCK  5284

Query  111   DSCTLWWYWLGIKYVEGAYSWQVY  134
              +  L  YW+ +   E    WQ+Y
Sbjct  5285  GAKQLTTYWIAMHGNE----WQIY  5344

 Score = 36.6 bits (83),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 26/67 (39%), Gaps = 6/67 (9%)
 Frame = +1

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCEVW DD       NC          + Y  S C     L  YW+ +   +    WQ+
Sbjct  2938  GPCEVWCDDVMAFQDDNCSVNLTTQPAVLKYDKSKCAGKKMLTSYWIALHVPQ----WQI  3105

Query  134   YKNCVAL  140
             Y  C  L
Sbjct  3106  YTYCAPL  3126

>PHRA:scaffold_131
Length=101106

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 64/134 (48%), Gaps = 17/134 (13%)
 Frame = +1

Query  19     SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GYTLDG  76
              SW  ++  ASL+  +   + Y      + +CG+T      QP+PS+   Q    G +  G
Sbjct  95992  SWFTKNNIASLKEYI---TTYGTD---ISECGVTKKNGAPQPVPSDGYAQHDNLGNSHPG  96153

Query  77     PCEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              PCE+W DDT+V    NC  +F  GQ      ID S C  S  L +YWL +        WQ
Sbjct  96154  PCEIWCDDTRVFHDSNCVAKF-SGQSPAKIPIDVSTCKSSSELVFYWLALHI----QPWQ  96318

Query  133    VYKNCVALSKTATA  146
              VY NCVAL     A
Sbjct  96319  VYINCVALDGAGAA  96360

 Score = 34.3 bits (77),  Expect = 0.88, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 27/53 (51%), Gaps = 9/53 (17%)
 Frame = +1

Query  48     DCGLTSPKTETQPIPSNSSFQTSGYTLD----GPCEVWLDDTKVAAGRNCHTQ  96
              +CG  +P   T+P PS   ++T  YTL     GPCE+W DD +       H Q
Sbjct  99847  ECG--TPSRMTRPRPS---YRTDMYTLGRSHLGPCEIWCDDKRAFNNNTNHRQ  99990

>PHKE:scaffold_399 scf_22126_399.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_399.1:1:32365:1 
REF
Length=32365

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 15/127 (12%)
 Frame = +1

Query  22     QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEV  80
              + + Y  L+ ++DD S+Y        DCG T P    QPIPS+     S      GPCE+
Sbjct  28126  KANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEI  28287

Query  81     WLDDTKVAAGRNCHTQFPHGQHE------IDYSAC-GDSCT-LWWYWLGIKYVEGAYSWQ  132
              WLDD  V +  +C+ ++ +   +      +DYS+C G  C  + +YWL  + V+G   WQ
Sbjct  28288  WLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQ  28467

Query  133    VYKNCVA  139
               Y    A
Sbjct  28468  SYSELPA  28488

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 62/122 (51%), Gaps = 18/122 (15%)
 Frame = +3

Query  19     SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDG  76
              S  + + +  L+ ++DD S+Y        DCG T P    QPIPS+  ++F  +   + G
Sbjct  30765  SLKKANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHV-G  30923

Query  77     PCEVWLDDTKVAAGRNCHTQ--FPHGQHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQ  132
              PCE+WLD TK  +  NC     FP     +DYS+C  G    + +YWL  + ++    WQ
Sbjct  30924  PCEIWLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQ  31088

Query  133    VY  134
               Y
Sbjct  31089  SY  31094

>PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_22.1:1:203587:1 
REF
Length=203587

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 66/133 (50%), Gaps = 10/133 (8%)
 Frame = -1

Query  10     GVNTSIEA-QSWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
              GVN ++   +      GY SL A +  ++ LY    +A  DCGLT  K   +     S  
Sbjct  37636  GVNGTLNFFKDTFPSKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKL  37463

Query  68     QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
                SG+T  GPCEVW DDTKV    +C T++P     + Y  S C ++  L  YW+G+   
Sbjct  37462  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLH--  37289

Query  126    EGAYSWQVYKNCV  138
                   WQVY +CV
Sbjct  37288  --GDPWQVYTDCV  37256

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 58/118 (49%), Gaps = 7/118 (6%)
 Frame = -3

Query  25     GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDD  84
              GY SL   ++   +   ++E    CG T+     +    +++   +G+T  GPCEVW DD
Sbjct  39356  GYESLGQYIETNQV-MYSDEIDEQCGYTTYDDSARQTMPSTNLTYTGFTHPGPCEVWCDD  39180

Query  85     TKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              T V    NC + +P     I Y  S C D+     YWLG   V GA  WQV+ +CV L
Sbjct  39179  TVVLFDYNCQSTYPDIPAGIPYDESLCADANRFTIYWLG---VHGA-PWQVFTDCVWL  39018

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 12/117 (10%)
 Frame = -3

Query  26     YASLRAML-DDESLYKVTEEALFDCGLTSPKTETQP-IPSNSSFQTSGYTLDGPCEVWLD  83
              Y +L A++ D + LY  + +   +CGLT+ K   +  +P   +F  +G+T  GPCEVW D
Sbjct  35351  YKTLSALIADKQELYSKSVDP--ECGLTAYKDSARSELPKELAF--TGFTHPGPCEVWCD  35184

Query  84     DTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              +TKV    +C   +P     + Y  S C ++  L  YW+ +        WQVY +CV
Sbjct  35183  NTKVLYKADCQKAYPDIPATMSYDSSLCANANRLTIYWIAVH----GDPWQVYADCV  35025

>PHIF:NW_003303506.1 Phytophthora infestans T30-4 supercont1.253 
genomic scaffold, whole genome shotgun sequence
Length=123523

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 63/131 (48%), Gaps = 13/131 (10%)
 Frame = +3

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
              +   Y SL+ +++  +   VT+ A   CG   P   +QP+P      S   T G+T   
Sbjct  1995  FESSSYTSLKELINALATVTVTD-ATLTCGSCDPDETSQPLPETYVEWSHSSTEGFTSSH  2171

Query  75    DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
             +GPCE+W DD +V    +C   +     E+ Y   AC  S TL +YWL +     + +WQ
Sbjct  2172  EGPCEIWCDDVRVFQDNDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQ  2339

Query  133   VYKNCVALSKT  143
             VY NC  L  T
Sbjct  2340  VYINCAPLEST  2372

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 34/71 (48%), Gaps = 6/71 (8%)
 Frame = +2

Query  73     TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYS  130
              T +GPCEVW D  +V    NC   F     E+ Y  S C  +  L  YW+ +       S
Sbjct  72047  THEGPCEVWCDKKRVFYDDNCAAHFTAAPAELPYEKSKCSGASVLTMYWMAMH----GPS  72214

Query  131    WQVYKNCVALS  141
              WQVY NC  LS
Sbjct  72215  WQVYVNCAPLS  72247

>PYAR:scaffold_674 par_scaffold_674 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_674:1:14611:1 
REF
Length=14611

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 9/96 (9%)
 Frame = -1

Query  49    CGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY  106
             CG T+     QP PS+   +F  S   + GPCE+WLDDTKV +  +C  QFP  +  +D+
Sbjct  7540  CGKTNANAAVQPAPSDGVVAFAISAQHI-GPCEIWLDDTKVVSATDCWKQFPDKRIPVDF  7364

Query  107   SACGD--SCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             S C +  SC L W W+          W+ Y NCV +
Sbjct  7363  SKCANKASCELRWIWMATHT----SPWEFYDNCVRV  7268

>PHCA:scaffold_40 PHYCAscaffold_40
Length=570383

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 62/127 (49%), Gaps = 17/127 (13%)
 Frame = +2

Query  20      WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGP  77
               W  ++  ASL+  +   + Y      + +CG T  K   Q +PS+   Q  T G +  GP
Sbjct  108722  WFTKNNVASLKEYI---TTYGT---GISECGNTEKKGTAQSVPSDGYAQHDTLGNSHPGP  108883

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
               CE+W DDT+V    NC T F  GQ      ID S C  S    +YWL +     A  WQV
Sbjct  108884  CEIWCDDTRVFHDTNCVTTF-SGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQV  109048

Query  134     YKNCVAL  140
               Y NCVAL
Sbjct  109049  YINCVAL  109069

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 11/107 (10%)
 Frame = +2

Query  46      LFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ--  101
               + +CG T      QP+P++   +  + G +  GPCE+W DDT+V    NC  ++  GQ  
Sbjct  112631  IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEY-AGQVP  112807

Query  102     --HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                   ID   C  S  L +YWL +   +GA  WQVY NCV L  +A A
Sbjct  112808  TSLPIDLDTCKSSSELVFYWLSL---QGA-PWQVYINCVKLDGSAAA  112936

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 53/107 (50%), Gaps = 11/107 (10%)
 Frame = +2

Query  46      LFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ--  101
               + +CG T      QP+P++   +  + G +  GPCE+W DDT+V    NC  ++  GQ  
Sbjct  164219  IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEY-AGQVP  164395

Query  102     --HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                   ID   C  S  L +YWL +        WQVY NCV L  +A A
Sbjct  164396  TSLPIDLDTCKSSSELVFYWLALH----VQPWQVYINCVTLDGSAAA  164524

 Score = 31.2 bits (69),  Expect(2) = 0.008, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (48%), Gaps = 4/42 (10%)
 Frame = +3

Query  104     IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTAT  145
               ID S C  S    +YW  +        WQV+ NCVAL  +A 
Sbjct  110625  IDVSTCKSSSEFVFYWQALH----VQPWQVHVNCVALDGSAA  110738

 Score = 28.5 bits (62),  Expect(2) = 0.008, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 4/28 (14%)
 Frame = +1

Query  70      SGYTL----DGPCEVWLDDTKVAAGRNC  93
               S YTL     GPCE+W D+T+V +  +C
Sbjct  110503  STYTLGNPHPGPCEIWCDNTRVYSDADC  110586

>PHCA:scaffold_11 PHYCAscaffold_11
Length=1076090

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 61/117 (52%), Gaps = 9/117 (8%)
 Frame = -1

Query  25      GYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLD  83
               GY SL A +  ++ LY    +   DCGLT  K   +     S  + SG+T  GPCEVW D
Sbjct  649559  GYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPCEVWCD  649386

Query  84      DTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               DTKV    +C T++P    ++ Y  S C ++  L  YW+G+        WQVY +CV
Sbjct  649385  DTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLH----GDPWQVYTDCV  649227

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 68/135 (50%), Gaps = 10/135 (7%)
 Frame = -2

Query  10      GVNTSIEA-QSWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
               G N S+   +  +   G  SL+A++  ++ LY   ++   +CGLT+ K   +     S  
Sbjct  685090  GPNGSVNIIKEKLSTTGGGSLKALISKNQKLYN--DKVDPECGLTAFKDSARSKLPASQL  684917

Query  68      QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
               + +G+T  GPCEVW DDTKV    NC  ++P    +I Y  S C  +  L  +W+ +   
Sbjct  684916  EFTGFTHPGPCEVWCDDTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAVH--  684743

Query  126     EGAYSWQVYKNCVAL  140
                    WQVY +CV L
Sbjct  684742  --GEPWQVYTDCVYL  684704

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 9/119 (8%)
 Frame = +1

Query  25      GYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLD  83
               G  SL+A++  ++ LY   ++   +CGLT+ K   +     S  + +G+T  GPCEVW D
Sbjct  647863  GGGSLKALISKNQKLYN--DKVDPECGLTAFKDSARSKLPASQLEFTGFTHPGPCEVWCD  648036

Query  84      DTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               DTKV    +C  ++P    +I Y  S C  +  L  +W+ +        WQVY +CV L
Sbjct  648037  DTKVLFDYDCQAKYPDIPAKIPYDESKCSGANRLTIHWVAVH----GEPWQVYTDCVYL  648201

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 58/125 (46%), Gaps = 13/125 (10%)
 Frame = -2

Query  21      MQEHGYASLRAMLD-DESLY--KVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGP  77
                   GY SL   ++ ++ LY   V E+    CG T      +     ++   +G+T  GP
Sbjct  651511  FNASGYNSLGQFIETNQVLYCDDVDEQ----CGYTVYDASGRQTMPTTNLTHTGFTHPGP  651344

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
               CE+W DDTKV    NC   +P     I Y  S C D+     YWL    V GA  WQVY 
Sbjct  651343  CEIWCDDTKVLFDYNCQATYPDIPAGIPYDESLCADANRFTIYWLA---VHGA-PWQVYT  651176

Query  136     NCVAL  140
               +CV L
Sbjct  651175  DCVWL  651161

>PYIR:scaffold_5821 pir_scaffold_5821 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5821:1:515:1 
REF
Length=515

 Score = 66.6 bits (161),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 14/125 (11%)
 Frame = -1

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
            ++   Y S+RA++D +  +     A   CG+TSP  + QP+P+     +   T G+T   
Sbjct  359  LKASTYKSVRALVDAKGQF--ISGANKQCGVTSPTGDKQPLPAQYVEWAHSSTEGFTPSH  186

Query  76   -GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCEVW DD    +  NC T +P    ++ Y  S C  +  L  YWL +     + +WQ
Sbjct  185  QGPCEVWCDDKMAFSDENCATNYPTAPAKLPYDKSKCTGASMLKIYWLALH----SSTWQ  18

Query  133  VYKNC  137
             Y NC
Sbjct  17   AYINC  3

>PHKE:scaffold_72 scf_22126_72.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_72.1:1:114560:1 
REF
Length=114560

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 14/127 (11%)
 Frame = +1

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLDGPCEVW  81
              Y SL+  +++++   VT  A   CG   P    QP+P +    S F T  +   GPCEVW
Sbjct  52792  YTSLKEFVNEKATVTVTG-ATLTCGSCDPNEPAQPLPESTVEWSPFFTESHV--GPCEVW  52962

Query  82     LDDTKVAAGRNCHTQFPH---GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               D+ +V    NC   F +    Q   D  AC  S  L +YW+ +     + +WQVY NC 
Sbjct  52963  CDEMRVFQNDNCAGSFSNNAPAQMPYDRDACMGSSVLTFYWMALH----SSTWQVYVNCA  53130

Query  139    ALSKTAT  145
               L KTA+
Sbjct  53131  PLEKTAS  53151

>PYUU:scaffold_2036 scf1117875582036 dna:supercontig supercontig:pug:scf1117875582036:1:1090657:1 
REF
Length=1090657

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 56/112 (50%), Gaps = 13/112 (12%)
 Frame = -3

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVWLD  83
               GY  L++ L+D+            CG + P  + +PIPS+   +  S     GPCEVW D
Sbjct  713495  GYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWFD  713343

Query  84      DTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               D +     +C   F      ++D+SAC  SC L +YWLG++  +G   WQ Y
Sbjct  713342  DVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSY  713193

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 55/117 (47%), Gaps = 13/117 (11%)
 Frame = +2

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
               + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  704567  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  704719

Query  82      LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ Y  C
Sbjct  704720  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYSKC  704884

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 13/114 (11%)
 Frame = -2

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
               + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  707577  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  707425

Query  82      LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ Y
Sbjct  707424  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSY  707269

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 13/114 (11%)
 Frame = -1

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
               + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  702445  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  702293

Query  82      LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ Y
Sbjct  702292  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSY  702137

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 13/114 (11%)
 Frame = -2

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
               + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  697422  KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  697270

Query  82      LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ Y
Sbjct  697269  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSY  697114

>SADI:scaffold_134 supercont1.134 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.134:1:99377:1 
REF
Length=99377

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 57/123 (46%), Gaps = 15/123 (12%)
 Frame = -1

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GY--TLDGPCEVW  81
              + +L+A LD             DCG+T      QP+PS   +     G+  +  GPCE+W
Sbjct  55631  FKTLKAFLD-------AYPTGGDCGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELW  55473

Query  82     LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
               D+T+V    NC    P G   ID S C  +  L   WL +   E    WQVYKNCV LS
Sbjct  55472  CDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  55305

Query  142    KTA  144
                A
Sbjct  55304  GVA  55296

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 54/120 (45%), Gaps = 13/120 (11%)
 Frame = -1

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GYTL--DGPCEVW  81
              + +L + +DD S           CG+T+     QP+PS   +     G+    +GPCEVW
Sbjct  58745  FQTLASFVDDPSFAPCGT-----CGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVW  58581

Query  82     LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
               D T+V    NC      G   ID + C  +  L   WL +       SWQVY NCV LS
Sbjct  58580  CDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLALH----TPSWQVYINCVPLS  58413

 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 0/30 (0%)
 Frame = +2

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQHEID  105
              GPCE+W D+T+V    NC      G   ID
Sbjct  69329  GPCELWCDNTRVYDNENCAKNIADGSMPID  69418

>HYAP:scaffold_176 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_176:1:128177:1 
REF
Length=128177

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 53/107 (50%), Gaps = 11/107 (10%)
 Frame = -3

Query  41     VTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEVWLDDTKVAAGRNCHT  95
              V + A  +CGLT P    QPIP     S   T G+T   +GPCE W DDT+V    NC  
Sbjct  37101  VAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCDDTQVFQDENCAA  36922

Query  96     QFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               F     ++ Y  + C  +    +YWL +     + +WQVY NC AL
Sbjct  36921  HFTTAPAKMPYDKAKCSGASRFTFYWLALH----SSTWQVYVNCAAL  36793

 Score = 38.9 bits (89),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 39/96 (41%), Gaps = 6/96 (6%)
 Frame = -3

Query  48     DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH--GQHEID  105
              +CG +      + +P    +     + +GP EV+ DD  V    N    FP        D
Sbjct  42444  ECGFSLVDGTPRDLPDQIQWDFFTASHEGPFEVYCDDKLVFKDWNAAIDFPEHPANTPYD  42265

Query  106    YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
               + C  +  L  YWL +  V     WQVY NC  L+
Sbjct  42264  KAKCKGAKMLTSYWLALHSVP----WQVYTNCAPLT  42169

>PYVX:scaffold_894 pve_scaffold_894 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_894:1:10447:1 
REF
Length=10447

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 12/126 (10%)
 Frame = +2

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y SL+ M+ D      T      CGLT P    Q +P      +   T G+T   +GPCE
Sbjct  191  YTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASHEGPCE  370

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            +W DDT+V    +C   +     ++  D  AC  +  L +YWL +     + +WQVY NC
Sbjct  371  IWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH----SSTWQVYINC  538

Query  138  VALSKT  143
             AL +T
Sbjct  539  AALEET  556

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 58/123 (47%), Gaps = 12/123 (10%)
 Frame = +1

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
             Y+SL+ M+        T      CGLT P    Q +P      +   + G+T   +GPCE
Sbjct  7435  YSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSDSEGFTASHEGPCE  7614

Query  80    VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
             +W DDT+V    +C   +     ++ Y  ++C  +  L +YWL +   +    WQVY NC
Sbjct  7615  IWCDDTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLALHSSQ----WQVYVNC  7782

Query  138   VAL  140
              AL
Sbjct  7783  AAL  7791

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 14/128 (11%)
 Frame = -3

Query  25    GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS----SFQTSGYTLD--GPC  78
             GY++L+  ++ +    +   A  +CGL  P    QP+P+         T G T    GPC
Sbjct  3710  GYSTLKNYVNVK--MTLIPGATEECGLAIPDATPQPLPAKYVEWYHSPTEGLTESHHGPC  3537

Query  79    EVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
             E++  +T+V    +C T +     Q   D ++C  +  L +YWL +      Y WQVY N
Sbjct  3536  EIYCGNTRVFKNDDCSTHYKTIPAQFPYDRASCLGASHLTFYWLTLH----EYQWQVYIN  3369

Query  137   CVALSKTA  144
             CV L  T+
Sbjct  3368  CVPLVATS  3345

 Score = 49.3 bits (116),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 51/110 (46%), Gaps = 25/110 (23%)
 Frame = -3

Query  35    DESLYK-----VTEE------ALFDCGLTSPKTETQPIP---------SNSSFQTSGYTL  74
             D S YK     VTE+      A  +CGL+ P    QP+P         SN  F  S    
Sbjct  1673  DSSSYKSLKEFVTEKMTPISGATKECGLSDPDATAQPLPDTYVEWAHSSNEGFTPS---H  1503

Query  75    DGPCEVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             +GPCE+W DDT+V    +C  H      Q + D ++C  S  L ++WL +
Sbjct  1502  EGPCEIWCDDTRVFQDDDCAAHYTSAPAQLKYDRASCVGSSRLTFFWLAL  1353

 Score = 21.6 bits (44),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 7/10 (70%), Positives = 7/10 (70%), Gaps = 0/10 (0%)
 Frame = -1

Query  131   WQVYKNCVAL  140
             WQVY NC  L
Sbjct  1342  WQVYINCAPL  1313

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 57/135 (42%), Gaps = 20/135 (15%)
 Frame = +2

Query  22    QEHGYASLRAMLDDESLYKVTEEALFDCGLTSP-KTETQPIPS------NSSFQTSGYTL  74
             +   YA++R M+    +  V++ A  DCG + P KT    +        ++     G+ +
Sbjct  9236  KNSSYANVREMIVANQVV-VSDSATADCGFSDPSKTSYGALNDTIYWGKSADLTGEGFVV  9412

Query  75    D--GPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSACGDSCTLWWYWLGIKYVE  126
                GPCE W DD       NC   +            ID S C  +  L +YW+ +   +
Sbjct  9413  GHMGPCETWCDDNLAQQDMNCQVTYNPASGSGAAPVPIDTSKCASAKRLTFYWIAMHGAQ  9592

Query  127   GAYSWQVYKNCVALS  141
                 WQVY NC+ ++
Sbjct  9593  ----WQVYINCININ  9625

>PHKE:scaffold_1151 scf_22126_1151.1_contig_1 dna:supercontig 
supercontig:PhyKer238_432v1:scf_22126_1151.1_contig_1:1:3259:1 
REF
Length=3259

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 17/130 (13%)
 Frame = -3

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDGP  77
            W  ++G +SL+  +   + Y      + +CG T      + IPS+  +   T G +  GP
Sbjct  908  WFTKNGISSLKEYI---TTYGTN---ISECGNTLKDGTAEAIPSDGYAEHDTLGNSHPGP  747

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W DDT+V    NC T+F  GQ      ID S C  S    +YWL +     A  WQV
Sbjct  746  CEIWCDDTRVFNNTNCVTEF-SGQSPAKIPIDVSTCKASSEFVFYWLALH----AQPWQV  582

Query  134  YKNCVALSKT  143
            Y NCVAL  T
Sbjct  581  YINCVALDGT  552

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 47/98 (48%), Gaps = 11/98 (11%)
 Frame = -1

Query  49    CGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ----H  102
             CG T      QP+PS+   Q  T G +  GPCE+W DDT+V    NC  +F  GQ     
Sbjct  2035  CGSTDMAGTPQPVPSDGYAQHDTLGTSHPGPCEIWCDDTRVFHDTNCAGKF-AGQVPTKI  1859

Query  103   EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              ID S C  S    +YWL +        WQVY NC  L
Sbjct  1858  PIDVSVCQASSEFIFYWLALH----VKPWQVYINCALL  1757

>PHRA:scaffold_52
Length=349176

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 15/120 (13%)
 Frame = -1

Query  24      HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
               + +  L+ ++DD + +        DCG T P    QPIPS+     S   +  GPCE+WL
Sbjct  102747  NNFVDLKTLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWL  102586

Query  83      DDTKVAAGRNCHTQFPHGQHEI------DYSAC-GDSCT-LWWYWLGIKYVEGAYSWQVY  134
               DD KV    +C + + +   +I      DYS C G  C  + +YWL  + V+G   WQ Y
Sbjct  102585  DDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  102406

>PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:pug:scf1117875582029:1:1550222:1 
REF
Length=1550222

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 18/126 (14%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTSGYTLDGP  77
               Y S+RA++D + +++       +CG+TSP  E QP+P        SNS   T  +T  GP
Sbjct  474155  YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  473988

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
               CEVW D+    +  NC T +P    ++  D S C     L +YWL +     + +WQ Y 
Sbjct  473987  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  473820

Query  136     NCVALS  141
                C  L+
Sbjct  473819  ACAPLA  473802

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 18/126 (14%)
 Frame = +2

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTSGYTLDGP  77
               Y S+RA++D + +++       +CG+TSP  E QP+P        SNS   T  +T  GP
Sbjct  464888  YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  465055

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
               CEVW D+    +  NC T +P    ++  D S C     L +YWL +     + +WQ Y 
Sbjct  465056  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  465223

Query  136     NCVALS  141
                C  L+
Sbjct  465224  ACAPLA  465241

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 18/126 (14%)
 Frame = +2

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTSGYTLDGP  77
               Y S+RA++D + +++       +CG+TSP  E QP+P        SNS   T  +T  GP
Sbjct  467468  YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  467635

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
               CEVW D+    +  NC T +P    ++  D S C     L +YWL +     + +WQ Y 
Sbjct  467636  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  467803

Query  136     NCVALS  141
                C  L+
Sbjct  467804  ACAPLA  467821

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 13/135 (10%)
 Frame = -3

Query  10      GVNTSIEA--QSWMQEHGYASLRAMLDDESLY--KVTEEALFDCGLTSPKTETQPIPSNS  65
               G +T+I+A  +++ ++  + +L+ ++ D+ +    + + A   CGLT  KT  QP+P   
Sbjct  614472  GTDTNIKAYVEAFAKQTKWKTLKDLIMDKYVEDGNIPDRA---CGLTD-KTYMQPLPDKY  614305

Query  66      SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYV  125
                   +G    GPCEVW DD +V A  +C T +P      D S C     LW  +LG+   
Sbjct  614304  VVWQAGQH-PGPCEVWCDDVRVFADNDCATNYPGINLPYDRSKCVGKKVLWSMFLGMHVP  614128

Query  126     EGAYSWQVYKNCVAL  140
               +    WQVY  C  +
Sbjct  614127  Q----WQVYMGCTGI  614095

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 14/146 (10%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               +++  +   NT   A ++  +  Y S+RA++D + +++   +    CG+TS     QP+P
Sbjct  503302  MSFTTDPESNTKAFAAAFKAQSTYKSMRALVDAKGVFQPGMDK--QCGVTSATGAKQPLP  503475

Query  63      SN----SSFQTSGYTLD--GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCT  114
               +     +   + G+T    GPCEVW D+T+V    NC   +      +  D S C  +  
Sbjct  503476  AKYVEWAHSSSEGFTPSHQGPCEVWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASM  503655

Query  115     LWWYWLGIKYVEGAYSWQVYKNCVAL  140
               L  YWL +     + +WQ Y NC  L
Sbjct  503656  LKIYWLALH----SSTWQAYINCAPL  503721

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 8/140 (6%)
 Frame = +3

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               +++  +   NT     ++  +  Y S++ M+D  +  K+   A  +CG +      QP+P
Sbjct  472401  MSFSTDPASNTKAYTAAFKAQTKYTSMKQMVD--ATQKLESGASKECGFSLVNGAAQPLP  472574

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWL  120
                   +     + +GPCEVW DD    +  NC   +P    ++ Y  S C  +  L   WL
Sbjct  472575  DQVEWDQLPASHEGPCEVWCDDKLAFSDENCAINYPDSPAKLPYDKSKCTGAKMLTSVWL  472754

Query  121     GIKYVEGAYSWQVYKNCVAL  140
                +       +WQVY NC  L
Sbjct  472755  ALHVP----TWQVYYNCAPL  472802

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 68/146 (47%), Gaps = 15/146 (10%)
 Frame = -1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               +++  +   NT+   ++ +    Y S+R +++D+ ++     A   CG+T    + QP+P
Sbjct  498803  MSFTTDPASNTAAFTKA-LANSSYTSVRELVEDKGVFIT--GATKTCGITEETEDPQPLP  498633

Query  63      SN----SSFQTSGYTLD--GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCT  114
               +     S   T G+T    GPCEVW DD    +  NC   +     ++  D + C  +  
Sbjct  498632  AKYVEWSHSSTEGFTASHQGPCEVWCDDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSL  498453

Query  115     LWWYWLGIKYVEGAYSWQVYKNCVAL  140
               L   WL +     + +WQ+Y NC  L
Sbjct  498452  LKIVWLALH----SSTWQIYINCATL  498387

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 53/122 (43%), Gaps = 8/122 (7%)
 Frame = -2

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEV  80
               ++   Y SL+A+    +  K    A  +CG +      QP+P    +     + +GPCEV
Sbjct  477916  IKSSSYGSLKALA--FATQKTESGATKECGFSKTNGAAQPLPDTVQWDELTSSHEGPCEV  477743

Query  81      WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               W D+T      NC   +P    ++ Y  S C  +  L   WL +       +WQVY NC 
Sbjct  477742  WCDNTMAFHDDNCAKNYPGSPAKLPYDKSKCSGAKMLMSIWLALH----TPTWQVYTNCA  477575

Query  139     AL  140
                +
Sbjct  477574  PI  477569

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 57/133 (43%), Gaps = 11/133 (8%)
 Frame = +2

Query  12      NTSIEAQSWMQEHGYASLR--AMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQT  69
               NT+   +++  +  Y SL+  AM D +   KV   A  +CG +      QP+P    +  
Sbjct  490325  NTNAYLKAFKAQTKYKSLKDLAMSDAQ---KVESGATKECGFSDVNGTPQPLPDTVQWDR  490495

Query  70      SGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEG  127
                  +  GPCEVW DD  V    NC    P     + Y  + C     L  +W+ +     
Sbjct  490496  FDNSHMGPCEVWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHVP--  490669

Query  128     AYSWQVYKNCVAL  140
                 +WQ+Y NC  +
Sbjct  490670  --TWQIYTNCAPI  490702

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 56/128 (44%), Gaps = 13/128 (10%)
 Frame = +1

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
               ++   Y S+R + + + +  VT  A   CG TS     QP+P+     S     G+T   
Sbjct  462103  LKTSSYKSVRDLWNAKGVLGVTG-ATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSH  462279

Query  76      -GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                GPCEVW D+       NC   +P    ++  D++ C     L  YWL +   +    WQ
Sbjct  462280  QGPCEVWCDNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLALHSPQ----WQ  462447

Query  133     VYKNCVAL  140
                Y NC  L
Sbjct  462448  AYINCAPL  462471

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 47/101 (47%), Gaps = 12/101 (12%)
 Frame = +2

Query  48      DCGLTSPKTETQPIPSN----SSFQTSGYTLD--GPCEVWLDDTKVAAGRNCHTQFPHGQ  101
               +CG+T+     QP+P      S     G+T    GPCEVW D+T V +  NC   +P   
Sbjct  487775  ECGITTSTGTKQPLPDKFVEWSHGSGEGFTPSHQGPCEVWCDNTLVFSDDNCAKNYPAAP  487954

Query  102     HEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                ++ Y  S C     L   WL +     + +WQ Y +C AL
Sbjct  487955  AQLPYEKSKCVGKSVLKTVWLALH----SPTWQAYISCAAL  488065

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 62/147 (42%), Gaps = 22/147 (15%)
 Frame = +2

Query  8       EQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
               E  VN+ +    +  +  Y ++R M+  E   KV   A  DCG T        I  +S +
Sbjct  494690  EGNVNSFV--AHFKNDTRYKNIRDMIVKEQ--KVISGASEDCGYTDITKSKHKINGSSVY  494857

Query  68      -------QTSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPH-----GQHEIDYSACGDSC  113
                         G+  + +GPCEVW DD  V    NC   +P+      +  ID + C  + 
Sbjct  494858  WGRNDAANREGFVDSHEGPCEVWCDDNMVQTNMNCVRAYPNKPGHAAEVPIDVAKCAGAK  495037

Query  114     TLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                L +YW+ +   E    WQVY   + L
Sbjct  495038  KLTFYWIAMHGNE----WQVYSKYLQL  495106

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/140 (24%), Positives = 59/140 (42%), Gaps = 8/140 (6%)
 Frame = +1

Query  3       LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
               +++  +   NT     ++  +  Y SL+ ++   +   V      +CG +      QP+P
Sbjct  470437  MSFGTDPTSNTKAFTAAFKAQTKYKSLKDLV--FATQTVESGTTKECGFSLVSGTPQPLP  470610

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWL  120
                   +     + +GPCE+W D+    +  NC   +P    ++ Y  S C  +  L   WL
Sbjct  470611  DVVEWDELTPSHEGPCEIWCDNKLAFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWL  470790

Query  121     GIKYVEGAYSWQVYKNCVAL  140
                +       +WQVY NC  L
Sbjct  470791  AL----HTPTWQVYTNCAPL  470838

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 53/121 (44%), Gaps = 19/121 (16%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS------NSSFQTSGY--TLDGP  77
               Y+ ++ M+ +     V   A   CG +SP T+ Q + S      N+     G+  + +GP
Sbjct  442310  YSDIKTMILEHQ--TVVSGATASCGFSSPNTK-QTLSSSVWWGKNTDLTGEGFVESHEGP  442140

Query  78      CEVWLDDTKVAAGRNCHTQFPH----GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
               CE W DD  V    NC T +       +  ID S C  +    +YW+ +   E    WQV
Sbjct  442139  CEAWCDDEMVMQNTNCATAYNKAGQAAEVPIDNSKCSGASQFTFYWIAMHTNE----WQV  441972

Query  134     Y  134
               Y
Sbjct  441971  Y  441969

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 61/144 (42%), Gaps = 16/144 (11%)
 Frame = +3

Query  2       ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
                 A+     +N     +++  +  + +LRA+++ E+   V   A   CG T P   +  +
Sbjct  496902  GFAFNTAPSINMENFVKNFKNDAKHPNLRALVEKEAKV-VATGADAQCGWTDPSKTSYTL  497078

Query  62      PSNS-----SFQTSG--YTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACG  110
                +++     +F+ +G  +   GPCE W DD  V    +C   +          ID + C 
Sbjct  497079  TNSTITYGRNFEGTGEGFVHPGPCETWCDDVMVQQDMHCDETYNKPNKAAVIPIDVAKCK  497258

Query  111     DSCTLWWYWLGIKYVEGAYSWQVY  134
                +  L  YW+ +   E    WQVY
Sbjct  497259  GAKQLTTYWIAMHGNE----WQVY  497318

>PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_323, whole genome shotgun sequence
Length=2746546

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 63/122 (52%), Gaps = 12/122 (10%)
 Frame = +2

Query  26       YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
                Y+S++  +++     VT  A  +CGLT+P +  QP+P+    +   T G+T   +GPCE 
Sbjct  2022791  YSSIKDFINNFGKI-VTHGANLECGLTNPNSTPQPLPNEIQWTHSDTEGFTPSHEGPCEA  2022967

Query  81       WLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
                W D T+V    NC   FP     +  D + C  +  L +YWL +     + +WQ+Y NC 
Sbjct  2022968  WCDYTRVFHDGNCAAHFPTAPARLPFDRTGCLGANRLTFYWLALH----SPTWQIYVNCA  2023135

Query  139      AL  140
                 L
Sbjct  2023136  PL  2023141

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 6/68 (9%)
 Frame = +1

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCEVW DD       NC   +P     + Y  S C  +  L  YW+ +        WQV
Sbjct  373900  GPCEVWCDDILAFTNWNCAVDYPQTPANLPYDKSKCQGASVLSSYWIALHTTP----WQV  374067

Query  134     YKNCVALS  141
               Y NC  L+
Sbjct  374068  YTNCAPLT  374091

>PYVX:scaffold_2510 pve_scaffold_2510 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_2510:1:1138:1 
REF
Length=1138

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 65/135 (48%), Gaps = 35/135 (26%)
 Frame = -3

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS-------------FQTSG  71
            GY SLRAM+D         E++ DCG T  +T+  P+                  F +S 
Sbjct  740  GYTSLRAMID---------ESVSDCGNT--RTDVSPVDMTGKKVLHWQNDQEGVGFVSSH  594

Query  72   YTLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGA  128
            +   GPCEVW+DD  V    +C   +T +P    + D+S C  SCTL +YWL +      
Sbjct  593  H---GPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLRFYWLALH----E  438

Query  129  YSWQVYKNCVALSKT  143
             +WQ+YK C  ++ +
Sbjct  437  PNWQIYKQCAPITNS  393

>PYIR:scaffold_871 pir_scaffold_871 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_871:1:14137:1 
REF
Length=14137

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 14/128 (11%)
 Frame = -3

Query  21     MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
              ++   Y S+RA+++ + ++     A  +CG+TS     QP+P+     S   + G+T   
Sbjct  12776  LKASTYDSVRALVEAKGVF--ISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSH  12603

Query  76     -GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCEVW D+ KV +  NC   +P    E  ID++ C  +  L   WL +     + +WQ
Sbjct  12602  QGPCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH----SSTWQ  12435

Query  133    VYKNCVAL  140
              +Y NC  L
Sbjct  12434  IYINCAPL  12411

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 48/100 (48%), Gaps = 11/100 (11%)
 Frame = +1

Query  48    DCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEVWLDDTKVAAGRNCHTQFPHGQH  102
             DCGLT+P    QP+P+    S     G+T   +GPCEVW D+    +  NC   FP    
Sbjct  2707  DCGLTTPTGAKQPLPAQVEWSHGSGEGFTPSHEGPCEVWCDNVLAFSDGNCAKNFPSAPA  2886

Query  103   EIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             ++ Y  S C     L   WL +     + +WQ Y NC A+
Sbjct  2887  KLPYDKSKCVGKSVLKTIWLALH----SPTWQAYINCAAI  2994

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (44%), Gaps = 22/141 (16%)
 Frame = +1

Query  8     EQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
             E  VN+ +E   +  +  + S+R M+  +   KV   A  DCG T        I  +S F
Sbjct  8368  EGNVNSFVE--HFKNDTRFTSVRDMI--QKHQKVIAGASEDCGYTDITKTKHTIKGSSVF  8535

Query  68    -------QTSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPH-----GQHEIDYSACGDSC  113
                       G+  + +GPCEVW DD  V    NC   +P+      +  I+ + C ++ 
Sbjct  8536  WGRNDAANREGFVDSHEGPCEVWCDDNMVQQNMNCVRAYPNKPGNAAEVPIEVAKCANAK  8715

Query  114   TLWWYWLGIKYVEGAYSWQVY  134
              L +YW+ +   E    WQVY
Sbjct  8716  KLTFYWVAMHGNE----WQVY  8766

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 15/100 (15%)
 Frame = +2

Query  49     CGLTSPKTETQPIPSNS-----SFQTSG--YTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ  101
              CG T P   ++P+  +S     +F+ +G  +   GPCE W DD  V     C   +    
Sbjct  11036  CGWTDPSKTSEPLEGSSIIYGRNFEGTGEGFVHPGPCETWCDDKMVQQDMTCDITYNVKD  11215

Query  102    HE----IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
                    ID + C  +  L  YW+ +   E    WQ+Y+ C
Sbjct  11216  KAAIIPIDAAKCKGAKQLSTYWIAMHGNE----WQIYRTC  11323

 Score = 37.4 bits (85),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 28/67 (42%), Gaps = 6/67 (9%)
 Frame = +1

Query  76    GPCEVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCEVW DD       NC  H        + D S C     L  +W+ +       +WQ+
Sbjct  6448  GPCEVWCDDVMAFQDDNCSVHMTTAPAVLKYDKSKCVGKKMLTSFWIALHV----PTWQI  6615

Query  134   YKNCVAL  140
             Y NC  +
Sbjct  6616  YTNCAPI  6636

>SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM15154v2:supercont2.19:1:569072:1 
REF
Length=569072

 Score = 66.2 bits (160),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 64/135 (47%), Gaps = 30/135 (22%)
 Frame = +3

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQT  69
               N + +AQS      Y +LRA+LD             DCG T      + IPSN   +FQ 
Sbjct  464598  NKAFKAQS-----KYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQN  464735

Query  70      S----GYTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYW  119
                    G+ L   GPCEVWLD+ +V    +C T F   P     +DYS+CG   C L +YW
Sbjct  464736  PDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYW  464915

Query  120     LGIKYVEGAYSWQVY  134
               + +     +  WQVY
Sbjct  464916  IALH----SPRWQVY  464948

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 59/135 (44%), Gaps = 30/135 (22%)
 Frame = +1

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
               N + +AQS      + +LR MLD             DCG T      + IP N       
Sbjct  448519  NKAFKAQS-----QFKTLRDMLDPHGP---------DCGFTLTNVARKAIPGNGQMTWKN  448656

Query  69      ---TSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPHGQH---EIDYSAC-GDSCTLWWYW  119
                    G+  +  GPCE+W+D+ +V    +C T FP        +DYS C GD C L +YW
Sbjct  448657  PDTGEGFIPSHKGPCEIWIDNERVFQNDDCATSFPQSPEVNLPVDYSKCRGDGCMLRFYW  448836

Query  120     LGIKYVEGAYSWQVY  134
               + +   +    WQVY
Sbjct  448837  IALHEPQ----WQVY  448869

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 46/149 (31%), Positives = 68/149 (46%), Gaps = 34/149 (23%)
 Frame = +3

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQT  69
               N + +AQ+      + +LR MLD +           DCG T      + IP+N   ++Q 
Sbjct  459291  NKAFKAQT-----QFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQN  459428

Query  70      ----SGY--TLDGPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYW  119
                    G+  +  GPCEVW+D+ +V    +C T F   P     +DYS+CG + C L +YW
Sbjct  459429  PDTGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYW  459608

Query  120     LGIKYVEGAYSWQVYKN----CVALSKTA  144
               L +        WQVY      CV +   A
Sbjct  459609  LALH----EPMWQVYSTFSMLCVCMEANA  459683

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 68/145 (47%), Gaps = 25/145 (17%)
 Frame = +3

Query  11      VNTSIEAQSWMQEHGYASLRAMLDDE------SLYKVTEEALFDCGLTS---PKTETQPI  61
               VN +   +++  +  + +LR MLD        +L  V ++A+   G  +   P T    I
Sbjct  457455  VNVANFNKAFKAQSQFKTLRDMLDPHGPDCGYTLTNVAKKAIPSDGKMTWQNPDTGEGFI  457634

Query  62      PS----NSSFQTSGYTLD----GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSAC-  109
               PS    N   +   Y+      GPCEVWLD+ +V    +C T F   P     +DYS+C 
Sbjct  457635  PSHTVPNYIHERIAYSSSTHW*GPCEVWLDNKRVFQNDDCPTNFADKPAAHLPVDYSSCT  457814

Query  110     GDSCTLWWYWLGIKYVEGAYSWQVY  134
               GD C L +YW+ +   E    WQVY
Sbjct  457815  GDGCMLRFYWIALHQPE----WQVY  457877

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 8/68 (12%)
 Frame = -1

Query  76      GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSW  131
               GPCEVW+DD +V    +C T F   P     IDYS+C GD C L +YWL +        W
Sbjct  450884  GPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLALH----EPMW  450717

Query  132     QVYKNCVA  139
               QVY  C +
Sbjct  450716  QVYSTCAS  450693

>SADI:scaffold_264 supercont1.264 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.264:1:6072:1 
REF
Length=6072

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/146 (35%), Positives = 67/146 (46%), Gaps = 30/146 (21%)
 Frame = +1

Query  12    NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQT  69
             N + +AQS      Y +LRAMLD             DCG T      + IPSN   +FQ 
Sbjct  1537  NKAFKAQS-----KYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQN  1674

Query  70    ----SGY--TLDGPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACG-DSCTLWWYW  119
                  G+  +  GPCEVWLD+ +V    +C T FP        +DYS+CG   C L +YW
Sbjct  1675  PDTGEGFIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYW  1854

Query  120   LGIKYVEGAYSWQVYKNCVALSKTAT  145
             + +     +  WQVY     L  T T
Sbjct  1855  IALH----SPRWQVYSTSHDLIWTGT  1920

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 70/150 (47%), Gaps = 29/150 (19%)
 Frame = -3

Query  10   GVNTSIEAQSWMQEHGYASLRAMLDDE------SLYKVTEEALFDCGLTS---PKTETQP  60
              N + +AQS      + +LR MLD +      +L    ++++   G  +   P T    
Sbjct  538  NFNKAFKAQS-----QFKTLRDMLDPQGPDCGNTLTTGAKKSIPSDGTMTWQNPDTGEGF  374

Query  61   IPSNSSFQTSGYTLD-------GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSAC-  109
            +PS++ ++   +  D       GPCEVWLDD +V    +C T F   P     IDYS+C 
Sbjct  373  VPSHTVYKECPWFDDAHDLSY*GPCEVWLDDKRVFQNDDCATNFPAKPAAHLPIDYSSCS  194

Query  110  GDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
            GD C L +YWL +        WQVY  C +
Sbjct  193  GDGCMLRFYWLALH----EPMWQVYSTCAS  116

>PHRA:scaffold_313
Length=18787

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = -2

Query  49     CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
              CG T    + QP+P+N           GYT  GPCE+++DD  V    NC   +P G ++
Sbjct  14733  CGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPND  14554

Query  104    --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                      +DYS+C   CT   YWLG +  +    WQ Y
Sbjct  14553  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAY  14449

>PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:pug:scf1117875581402:1:979788:1 
REF
Length=979788

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 31/130 (24%)
 Frame = -2

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD---------  75
                Y SLR MLD          A+ DCG T   T+  P+   SS ++  +  D         
Sbjct  159908  SYKSLREMLD---------SAVPDCGFT--LTDGTPV-DVSSLKSMKWQNDQEQKGFIDS  159765

Query  76      --GPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
                 GPCE+W+DDTK+    +C   +T +P  +  +DYS C   C L +YWL +       +
Sbjct  159764  HHGPCELWIDDTKIMHSDDCRADYTAYP-AEIPVDYSVCKGKCQLTFYWLALHEP----N  159600

Query  131     WQVYKNCVAL  140
               WQ+YK CV +
Sbjct  159599  WQIYKQCVPI  159570

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 63/130 (48%), Gaps = 23/130 (18%)
 Frame = -2

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGY------TLDG  76
               GY SL+ M+D         +A+  CG ++P      +   S+  FQ + Y      +  G
Sbjct  153692  GYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHG  153540

Query  77      PCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               PCE W+D+T+V    +C  +FP     I   Y +C  +C L +YWL +     +  WQ Y
Sbjct  153539  PCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH----SPKWQAY  153372

Query  135     KNCVALSKTA  144
               K+CVA+   A
Sbjct  153371  KSCVAIKNNA  153342

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 63/130 (48%), Gaps = 23/130 (18%)
 Frame = -3

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGY------TLDG  76
               GY SL+ M+D         +A+  CG ++P      +   S+  FQ + Y      +  G
Sbjct  150100  GYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHG  149948

Query  77      PCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               PCE W+D+T+V    +C  +FP       + Y +C  +C L +YWL +     +  WQ Y
Sbjct  149947  PCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH----SPKWQAY  149780

Query  135     KNCVALSKTA  144
               K+CVA+   A
Sbjct  149779  KSCVAIKNNA  149750

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 27/132 (20%)
 Frame = -2

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP----SNSSFQTSGY------TL  74
               GY SL+ M+D         +A+  CG +  +T+  P+     S+  FQ + Y      + 
Sbjct  147926  GYKSLKQMMD---------KAVPGCGYS--RTDIAPVDVSRMSSMKFQNNEYKEGFLASH  147780

Query  75      DGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                GPCE W+D+T+V    +C  +FP       + + AC  +C L +YWL +     +  WQ
Sbjct  147779  HGPCEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALH----SPKWQ  147612

Query  133     VYKNCVALSKTA  144
                YK+CV +   A
Sbjct  147611  AYKSCVPIKYNA  147576

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 28/135 (21%)
 Frame = -1

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS----SF  67
               N  +   +W Q  GY SL+ MLD          A  DCGL+ P  +  PI  +S     F
Sbjct  158424  NAKVFTAAWPQT-GYKSLKEMLD---------PAAPDCGLSLP--DVAPIDVSSMTEFKF  158281

Query  68      QTSGY------TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYW  119
               Q + Y      +  GPCE+W+ DT+     +C  +FP     I  D+S C  +C + +YW
Sbjct  158280  QNNEYKEGFIASHRGPCELWIGDTRAWHYDDCAAKFPGYPATIPTDFSVCKGTCRVTFYW  158101

Query  120     LGIKYVEGAYSWQVY  134
               L +     + +WQ+Y
Sbjct  158100  LALH----SPNWQIY  158068

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 8/67 (12%)
 Frame = -1

Query  76      GPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCE+WL++T+V    +C   +T +P     ++YS C  +C L +YWL +       +WQ
Sbjct  164184  GPCEIWLNNTRVLHNDDCVATYTTYP-AVLPVNYSVCKGNCILTFYWLALH----EPNWQ  164020

Query  133     VYKNCVA  139
               +Y  C A
Sbjct  164019  IYSACFA  163999

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -1

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
               GPCEVW+D+T      +C   FP G  ++DYS+C   C L +YWL
Sbjct  139998  GPCEVWIDNTLRFQREDCSKVFP-GAIKMDYSSCQGDCVLRFYWL  139867

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 9/70 (13%)
 Frame = -2

Query  76      GPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
               GPCEVW+D+T+V    +C   +  +P     I+Y+AC  S CTL +YWL +       +W
Sbjct  162095  GPCEVWIDNTRVFHHNDCVAAYKTYP-AVLPINYAACKTSKCTLTFYWLALH----EPNW  161931

Query  132     QVYKNCVALS  141
               Q+Y   + LS
Sbjct  161930  QIYSKFLLLS  161901

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 33/62 (53%), Gaps = 8/62 (13%)
 Frame = -1

Query  76      GPCEVWLDDTKVAAGRNCH---TQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCE+W++DTK     +C    T++P     +DYS C   C L +Y + +   +    WQ
Sbjct  178404  GPCEIWINDTKAFQTNDCRGYTTEYP-AVFPVDYSVCKGDCVLTFYLVAVHEPQ----WQ  178240

Query  133     VY  134
               +Y
Sbjct  178239  IY  178234

 Score = 32.3 bits (72),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  7       QEQGVNTSIEAQSWMQEHGYASLRAMLDDE  36
               Q QG NTSIEAQ   QEHG +   + ++DE
Sbjct  801264  QTQGENTSIEAQEDEQEHGASRHSSGVNDE  801353

>PHRA:scaffold_28
Length=530368

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (45%), Gaps = 17/109 (16%)
 Frame = +1

Query  49     CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
              CG T    + QP+P+N           GYT  GPCE+++DD  V    NC   +P G ++
Sbjct  77527  CGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPND  77706

Query  104    --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                      +DYS+C   CT   YWLG +  +    WQ Y   +    T 
Sbjct  77707  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYSTSMCFHFTV  77841

>PYVX:scaffold_385 pve_scaffold_385 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_385:1:26997:1 
REF
Length=26997

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 63/127 (50%), Gaps = 15/127 (12%)
 Frame = -3

Query  26     YASLRAMLDDESLYKVTEEAL-FDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPC  78
              Y SLR  ++D  L +V E      CG T+P    Q +P      +   T G+T   +GPC
Sbjct  26080  YTSLREFVED--LGQVVESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGFTSSHEGPC  25907

Query  79     EVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
              EVW D+T+V    +C   +     ++  D  AC  S  L +YWL +     + +WQVY N
Sbjct  25906  EVWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLALH----SSTWQVYIN  25739

Query  137    CVALSKT  143
              C AL +T
Sbjct  25738  CAALEET  25718

>APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.11:1:1510989:1 
REF
Length=1510989

 Score = 61.2 bits (147),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 7/66 (11%)
 Frame = +3

Query  76      GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCE+WLD+T+V    NC   FP     Q  +D+S+C  SCT+ +YWL +        WQ
Sbjct  823092  GPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH----EDLWQ  823259

Query  133     VYKNCV  138
               VY  C+
Sbjct  823260  VYSTCL  823277

 Score = 27.7 bits (60),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (48%), Gaps = 9/40 (23%)
 Frame = +2

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN  64
               G+ +LRAMLD             DCG T      +PIP++
Sbjct  822893  GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTD  822985

>PYAP:scaffold_583 pag1_scaffold_583 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_583:1:20637:1 
REF
Length=20637

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 68/140 (49%), Gaps = 29/140 (21%)
 Frame = +2

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP----SNSSFQT----SGY  72
              +  G++SLRA+LD          A   CG  + +T+  P+     S   FQ      G+
Sbjct  6344  FRAGGFSSLRALLD---------PAAPGCG--NSRTDVAPVDVSGLSVMQFQNDEEGKGF  6490

Query  73    TLD--GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSAC--GDSCTLWWYWLGIKYVE  126
                  GPCE W+D+T+V  G +C  QF        I+Y+AC  G +C L +YWL +    
Sbjct  6491  ITSHHGPCEAWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLALHEA-  6667

Query  127   GAYSWQVYKNCVALSKTATA  146
                +WQVYK CV + +  +A
Sbjct  6668  ---NWQVYKQCVPIKRGGSA  6718

>PLHA:NW_020189511.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2604, whole genome shotgun sequence
Length=604050

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (48%), Gaps = 15/128 (12%)
 Frame = -1

Query  23      EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVW  81
               ++ Y ++R ++D    +        DCG T PK +    PS+ +   S G    GPCE+W
Sbjct  431325  KNNYKNVRTLMDGNPAFGE------DCGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELW  431164

Query  82      LDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDSCTLW-WYWLGIKYVEGAYSWQV  133
                +D  +    +C + +  G  +       + YS C     L  +YWL ++ ++G   WQ 
Sbjct  431163  CNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQA  430984

Query  134     YKNCVALS  141
               YKNC+ L+
Sbjct  430983  YKNCIPLT  430960

>APIN:scaffold_9 supercont1.9 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.9:1:1715687:1 
REF
Length=1715687

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 16/126 (13%)
 Frame = -1

Query  21      MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ----TSGY--TL  74
                ++  + SL+A++  +           +CG+T      QP+P +   +      GY  + 
Sbjct  911126  FKKSSFTSLKALVHSQ------PTTCGECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSH  910965

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               +GPCEVW D T+V +  NC    P+G   I+ +AC  +  L + WL +       SWQVY
Sbjct  910964  EGPCEVWCDATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAMH----TSSWQVY  910797

Query  135     KNCVAL  140
                NCV L
Sbjct  910796  INCVPL  910779

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 18/121 (15%)
 Frame = -1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ----TSGY--TLDGPCE  79
               Y SL+   D         +   +CG+T    + Q +P+N   Q      G+  + +GPCE
Sbjct  922013  YTSLKQFFDKN-------DNCGECGITK-FGDAQKLPANGVVQWRNGGEGFVSSHEGPCE  921858

Query  80      VWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
               +W D+T V    NC    P G  +ID + C  S      W+ +  V+    WQVYKNCVA
Sbjct  921857  LWCDNTLVFQNDNCARNLPSGDMQIDVAKCAGSKKFIALWIALHSVD----WQVYKNCVA  921690

Query  140     L  140
               L
Sbjct  921689  L  921687

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +1

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               +GPCEVW D T+V    NC      G  +ID + C  +  L  YWL +       +WQ+Y
Sbjct  911995  EGPCEVWCDATRVFYNDNCARNVASGILKIDVAKCQGARQLVMYWLALHVP----TWQIY  912162

Query  135     KNCVALSKTA  144
                NCV L   A
Sbjct  912163  VNCVTLGGAA  912192

>PYAR:scaffold_370 par_scaffold_370 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_370:1:20005:1 
REF
Length=20005

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 5/115 (4%)
 Frame = +3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDT  85
              Y +L+ ++  E       ++   CGLT+ K E +     ++ + SG+T  GPCEVW D+T
Sbjct  17550  YKTLKDLIMGEQTVLTEYKSDAQCGLTT-KDEAKRATLPATLKYSGFTHAGPCEVWCDNT  17726

Query  86     KVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              K+A   +C   +  G   ID S C  +  L  YW+ +     +  WQVY +CV L
Sbjct  17727  KLAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAVH----SEPWQVYTDCVYL  17879

>PYAP:scaffold_558 pag1_scaffold_558 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_558:1:21510:1 
REF
Length=21510

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 68/146 (47%), Gaps = 22/146 (15%)
 Frame = +1

Query  5      YLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN  64
              Y  +   N     +++  +  + +L+ M        V ++    CG +S K + Q +   
Sbjct  19414  YNNDPTSNVKAFTEAFKSQKTFKTLKDM--------VEKQLKGSCGKSSGKGKPQSVEGL  19569

Query  65     SSF------QTSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCT  114
              S        + +G+  +  GPCE+W+DDT+V    NC  +F     +  ++YS C   C 
Sbjct  19570  SDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECM  19749

Query  115    LWWYWLGIKYVEGAYSWQVYKNCVAL  140
              L +YWL +   E    WQVYKNCV +
Sbjct  19750  LRFYWLALHEPE----WQVYKNCVPI  19815

>PHSO:scaffold_3
Length=10773376

 Score = 63.5 bits (153),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 68/140 (49%), Gaps = 26/140 (19%)
 Frame = -1

Query  12       NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF----  67
                NT++  +S+     + +LRAM+D          A  DCG T+       + S SS     
Sbjct  6425893  NTAMFTKSFPNSQ-FKTLRAMMD---------TAASDCGNTALTGSPVDVSSLSSMKWQN  6425744

Query  68       --QTSGY--TLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWL  120
                  +  G+  +  GPCE W+DDT+V    +C   +T +P  +  IDYSAC   CT  +YWL
Sbjct  6425743  DQEQMGFIDSHHGPCEAWIDDTRVFHSDDCRAAYTSYP-AEIPIDYSACSGDCTFTFYWL  6425567

Query  121      GIKYVEGAYSWQVYKNCVAL  140
                 +       +WQVYK C  +
Sbjct  6425566  ALHEP----NWQVYKQCAPI  6425519

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 6/69 (9%)
 Frame = -2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
                GPCE W+DD K+    NC  +F     ++  DYS+C   C L +YWL +       +WQ+
Sbjct  6431172  GPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP----NWQI  6431005

Query  134      YKNCVALSK  142
                YK CV ++ 
Sbjct  6431004  YKQCVPITN  6430978

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 6/69 (9%)
 Frame = -1

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
                GPCE W+DD K+    NC  +F     ++  DYS+C   C L +YWL +       +WQ+
Sbjct  6433567  GPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP----NWQI  6433400

Query  134      YKNCVALSK  142
                YK CV ++ 
Sbjct  6433399  YKQCVPITN  6433373

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 7/62 (11%)
 Frame = -2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQ  132
                GPCE W+DDTKV    +C  +FP    +  +DYSAC GD C   +YWL +   E    WQ
Sbjct  6429465  GPCEGWIDDTKVFHYDDCVAKFPSYPAKIPVDYSACKGDKCLFVFYWLAVHSPE----WQ  6429298

Query  133      VY  134
                +Y
Sbjct  6429297  IY  6429292

 Score = 46.2 bits (108),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 28/53 (53%), Gaps = 2/53 (4%)
 Frame = +2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVE  126
                GPCE+WLD+  V    NC   FP       +DYS+C   C L +Y L +  V+
Sbjct  6436028  GPCELWLDEVVVFQSNNCAVAFPTSPAVCAVDYSSCSGFCVLRFYALALTGVQ  6436186

 Score = 25.8 bits (55),  Expect(2) = 1.7, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = -1

Query  73        TLDGPCEVWLDDTKVAAGRN  92
                 TLD PC   LD+ + A+ R+
Sbjct  10671109  TLDDPCATKLDEMRTASARD  10671050

 Score = 24.6 bits (52),  Expect(2) = 1.7, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -2

Query  97        FPHGQHEIDYSACGDS  112
                 FPHG H ++ +A GD+
Sbjct  10671036  FPHGAHLVEENAVGDA  10670989

>PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:pug:scf1117875582007:1:931704:1 
REF
Length=931704

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
 Frame = -3

Query  32      MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGR  91
               +L ++ +Y  + +    CGLT  K E +     S  + SG++  GPCE+W D+ K+A   
Sbjct  551143  ILKNQKMYDASTDP--QCGLTI-KDEAKRATMPSEVKFSGFSHPGPCELWCDNNKLAFAN  550973

Query  92      NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               +C   +P G   +D S C  +     +W+G+     +  WQVY +CV L
Sbjct  550972  DCAATYPTGVVPVDASKCAGADRFRIFWIGVH----SAPWQVYTDCVYL  550838

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 7/120 (6%)
 Frame = -3

Query  23      EHGYASLRAM-LDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVW  81
               + GY +L+ + L ++ +Y+ T +    CG T      +     +    SG+T  GPCE+W
Sbjct  549886  DSGYTTLKDLILANQDMYEDTIDK--QCGYTILDEAKRADMPATEITFSGFTHPGPCELW  549713

Query  82      LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                DD K+A   +C T +  G+  +D S C  +     +WL +     +  WQVY NCV L+
Sbjct  549712  CDDNKLAFDYDCQTTYASGKVPVDASKCSGANRFRIFWLALH----SAPWQVYTNCVYLT  549545

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 13/120 (11%)
 Frame = -2

Query  21      MQEHGYASLRAMLDDESLYKVT--EEALFDCGLTS-PKTETQPIPSNSSF---QTSGYTL  74
                 E G ASL+ ++ +  +   +  +EA   CG T   + +   +P+   F      G+T 
Sbjct  552845  FPESGVASLKDLILENQVMWTSGLDEA---CGYTKLDEAKRSELPTEMKFGNGDVGGFTH  552675

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                GPCE+W DDTK++   +C  ++P G   ID S C ++     YWL +     A  WQVY
Sbjct  552674  PGPCELWCDDTKLSYDNDCAAKYPSGLVPIDTSKCANANQFTVYWLAVH----ASMWQVY  552507

>PYIR:scaffold_2066 pir_scaffold_2066 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2066:1:3915:1 
REF
Length=3915

 Score = 63.2 bits (152),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 4/80 (5%)
 Frame = +3

Query  61    IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
             +P++     SG+T  GPCE+W DD K+A   +C T++P  +   D + C  +     YW+
Sbjct  1089  MPASGKISFSGFTHPGPCELWCDDNKLAFANDCATEYPDNKVPFDAAKCAGANRFTLYWI  1268

Query  121   GIKYVEGAYSWQVYKNCVAL  140
              +        WQVY NCV L
Sbjct  1269  AVH----GTPWQVYTNCVYL  1316

>PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_499.1_contig_1:1:23234:1 
REF
Length=23234

 Score = 63.2 bits (152),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 6/69 (9%)
 Frame = -3

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCE W+DDT+V    +C   +P+   E  IDYS+C   CT  +YW+ +       +WQV
Sbjct  9288  GPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMALHEP----NWQV  9121

Query  134   YKNCVALSK  142
             YK C  ++ 
Sbjct  9120  YKQCAPITN  9094

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 6/70 (9%)
 Frame = -2

Query  75     DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              +GPCE W+DD  V    NC  QF     +I  DYS+C   C   +YWL +   E    WQ
Sbjct  14296  EGPCEGWIDDIMVFHHDNCAAQFKSYPAKIPTDYSSCKGDCLFVFYWLALHQAE----WQ  14129

Query  133    VYKNCVALSK  142
              +YK CV ++ 
Sbjct  14128  IYKQCVPITN  14099

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 11/72 (15%)
 Frame = +3

Query  76     GPCEVWLD-----DTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGA  128
              GPCE W+D      T+V    +C   +P    +  ID+S C   CT  +YWL +      
Sbjct  11256  GPCEAWIDGSDGSSTRVFQSDDCRRDYPGYPAEIPIDFSTCNGDCTFTFYWLALH----E  11423

Query  129    YSWQVYKNCVAL  140
               +WQVYK C  +
Sbjct  11424  PNWQVYKQCAPI  11459

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 6/69 (9%)
 Frame = -1

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              GPCE W+D   V    +C  +FP    +I  DYS+C   C   +YWL +   +    WQ+
Sbjct  12578  GPCEGWIDGKMVFHYDDCVAKFPSYPAKIPTDYSSCKGDCLFVFYWLALHQAD----WQI  12411

Query  134    YKNCVALSK  142
              YK CV ++ 
Sbjct  12410  YKQCVPITN  12384

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 6/69 (9%)
 Frame = +2

Query  73     TLDGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
              T+ GPCE+WL++  V   +NC   FP       +DYS+C   C L +Y L +  VE    
Sbjct  15569  TV*GPCELWLNELMVFKAKNCAVAFPTSPAMCAVDYSSCSGYCLLRFYALALTGVE----  15736

Query  131    WQVYKNCVA  139
              WQ +   +A
Sbjct  15737  WQAFSTSLA  15763

>PYIR:scaffold_998 pir_scaffold_998 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_998:1:11681:1 
REF
Length=11681

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 61/122 (50%), Gaps = 8/122 (7%)
 Frame = -1

Query  21     MQEHGYASLR-AMLDDESLYKVTEEALFDCGLTS-PKTETQPIPSNSSFQTSGYTLDGPC  78
                + G  +LR  ++ ++ ++  T +    CG T   + +   +P++     SG+T  GPC
Sbjct  10232  FPDSGVTTLRDLIMKNQKMWAPTVDP--KCGYTILDEAKRTTMPASGKITFSGFTHPGPC  10059

Query  79     EVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              E+W D+ K+A   +C   +P  +   D + C ++     YW+G++       WQVY NCV
Sbjct  10058  ELWCDNNKLAFANDCAATYPDAKVPFDAAKCANANQFTIYWIGVQ----GTPWQVYTNCV  9891

Query  139    AL  140
               L
Sbjct  9890   YL  9885

>PYAR:scaffold_1918 par_scaffold_1918 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1918:1:6575:1 
REF
Length=6575

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 9/72 (13%)
 Frame = +1

Query  76   GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSAC--GDSCTLWWYWLGIKYVEGAYS  130
            GPCEVW+D T+V  G +C  QF      +  +DYS C  G +CTL +YWL +       +
Sbjct  739  GPCEVWIDSTRVFRGSDCVEQFRGAMPARFPVDYSVCPSGQTCTLMFYWLPLHEA----A  906

Query  131  WQVYKNCVALSK  142
            WQVYK CV +++
Sbjct  907  WQVYKQCVPITR  942

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 9/63 (14%)
 Frame = +3

Query  85    TKVAAGRNCHTQFPHGQH---EIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
             T+V  G +C  QF   +     +DYS C  G +CTL +YWL +       +WQVYK CV 
Sbjct  1938  TRVFHGDDCAAQFRGAKPASIPVDYSVCQSGQTCTLTFYWLALH----EPNWQVYKQCVP  2105

Query  140   LSK  142
             +++
Sbjct  2106  ITR  2114

>PHRA:scaffold_123
Length=117378

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 60/135 (44%), Gaps = 40/135 (30%)
 Frame = +2

Query  25     GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL----------  74
              GY+SLR MLD         + + DC  T  +T+  P+        SG T+          
Sbjct  24674  GYSSLRDMLD---------QQVTDCANT--RTDVSPV------DVSGLTVLNWQNDQEQK  24802

Query  75     ------DGPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYV  125
                     GPCEVW+DDTKV    +C   +  G       D+S C   CTL +YWL +   
Sbjct  24803  GFIDSHHGPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLALH--  24976

Query  126    EGAYSWQVYKNCVAL  140
                  +WQVYK CV +
Sbjct  24977  --EPNWQVYKQCVPV  25015

>PHRA:scaffold_37
Length=441994

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 17/99 (17%)
 Frame = +2

Query  49      CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
               CG T      QPIPS+   +       G+T  GPCE++LDDT V    NC   +P G   
Sbjct  285308  CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  285487

Query  101     -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +DYS+C   CTL  YWL  +  +    WQ Y
Sbjct  285488  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAY  285592

>HYAP:scaffold_8 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8:1:893728:1 
REF
Length=893728

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 9/117 (8%)
 Frame = +2

Query  25      GYASLRA-MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLD  83
               GY SL A +L+++ L+    +   +CGLT  K   +     S    +G+T  GPCEVW D
Sbjct  537677  GYKSLGAFILENQELF--LPKVDLNCGLTVYKDSARSELPASELTYTGFTHPGPCEVWCD  537850

Query  84      DTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               DTKV    +C T +P     + Y  S C  +  +  YWLG+        WQVY +C+
Sbjct  537851  DTKVLFDSDCQTTYPGKPATMPYDKSKCAGANRMTIYWLGVH----GDPWQVYIDCM  538009

 Score = 54.7 bits (130),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 9/117 (8%)
 Frame = +2

Query  25      GYASLRA-MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLD  83
               GY SL A +++++ ++    +   DCGLT  K   +     S    + +T  GPCEVW D
Sbjct  522125  GYKSLGAFIIENQEIHLPNVDP--DCGLTVYKDSARSELPASELTYTSFTHPGPCEVWCD  522298

Query  84      DTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
               DTKV    +C T++P+    + Y  S C  +  +  Y + +     A  WQ Y NC+
Sbjct  522299  DTKVLFDSDCQTKYPNKPATMPYVKSKCAGANRMTIYRVAVH----ADPWQSYINCM  522457

>PHSO:scaffold_8
Length=3549547

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 9/121 (7%)
 Frame = +3

Query  21       MQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
                  + G  SL A +  ++ LY  + +   +CGLT+ K   +    +S  + +G+T  GPCE
Sbjct  1240605  FPKKGGGSLGAFIAKNQKLYSSSVDP--NCGLTTYKESARSKLPSSQIEYTGFTHPGPCE  1240778

Query  80       VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
                VW DDTKV    +C T+F     ++ Y  S C ++  L  YW+ +        WQVY +C
Sbjct  1240779  VWCDDTKVLFDYDCQTKFAGSPAKMAYDESKCANANRLTIYWVAMH----GSPWQVYTDC  1240946

Query  138      V  138
                V
Sbjct  1240947  V  1240949

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 63/133 (47%), Gaps = 10/133 (8%)
 Frame = +2

Query  10       GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
                GVN ++   ++     GY SL   +  ++ L     +A  DCGLT  K   +     S  
Sbjct  1238078  GVNGTLNFFKATFPSKGYDSLGEFIAKNQELVDSKTDA--DCGLTIYKDSARSELPASKL  1238251

Query  68       QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
                  +G+T  GPCEVW DDTKV    +C T++P     + Y  S C  +  L  YWL +   
Sbjct  1238252  THTGFTHTGPCEVWCDDTKVLFDYDCQTKYPAIPATLPYDESKCSGANRLTIYWLALH--  1238425

Query  126      EGAYSWQVYKNCV  138
                     WQVY +CV
Sbjct  1238426  --GDPWQVYTDCV  1238458

 Score = 43.5 bits (101),  Expect(3) = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (45%), Gaps = 3/89 (3%)
 Frame = +3

Query  21       MQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
                    GY SL   ++ ++ LY    +A   CG T      +    +++   +G+T  GPCE
Sbjct  1236255  FNSSGYNSLGQFIETNQVLYSDDIDA--QCGYTVYDASARQTMPSTNLTYTGFTHPGPCE  1236428

Query  80       VWLDDTKVAAGRNCHTQFPHGQHEIDYSA  108
                +W DDTKV    NC    P G    +  A
Sbjct  1236429  IWCDDTKVLFDYNCQASCPRGSRTTNRCA  1236515

 Score = 23.9 bits (50),  Expect(3) = 1e-05, Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 12/23 (52%), Gaps = 0/23 (0%)
 Frame = +2

Query  105      DYSACGDSCTLWWYWLGIKYVEG  127
                D S C D+  L  YWL +  + G
Sbjct  1236500  DESLCTDANRLTIYWLAVHGLRG  1236568

 Score = 20.8 bits (42),  Expect(3) = 1e-05, Method: Compositional matrix adjust.
 Identities = 6/8 (75%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = +1

Query  131      WQVYKNCV  138
                WQVY +CV
Sbjct  1236565  WQVYTDCV  1236588

 Score = 31.2 bits (69),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +1

Query  111      DSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                +SCT +    G    EGA+ +QV  +C + SKTA
Sbjct  3245533  ESCTRYQNTAGKSNFEGAFGYQVRTDCQSASKTA  3245634

>PYAP:scaffold_187 pag1_scaffold_187 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_187:1:47143:1 
REF
Length=47143

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 72/154 (47%), Gaps = 30/154 (19%)
 Frame = +2

Query  3      LAYLQEQGVNTSIEAQSWM-----QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTE  57
              +A  Q +  N S E  + +     ++ G  SLR ++D         + +  CG T+P T 
Sbjct  9968   IAAFQGKPFNRSPEQNTQVFTDAFKQSGLKSLRELMD---------KYVPGCGNTNPNTT  10120

Query  58     TQPIPS--NSSFQTSGY------TLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDY  106
               + +      ++Q + Y      +  GPCEVW+D+T+V    +C   +  +P     +DY
Sbjct  10121  PRDVTKLKTMTYQNNEYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYP-AALPVDY  10297

Query  107    SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              S C  +C L +YWL +     +  WQ YK CV +
Sbjct  10298  SKCKGTCRLTFYWLALH----SQKWQAYKQCVPI  10387

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 69/146 (47%), Gaps = 27/146 (18%)
 Frame = -2

Query  12     NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQT  69
              NT +   ++ Q  G  SLR ++D         + +  CG T+P T  + +      ++Q 
Sbjct  11565  NTQVFTDAFKQS-GLKSLRQLMD---------KYVPGCGNTNPNTTPRDVTKLKTMNWQN  11416

Query  70     SGY------TLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDS-CTLWWYW  119
              + Y      +  GPCEVW+D+T+V    +C   +  +P     +DYS C  S C L +YW
Sbjct  11415  NEYKEGFLASHRGPCEVWIDNTRVFQNNDCAGNYKSYP-ASLPVDYSKCKSSKCMLRFYW  11239

Query  120    LGIKYVEGAYSWQVYKNCVALSKTAT  145
              L +     +  WQ YK CV +   A+
Sbjct  11238  LALH----SEKWQAYKQCVPIKYGAS  11173

 Score = 32.7 bits (73),  Expect = 3.0, Method: Composition-based stats.
 Identities = 21/79 (27%), Positives = 35/79 (44%), Gaps = 18/79 (23%)
 Frame = -3

Query  76    GPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSAC--GDSCTLWWYWLGI--------  122
             GPCE W+D+  +    +C   +  +P  Q  I++  C  G  C L +YW+ +        
Sbjct  7418  GPCETWIDNELLQRRVDCVSTYRTYP-AQIPINFGRCPIGKICVLRFYWIAVDALPFKLM  7242

Query  123   ----KYVEGAYSWQVYKNC  137
                 + V   +S+Q   NC
Sbjct  7241  SEWSRCVRDGFSYQRSVNC  7185

>PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_305:1:30708:1 
REF
Length=30708

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 7/124 (6%)
 Frame = -3

Query  18     QSWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDG  76
              ++   + GYASL  ++   + LY    +A  +CGLT      +     S F  SG+T  G
Sbjct  10582  ETLFPDSGYASLWDLIKAKQVLYSDDIDA--ECGLTIYDDAKRSALPASKFTYSGFTHAG  10409

Query  77     PCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
              PCE W DD KVA   +C + +  G    + + C  +  L  YW+G+        WQVY +
Sbjct  10408  PCEFWCDDNKVAFDNDCQSTYADGTVPFEAAQCEGANRLAVYWIGVH----GDPWQVYSD  10241

Query  137    CVAL  140
              CV L
Sbjct  10240  CVWL  10229

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = -1

Query  21     MQEHGYASL-RAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
                  GY SL + ++ ++ LY  + +A  +CG+T  K   +     ++   SG+T  GPCE
Sbjct  15747  FNSSGYDSLGQFIITNQVLYSSSVDA--ECGMTVYKDSARSALPATNLTYSGFTHPGPCE  15574

Query  80     VWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
              VW DDTK+    NC   ++  P G    D S C  +  L  YWL +     A  WQ Y +
Sbjct  15573  VWCDDTKLLFDYNCQATYSDIPAGV-PYDESKCTGANRLTVYWLALH----AAPWQAYID  15409

Query  137    CV  138
              CV
Sbjct  15408  CV  15403

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 40/90 (44%), Gaps = 4/90 (4%)
 Frame = -1

Query  49     CGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSA  108
              CGLT      +    + +   SG+T  GPCE W DD K+    +C   FP G    D S 
Sbjct  13656  CGLTVYDDSARSTMPSGNLTYSGFTHQGPCEAWCDDNKLFFEYDCSVSFPSGSMAYDSSL  13477

Query  109    CGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              C D+     YWL +        WQ Y +CV
Sbjct  13476  CTDANRFTIYWLALH----GDPWQAYIDCV  13399

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 55/117 (47%), Gaps = 9/117 (8%)
 Frame = -1

Query  21     MQEHGYASLRA-MLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
                E GY +L+  +L ++ L   T +    CG+T      +    +S+F  SG+T  GPCE
Sbjct  12159  FPESGYETLQDFILANQELVDSTIDK--SCGMTIYDDAKRSALPDSAFSYSGFTHAGPCE  11986

Query  80     VWLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               W DD KVA   +C   +P        D + C ++  L  YW+G+        WQVY
Sbjct  11985  FWCDDNKVAFDYDCQATYPDIPASVPFDSAQCANANKLTVYWIGLH----GDPWQVY  11827

>PYIR:scaffold_81 pir_scaffold_81 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_81:1:58218:1 
REF
Length=58218

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 66/157 (42%), Gaps = 39/157 (25%)
 Frame = -3

Query  9     QGVNTSIEAQSW--------------MQEHGYASLRAMLDDESLYKVTEEALFDCG---L  51
             Q VN + + + W               +  GY SL+ +LD          A   CG   L
Sbjct  4960  QSVNPAFQGRKWNGSPEDNTQQFTAGFRAAGYPSLKTLLD---------PAAPGCGNSRL  4808

Query  52    TSPKTETQPIPSNSSFQTSGY------TLDGPCEVWLDDTKVAAGRNCHTQFP--HGQHE  103
               P  +   + S   F+   Y      +  GPCEVW+D+T+     +C   FP       
Sbjct  4807  DVPAVDVSRL-SAMEFRNDEYHEGFVSSHHGPCEVWIDNTRAFHNDDCRALFPGFPASIP  4631

Query  104   IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             +++S C D CTL +YWL +       +WQVYK CV +
Sbjct  4630  VNFSLCKDKCTLTFYWLALH----EPTWQVYKQCVPI  4532

>PYIW:scaffold_1952 piw_scaffold_1952 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1952:1:6546:1 
REF
Length=6546

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (52%), Gaps = 7/110 (6%)
 Frame = -1

Query  32    MLDDESLYKVTEEALFDCGLTS-PKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAG  90
             +L ++ +Y  T +    CG T   + +   +P++     SG++  GPCE+W D+ K+A+ 
Sbjct  4716  ILANQKMYADTIDK--QCGYTILDEAKRATMPASGEITFSGFSHPGPCELWCDNNKLASA  4543

Query  91    RNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +C   +  G+   D + C  +  L  YW+G++       WQVY NCV L
Sbjct  4542  NDCSVTYKSGKVPFDAAKCAGANKLTIYWIGVQ----GTPWQVYTNCVYL  4405

>PYIR:scaffold_1744 pir_scaffold_1744 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1744:1:5237:1 
REF
Length=5237

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 65/129 (50%), Gaps = 14/129 (11%)
 Frame = +1

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
             ++   Y S+R +++ ++ +     A  +CG++S     QP+P+     +   + G+T   
Sbjct  1657  LKSSSYKSVRDLVNAKASF--ISGASKECGISSSSGAKQPLPAQYVEWAHSSSEGFTPSH  1830

Query  75    DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
             +GPCEVW D+    +  NC   +P    ++ Y  S C  +  L +YW+ +     + +WQ
Sbjct  1831  EGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVALH----SSTWQ  1998

Query  133   VYKNCVALS  141
             VY NC  LS
Sbjct  1999  VYINCAPLS  2025

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 31/67 (46%), Gaps = 6/67 (9%)
 Frame = -2

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCEVW DD    +  NC T +P    ++ Y  S C  +  L   WL +       + QV
Sbjct  3151  GPCEVWCDDVLAFSDENCATNYPGNPAKLPYDESKCIGASMLTSIWLALH----VPT*QV  2984

Query  134   YKNCVAL  140
             Y NC  L
Sbjct  2983  YLNCAPL  2963

 Score = 33.5 bits (75),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 6/67 (9%)
 Frame = -1

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCEV  D+    +  NC   +P     + Y  + C     L   W+    V    +WQV
Sbjct  4739  GPCEV*CDNVLAFSDENCVINYPEAPARLPYDMAKCTGVKILKSVWM----VLHLPAWQV  4572

Query  134   YKNCVAL  140
             Y  CV+L
Sbjct  4571  YLYCVSL  4551

>SADI:scaffold_91 supercont1.91 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.91:1:209005:1 
REF
Length=209005

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 30/135 (22%)
 Frame = -1

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQT  69
               N +  AQS      Y +LR +LD             DCG T      +PIPS+   ++Q 
Sbjct  157888  NKAFAAQS-----QYKTLRDLLDLSGP---------DCGNTRTNVAPKPIPSDGMMTWQN  157751

Query  70      ----SGY--TLDGPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYW  119
                    G+  +  GPCE+WLD+ +V    NC T F   P  +  +DY+ CG + C L +YW
Sbjct  157750  PDTGEGFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYW  157571

Query  120     LGIKYVEGAYSWQVY  134
               L +   +    WQVY
Sbjct  157570  LALHQPQ----WQVY  157538

>SAPA:scaffold_32 supercont2.32 dna:supercontig supercontig:ASM15154v2:supercont2.32:1:360474:1 
REF
Length=360474

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 56/121 (46%), Gaps = 25/121 (21%)
 Frame = -2

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ------TSGY--TLDGP  77
               Y +LR +LD             DCG T P    + IPS+            G+  +  GP
Sbjct  116927  YKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEGFIPSHTGP  116775

Query  78      CEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYWLGIKYVEGAYSWQV  133
               CE+WLD T+V    +C T F   P  +  +DY+ CG + C L +YWL +   +    WQV
Sbjct  116774  CEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQPQ----WQV  116607

Query  134     Y  134
               Y
Sbjct  116606  Y  116604

>PLHA:NW_020187410.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_490, whole genome shotgun sequence
Length=4199

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 16/127 (13%)
 Frame = +2

Query  23    EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVW  81
             ++ +  LR++ +   +Y   EE    CG T PK      P++ +   S G    G CE+W
Sbjct  3311  KNNFKDLRSLFEGNPIYG--EE----CGYTDPKGPPADRPNDGAATFSRGILHAGTCEIW  3472

Query  82    LDDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQV  133
              DD  V    +C + +  G  +       +DY  C  + C L +YWL ++ ++    WQV
Sbjct  3473  FDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRIDKTV-WQV  3649

Query  134   YKNCVAL  140
             Y+NC+ L
Sbjct  3650  YRNCIPL  3670

>PLHA:NW_020186941.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_20, whole genome shotgun sequence
Length=72972

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 11/121 (9%)
 Frame = +1

Query  25     GYASLRAMLDDESLYKVTEEALF--DCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEVW  81
               Y SL+A  + + L  + E      +CG + PK + QPIP +     S   +  GPCE+W
Sbjct  55957  AYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  56136

Query  82     LDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQV  133
              LD+ KV    +C+ ++ +   +I      DYS+C  G    + +YWL  + ++G   WQ 
Sbjct  56137  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  56316

Query  134    Y  134
              Y
Sbjct  56317  Y  56319

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 17/131 (13%)
 Frame = +1

Query  14     SIEA-QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
              S++A QS    + +  L+ ++D+  L +       DCG + P  + QPIP +     S  
Sbjct  40630  SVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRA  40788

Query  73     TLD-GPCEVWLDDTKVAAGRNCHTQFPH------GQHEIDYSAC--GDSCTLWWYWLGIK  123
               +  GPCE+WLD+ KV    +C++++ +          +DYS+C  G    + +YWL  +
Sbjct  40789  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  40968

Query  124    YVEGAYSWQVY  134
               + G   WQ Y
Sbjct  40969  GINGKTFWQSY  41001

 Score = 60.1 bits (144),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 11/120 (9%)
 Frame = -2

Query  26     YASLRAMLDDESLYKVTEEALF--DCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
              +  L+A    + L  + + + F   CG + PK + QPIP +     S   +  GPCE+WL
Sbjct  30110  FQKLKAANKFKDLKTLMDTSAFGAKCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWL  29931

Query  83     DDTKVAAGRNCHTQFPH------GQHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
              D+ KV    +C++++ +          +DYS+C  G    + +YWL  + V G   WQ Y
Sbjct  29930  DNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSY  29751

>PYIW:scaffold_2639 piw_scaffold_2639 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2639:1:4508:1 
REF
Length=4508

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/147 (28%), Positives = 65/147 (44%), Gaps = 14/147 (10%)
 Frame = -3

Query  2     ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
              + Y      N  +  +++  ++ Y +LR ++D  +++    +   +CG TS     QP+
Sbjct  2049  GMTYSSNGANNARVYERAFGNQNRYRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPL  1876

Query  62    PS------NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSC  113
             P+      N   Q    T +GPCEVW D        NC   F     ++ Y  S C  + 
Sbjct  1875  PAQYVEWNNRVNQGLAPTHEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAK  1696

Query  114   TLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              L +YWL +   E    W+VY NCV L
Sbjct  1695  MLKFYWLSLDSRE----WEVYINCVPL  1627

 Score = 60.5 bits (145),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (48%), Gaps = 14/123 (11%)
 Frame = -3

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
             Y +LR ++D ++++    +   +CG T+  +  QP+ +      S  T G+T    GPCE
Sbjct  3753  YRNLRDLIDTKAVFSAGTDK--ECGFTNVTSAKQPLSAQYVE*KSSATGGFTPTHQGPCE  3580

Query  80    VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
             +W D   V    NC   +P    ++ Y  S C  +  L +YWL +  ++    W+ Y NC
Sbjct  3579  IWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINC  3412

Query  138   VAL  140
               L
Sbjct  3411  APL  3403

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 14/130 (11%)
 Frame = +2

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL  74
            ++  +  YASL+A++D     K    A  +CG+TS     QP+P+     +     G+T 
Sbjct  257  AFKAQTKYASLKALIDANG--KFISGASKECGVTSATGAKQPLPATYVEWAHSNEEGFTP  430

Query  75   D--GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYS  130
               GPCEVW D     +  NC   +     ++ Y  S C  +  L +YWL +     + +
Sbjct  431  SHQGPCEVWCDGKVAFSNDNCPKNYATAPAKLPYDKSKCTGASMLKFYWLALH----SDT  598

Query  131  WQVYKNCVAL  140
            WQ Y  C  L
Sbjct  599  WQAYIACAPL  628

>SADI:scaffold_22 supercont1.22 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.22:1:763575:1 
REF
Length=763575

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 46/149 (31%), Positives = 65/149 (44%), Gaps = 45/149 (30%)
 Frame = -1

Query  13      TSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ----  68
               T+ +AQS      + +LR ML+ +            CG + P    + IPS+ +      
Sbjct  135084  TAFKAQS-----QFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWLNP  134947

Query  69      ------TSGYTLD-------------GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDY  106
                      S +T+D             GPCEVWLDD +V    +C T FP        +DY
Sbjct  134946  DTGEGFISSHTVDRPL*R*QRLLPA*GPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDY  134767

Query  107     SACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
               S+CG S C L +YWL +   +    WQVY
Sbjct  134766  SSCGGSGCMLRFYWLALHQPQ----WQVY  134692

>PHCA:scaffold_39 PHYCAscaffold_39
Length=591971

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = +3

Query  49      CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
               CG T    + +P+P+N           G+T  GPCE+++DD  V    +C   +P G ++
Sbjct  200088  CGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPND  200267

Query  104     --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                       +DYS+C   CT   YWLG +  +    WQ Y
Sbjct  200268  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAY  200372

>PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_206.1:1:61978:1 
REF
Length=61978

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 67/149 (45%), Gaps = 31/149 (21%)
 Frame = +2

Query  12    NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSG  71
             NT+I   S+    GY+SLR MLD         + + DC  T  +T+  P+   S   T  
Sbjct  3098  NTAIFTSSFANA-GYSSLRDMLD---------QQVTDCANT--RTDVSPVDV-SGLTTMN  3238

Query  72    YTLD-----------GPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWW  117
             +  D           GPCEVW+DDT V    +C   +  G       D+S C   CTL +
Sbjct  3239  WQNDQEQKGFIDSHHGPCEVWIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRF  3418

Query  118   YWLGIKYVEGAYSWQVYKNCVALSKTATA  146
             YW+ +       +WQ+YK CV +   + A
Sbjct  3419  YWIALH----EPNWQIYKQCVPVVNNSGA  3493

>PYAR:scaffold_212 par_scaffold_212 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_212:1:25069:1 
REF
Length=25069

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 57/117 (49%), Gaps = 12/117 (10%)
 Frame = +2

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDT  85
              + SLR +++ +S       +   CG+T P    QP+P +  +     +  GPCEVW D  
Sbjct  20006  FTSLRDLIEKKS------PSTPACGITPPGGAPQPVPDHVEWSAFADSHVGPCEVWCDQK  20167

Query  86     KVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +V    NC  ++P    +  I+ + C ++  L +YWL +     +  WQ+Y NC  L
Sbjct  20168  RVFQEDNCAGKYPARPAKLPINAADCANAKELKFYWLALH----SQDWQIYINCAPL  20326

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (48%), Gaps = 12/122 (10%)
 Frame = +1

Query  21     MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEV  80
               +  G +SL+A+++  +       +   CG+T P    Q +P +  +     +  GPCEV
Sbjct  17971  FKASGLSSLKALIEKAA------PSTPACGITPPGGAPQDVPDHVEWSAFADSHVGPCEV  18132

Query  81     WLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              W D+T+V    NC  ++P    +  I+ + C ++  +   WL +     +  WQVY NC 
Sbjct  18133  WCDNTRVFQEANCAGRYPSRPARLPINKAQCSNAKQMKIIWLALH----SQDWQVYINCA  18300

Query  139    AL  140
               L
Sbjct  18301  PL  18306

>PHCA:scaffold_146 PHYCAscaffold_146
Length=47772

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 11/107 (10%)
 Frame = +1

Query  46   LFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ--  101
            + +CG T      QP+P++   +  + G +  GPCE+W DDT+V    NC  ++  GQ  
Sbjct  40   IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEY-AGQVP  216

Query  102  --HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                ID   C  S  L +YWL +   +GA  WQVY NCV L  +A A
Sbjct  217  TSLPIDLDTCKSSSELVFYWLSL---QGA-PWQVYINCVKLDGSAAA  345

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = -2

Query  49      CGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYS  107
               CG + PK   QP+P    + TS +   GPCE W DD  V     NC T+F  G    D +
Sbjct  690703  CGFSDPKGTPQPLPDKIQWGTS-FIHPGPCEAWCDDEIVVPYTANCWTEFKDGSVPYDKA  690527

Query  108     ACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                C     L +YWL +     +  WQVY NCV L
Sbjct  690526  KCQGKKQLTFYWLAVH----SPPWQVYINCVPL  690440

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 6/64 (9%)
 Frame = +1

Query  73      TLDGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
                  GPCE+WLDDT V    NC  +FP    Q ++D+S+C   C + +YWL ++      +
Sbjct  299506  VFQGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPA  299673

Query  131     WQVY  134
               WQ+Y
Sbjct  299674  WQIY  299685

 Score = 52.0 bits (123),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 41/94 (44%), Gaps = 6/94 (6%)
 Frame = -2

Query  48      DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDY  106
               DCG +      Q +P +  + T G+   GPCE W D+  V     NC   F  G      
Sbjct  681070  DCGFSKSNGAAQALPDSLQWGT-GFIHPGPCEAWCDNEIVVPYTANCWKTFSGGNVPYAK  680894

Query  107     SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               + C     L +YWLG+        WQVY NCV L
Sbjct  680893  AKCAGKSRLTFYWLGVH----GPPWQVYINCVPL  680804

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 42/94 (45%), Gaps = 6/94 (6%)
 Frame = +3

Query  48      DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDY  106
               +CG + P    Q +P    + TS +   GPCE W DD  V     NC   + +G    + 
Sbjct  736449  ECGFSDPDGTPQALPDKLQWGTS-FIHPGPCEAWCDDVNVVPYTANCWITYKNGTVPYEK  736625

Query  107     SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               + C     L +YWL +     +  WQ Y NCV L
Sbjct  736626  AKCEGKKRLTFYWLAVH----SPPWQPYINCVPL  736715

 Score = 36.6 bits (83),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -3

Query  76      GPCEVWLDDTKVAAGRNCHTQFP  98
               GPCE+WLDDT V    NC  +FP
Sbjct  309222  GPCEIWLDDTPVLKEENCAGRFP  309154

 Score = 29.6 bits (65),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 4/35 (11%)
 Frame = -2

Query  100     GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                Q ++D+S+C   C + +YWL ++      +WQ+Y
Sbjct  309145  AQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQIY  309053

>PYIR:scaffold_277 pir_scaffold_277 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_277:1:34862:1 
REF
Length=34862

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 54/130 (42%), Gaps = 11/130 (8%)
 Frame = +1

Query  21    MQEHGYASLRAML----DDESLYKVTEEALFDCGLTSPKTET-QPIPSNSSFQTSGYTLD  75
              ++  Y SLR       D     K    +  +CG T+P  +T QP+P N  +   G    
Sbjct  838   FKKSKYKSLREFFMKNQDMSQGVKSGNPSTAECGFTAPDKQTAQPLPDNIEWYGGGQNHP  1017

Query  76    GPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             GPCE W D+  V     NC   FP G    D + C     L +YW+          WQVY
Sbjct  1018  GPCEAWCDNEIVLPFTANCQAAFPKGIMAYDKAKCVGKNRLSFYWMAT-----LNQWQVY  1182

Query  135   KNCVALSKTA  144
              +CV +   A
Sbjct  1183  IDCVKIGNGA  1212

>PHCA:scaffold_49 PHYCAscaffold_49
Length=508508

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 61/136 (45%), Gaps = 42/136 (31%)
 Frame = +2

Query  25     GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL----------  74
              GY+SLR MLD         + + DC  T  KT+  P+        SG T+          
Sbjct  24791  GYSSLRNMLD---------QQVSDCANT--KTDVSPV------DVSGLTVMNWQNDQEQK  24919

Query  75     ------DGPCEVWLDDTKVAAGRNC----HTQFPHGQHEIDYSACGDSCTLWWYWLGIKY  124
                     GPCEVW+DDT V    +C     + +P    + DYS C   CTL +YWL +  
Sbjct  24920  GFIDSHHGPCEVWIDDTMVDHQDDCVATYGSSYP-ANVKADYSQCSGDCTLRFYWLALH-  25093

Query  125    VEGAYSWQVYKNCVAL  140
                   +WQ+YK CV +
Sbjct  25094  ---EPNWQIYKQCVPI  25132

>SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.27:1:696964:1 
REF
Length=696964

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/135 (32%), Positives = 60/135 (44%), Gaps = 30/135 (22%)
 Frame = +3

Query  12      NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
               N + +AQS      + +LR MLD             DCG T    + + IP N       
Sbjct  290973  NKAFKAQS-----QFKTLRDMLDPHGP---------DCGYTLTNVDKKAIPGNGQMTWKN  291110

Query  69      ---TSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPHGQH---EIDYSACG-DSCTLWWYW  119
                    G+  +  GPCEVW+D+ +V    +C T FP        +DYS+CG + C L +YW
Sbjct  291111  PDTGEGFIPSHKGPCEVWIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYW  291290

Query  120     LGIKYVEGAYSWQVY  134
               L +        WQVY
Sbjct  291291  LALH----EPMWQVY  291323

>PYAR:scaffold_4452 par_scaffold_4452 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4452:1:2219:1 
REF
Length=2219

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 69/144 (48%), Gaps = 11/144 (8%)
 Frame = +2

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            M+  Y  EQ  NT+   +++  +  Y S+R M+ D+  ++    A  +CG ++     Q 
Sbjct  455  MSFGYGHEQ--NTAAFLKAYKSQSKYTSIRQMIYDK--FRPDGGATKECGRSAMTGPPQD  622

Query  61   IPSNSSFQTSGYTLD-GPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWW  117
            +P    ++T   +   GPCEVW DD +V    NC  ++P   G+   D + C  +  L  
Sbjct  623  LPDFVEYETGFDSTHWGPCEVWCDDKRVFYEDNCAVKYPQKPGKLPYDKAQCRGAKRLQS  802

Query  118  YWLGIKYVEGAYSWQVYKNCVALS  141
            +WL +   +    WQ Y +C  LS
Sbjct  803  FWLALHVPD----WQAYISCATLS  862

>PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 
genomic scaffold, whole genome shotgun sequence
Length=1472

 Score = 60.1 bits (144),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
             L++L+++ V T      +  ++GY SLR  +D    YKVTE A   CG + P    Q I
Sbjct  669  PLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD-SPRYKVTEGADQACGWSDPNGIPQQI  493

Query  62   PSNSSFQTSGYTLDGPCEVWL  82
            P + + +TS YT DGPCE+++
Sbjct  492  PEDGTMRTSNYTHDGPCEIYM  430

>PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.19, whole genome shotgun 
sequence
Length=1020763

 Score = 60.5 bits (145),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 28/129 (22%)
 Frame = +2

Query  25     GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--------SSFQTSGY--TL  74
              GY+SLR MLD +         + DC  T  +T+  P+  +        +  +  G+  + 
Sbjct  49469  GYSSLRDMLDQQ---------VTDCANT--RTDVSPVDVSGLSVMNWQNDQEQKGFIDSH  49615

Query  75     DGPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
               GPCEVW+DDT V    +C   +  G     + D+S C   CTL +YWL +       +W
Sbjct  49616  HGPCEVWIDDTMVDHQDDCVAAYGTGYPASVKADFSKCSGDCTLRFYWLALH----EPNW  49783

Query  132    QVYKNCVAL  140
              Q+YK CV +
Sbjct  49784  QIYKQCVPI  49810

>PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 
genomic scaffold, whole genome shotgun sequence
Length=182585

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 60/135 (44%), Gaps = 40/135 (30%)
 Frame = +3

Query  25     GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL----------  74
              GY+SLR MLD         + + DC  T  +T+  P+        SG +L          
Sbjct  79011  GYSSLRDMLD---------QQVADCANT--RTDGSPV------DVSGLSLMNWQNDEEQK  79139

Query  75     ------DGPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYV  125
                     GPCEVW+DDT V    +C   +  G     + D+S C   CTL +YWL +   
Sbjct  79140  GFIDSHHGPCEVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALH--  79313

Query  126    EGAYSWQVYKNCVAL  140
                  +WQ+YK CV +
Sbjct  79314  --EPNWQIYKQCVPI  79352

>PHIF:NW_003303637.1 Phytophthora infestans T30-4 supercont1.122 
genomic scaffold, whole genome shotgun sequence
Length=232370

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 60/135 (44%), Gaps = 40/135 (30%)
 Frame = -2

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL----------  74
               GY+SLR MLD         + + DC  T  +T+  P+        SG +L          
Sbjct  183181  GYSSLRDMLD---------QQVADCANT--RTDGSPV------DVSGLSLINWQNDEEQK  183053

Query  75      ------DGPCEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYV  125
                      GPCEVW+DDT V    +C   +  G     + D+S C   CTL +YWL +   
Sbjct  183052  GFIDSHHGPCEVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALH--  182879

Query  126     EGAYSWQVYKNCVAL  140
                   +WQ+YK CV +
Sbjct  182878  --EPNWQIYKQCVPI  182840

>PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_50:1:72629:1 
REF
Length=72629

 Score = 48.9 bits (115),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = +2

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSAC--GDSCTLWWYWLGIKYVEG  127
              GPCE+WLDDT V    +C++ +     +      +DYS+C  G    + +YWL  + V+G
Sbjct  42350  GPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDG  42529

Query  128    AYSWQVY  134
                 WQVY
Sbjct  42530  DTVWQVY  42550

 Score = 34.7 bits (78),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (13%)
 Frame = +3

Query  18     QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN  64
              +S   E G   +R++LDD S+Y        DCG T P    Q IP++
Sbjct  42117  KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTD  42239

>PYIW:scaffold_878 piw_scaffold_878 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_878:1:13019:1 
REF
Length=13019

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 11/130 (8%)
 Frame = +3

Query  21   MQEHGYASLRA-MLDDESL---YKVTEEALFDCGLTSPKTET-QPIPSNSSFQTSGYTLD  75
             ++  Y SLR  M+ ++++    K    +  +CG T+P+ +T Q +P N  +   G    
Sbjct  207  FKKSSYKSLREFMMKNQNMNGGVKSGNPSTKECGFTAPEKQTAQALPDNIEWYGGGMNHP  386

Query  76   GPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
            GPCE W D+  V     NC   FP G  + D + C     L +YW+          WQVY
Sbjct  387  GPCEAWCDNELVLPFTDNCQQTFPKGVMKYDKAKCVGKNQLSFYWMAT-----LNQWQVY  551

Query  135  KNCVALSKTA  144
             +CV +   A
Sbjct  552  IDCVKIGNGA  581

>PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1343, whole genome shotgun sequence
Length=1546205

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 12/123 (10%)
 Frame = -2

Query  26       YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS---GYTLD--GPCEV  80
                Y S++ +++D+++  VT  +L  CG  +P    QP+P    +  S   G+T    GPCEV
Sbjct  1356568  YKSIKELIEDKAVISVTGASLT-CGNANPDAPPQPLPEQVEWSHSAEEGFTPSHQGPCEV  1356392

Query  81       WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
                W D+ +     NC   F     ++ Y  + C  +  L  YW+ +        WQVY NC 
Sbjct  1356391  WCDNKQAFHDENCAAHFTTAPAQLSYEKTMCSGASKLTLYWIAMH----GPIWQVYINCA  1356224

Query  139      ALS  141
                 +S
Sbjct  1356223  NIS  1356215

>SAPA:scaffold_12 supercont2.12 dna:supercontig supercontig:ASM15154v2:supercont2.12:1:690970:1 
REF
Length=690970

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 51/114 (45%), Gaps = 32/114 (28%)
 Frame = -1

Query  49      CGLTSPKTETQPIPSNSSFQ----------TSGYTLD--------------GPCEVWLDD  84
               CG + P    + IPS+ +             S +T+D              GPCEVWLDD
Sbjct  306559  CGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTVDRPSGRRHGLIRRA*GPCEVWLDD  306380

Query  85      TKVAAGRNCHTQFPH---GQHEIDYSACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
                +V    +C T FP        +DYS+CG + C L +YWL +   +    WQVY
Sbjct  306379  KRVFQNDDCPTNFPQKPAAHLPVDYSSCGGAGCMLRFYWLALHQPQ----WQVY  306230

>PYAR:scaffold_1613 par_scaffold_1613 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1613:1:7643:1 
REF
Length=7643

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 55/115 (48%), Gaps = 8/115 (7%)
 Frame = -3

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDT  85
             Y SL+A++      +  E    +CG T  K E +     S+   S +   GPCEVW D+T
Sbjct  7440  YKSLKALIMGT---QKVEAGTAECGFTI-KDEAKRATLPSTIVHSSFFHPGPCEVWCDNT  7273

Query  86    KVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             K+A   +C T +   +  ID S C  +  L  YWL +        WQVY +CV L
Sbjct  7272  KLAYALDCQTAYKTSKIPIDTSKCAGADRLTLYWLAVH----GSPWQVYIDCVYL  7120

>PYIR:scaffold_573 pir_scaffold_573 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_573:1:20947:1 
REF
Length=20947

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 62/123 (50%), Gaps = 17/123 (14%)
 Frame = +1

Query  25    GYASLRAMLDDESL---YKVTEEALFDC-GLTSPKTETQPIPSNSSFQTSGYTLDGPCEV  80
             GY SL+ MLD       + +T+ A  D  GL S K +         F  S +   GPCEV
Sbjct  5425  GYKSLKEMLDLSVPGCGFTLTDGAPVDVSGLKSMKWQNDQ--EQKGFIDSHH---GPCEV  5589

Query  81    WLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
             W+D+TK+    +C   +T +P  +  +DYS C   C L +YWL +       +WQ+YK C
Sbjct  5590  WIDNTKIMHSDDCRADYTAYP-AEIPVDYSKCKGKCQLTFYWLALHEP----NWQIYKQC  5754

Query  138   VAL  140
             V +
Sbjct  5755  VPI  5763

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 19/130 (15%)
 Frame = +3

Query  21    MQEHGYASLRAMLDDESLYKVTEEAL-----FDCGLTSPKTETQPIPSNSSFQTSGYTLD  75
             +QEHG A     L  + L+++    L       CG+   +     +    S  T    L 
Sbjct  2637  LQEHGVAK---RLGAQGLHRLAPRKLRFARLLLCGVLHNQHRDLTV---QSLSTCVCDL*  2798

Query  76    GPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCE+W+D+T+V    +C   +  +P     +DYS C   CTL +YWL +       +WQ
Sbjct  2799  GPCEIWIDNTRVLHNDDCVATYKTYP-AVLPVDYSKCKGKCTLTFYWLALH----EPNWQ  2963

Query  133   VYKNCVALSK  142
             +Y   + L K
Sbjct  2964  IYSKSLFLHK  2993

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 28/141 (20%)
 Frame = +2

Query  12    NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS----SF  67
             NT+   ++W    GY SL+ MLD           + DCGL+ P  +  P+  +      F
Sbjct  7181  NTAQFTEAWPNT-GYKSLKEMLD---------TYVPDCGLSLP--DVTPVDVSGMKEFKF  7324

Query  68    QTSGY------TLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYW  119
             Q + Y      +  GPCE+W+ +TK     +C  +FP     I  D+S C  +C + +YW
Sbjct  7325  QNNEYKEGFIASHHGPCELWVGNTKAWHYDDCSAKFPGYPATIPTDFSVCKGTCRVTFYW  7504

Query  120   LGIKYVEGAYSWQVYKNCVAL  140
             L +     +  WQ+Y   + L
Sbjct  7505  LALH----SQKWQIYSASIIL  7555

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 47/96 (49%), Gaps = 10/96 (10%)
 Frame = +1

Query  37     SLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGY------TLDGPCEVWLDDTKVA  88
              SL ++ + A+  CG T P      +   SS  +Q + Y      +  GPCE W+D+TKV 
Sbjct  15802  SLKQMMDAAVPGCGYTDPNAAPVDVSKLSSMKYQNNEYKEGFLNSHHGPCEGWIDNTKVF  15981

Query  89     AGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGI  122
                 +C   FP       + +++C  +C L +YWL +
Sbjct  15982  HYDDCVKSFPGYPATIPMSFASCKGNCRLTFYWLAL  16089

>PHCA:scaffold_8 PHYCAscaffold_8
Length=1194346

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 71/146 (49%), Gaps = 31/146 (21%)
 Frame = -1

Query  11      VNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS  70
                NT++  +S+     + +L+AM+D          A  DCG TS  T   P+   SS ++ 
Sbjct  815311  ANTAMFTKSFPNSQ-FKTLKAMMD---------TAAPDCGKTS-LTGKAPV-DVSSLKSM  815168

Query  71      GYTLD-----------GPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLW  116
                +  D           GPCE W+DDT+V    +C   +T +P  +  +D+S+C   CT  
Sbjct  815167  TWQNDQEQKGFIDSHRGPCEGWIDDTRVFHSDDCRGDYTGYP-AEIPVDFSSCSGDCTFT  814991

Query  117     WYWLGIKYVEGAYSWQVYKNCVALSK  142
               +YWL +       +WQVYK C A++ 
Sbjct  814990  FYWLALHEP----NWQVYKQCAAITN  814925

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = -3

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCE W+DDT++    NC  QF     +I  DYS+C   C   +YWL +       +WQ
Sbjct  824051  EGPCEGWIDDTRIFHYDNCAAQFKTYPAKIPADYSSCKGDCLFSFYWLALHEP----NWQ  823884

Query  133     VYKNCVALSK  142
               +YK CV ++ 
Sbjct  823883  IYKQCVPITN  823854

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = -1

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCE W+DDT++    NC  QF     ++  DYS+C   C   +YWL +   +    WQ
Sbjct  820348  EGPCEAWIDDTRIFHYDNCAAQFKTYPAKVPADYSSCKGDCLFVFYWLALHEPD----WQ  820181

Query  133     VYKNCVALSK  142
               +YK CV ++ 
Sbjct  820180  IYKQCVPITN  820151

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 7/65 (11%)
 Frame = -3

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC-GDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCE W+D+  V    +C  +FP    +I  DYS+C GD C   +YWL +   E    WQ
Sbjct  818906  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLALHSPE----WQ  818739

Query  133     VYKNC  137
               +Y  C
Sbjct  818738  IYSTC  818724

 Score = 51.6 bits (122),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 44/87 (51%), Gaps = 6/87 (7%)
 Frame = -3

Query  55      KTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDS  112
               +  + P+ +  +F+ + +   GPCE W+D+TKV    +C   F     +I  DYS+C   
Sbjct  817271  RVNSFPLETTCTFRLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKGE  817092

Query  113     CTLWWYWLGIKYVEGAYSWQVYKNCVA  139
               C   +YWL +     + +WQVY   + 
Sbjct  817091  CKFVFYWLALH----SPTWQVYSTLIV  817023

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 6/62 (10%)
 Frame = +3

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCE+WLD+  V    NC   FP       +DYS+C + C L +Y L +  VE    WQ 
Sbjct  821658  GPCELWLDEVVVVKSNNCAVAFPTNPAICAVDYSSCSECCVLRFYALALTGVE----WQA  821825

Query  134     YK  135
               + 
Sbjct  821826  FS  821831

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 38/76 (50%), Gaps = 6/76 (8%)
 Frame = +3

Query  66      SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIK  123
               +F+ + +   GPCE W+D+TKV    +C   F     +I  DYS+C       +YWL + 
Sbjct  850308  TFRLTRFHTQGPCEAWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSCKGERKFVFYWLALH  850487

Query  124     YVEGAYSWQVYKNCVA  139
                   + +WQVY   + 
Sbjct  850488  ----SPTWQVYSTLIV  850523

 Score = 37.0 bits (84),  Expect = 0.11, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = +3

Query  63      SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC  109
               +  SF+ + +   GPCE W+D+TKV    +C   F     +I  DYS+C
Sbjct  831357  TTCSFRLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKIPTDYSSC  831503

>PHRA:scaffold_23
Length=570991

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 70/143 (49%), Gaps = 26/143 (18%)
 Frame = +3

Query  11      VNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---  67
                NT++  +S+ +   + +LRA++D          A  DCG T+       + S SS    
Sbjct  390378  ANTAMFTKSFPKSQ-FKTLRALMD---------TAAPDCGNTALTGTAVDVSSLSSMKWQ  390527

Query  68      ---QTSGY--TLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYW  119
                  +  G+  +  GPCE W+DDT+V    +C   +T +P  +  ID+S+C   CT  +YW
Sbjct  390528  NDQEQKGFIDSHHGPCEAWIDDTRVFQSDDCRADYTGYP-AEIPIDFSSCSGDCTFTFYW  390704

Query  120     LGIKYVEGAYSWQVYKNCVALSK  142
               + +       +WQVYK C  ++ 
Sbjct  390705  MAMHEP----NWQVYKQCAPIAN  390761

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 6/67 (9%)
 Frame = +2

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
               GPCE W+DD ++    NC  QF     +I  DY++C   C   +YWL +       +WQ+
Sbjct  380690  GPCEAWIDDVRIFHHDNCAAQFTSYPAKIPADYASCKGDCLFSFYWLALHEP----NWQI  380857

Query  134     YKNCVAL  140
               YK CV +
Sbjct  380858  YKQCVPI  380878

 Score = 54.7 bits (130),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = +2

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +GPCE W+DD ++    NC  QF     ++  D+S+C   C   +YWL +       +WQ
Sbjct  384860  EGPCEAWVDDVQIFHHDNCAAQFKTYPAKVPADFSSCKGDCLFVFYWLALHEP----NWQ  385027

Query  133     VYKNCVALSKTATA  146
               +YK CV ++ + ++
Sbjct  385028  IYKQCVPITNSGSS  385069

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 13/73 (18%)
 Frame = -3

Query  76      GPCEVWLDD-----TKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEG  127
               GPCE W+D      T+V    +C   +T +P  +  IDYS C   CT  +YWL +     
Sbjct  388631  GPCEAWIDSNTGTKTRVFRSDDCRRDYTGYP-AEIPIDYSLCTGECTFVFYWLAMHEA--  388461

Query  128     AYSWQVYKNCVAL  140
                 +WQVYK C  +
Sbjct  388460  --NWQVYKQCAPI  388428

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 7/62 (11%)
 Frame = +1

Query  76      GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC-GDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCE W+DDT V    +C  +FP    +I  DYSAC GD C   +YWL +   E    WQ
Sbjct  386578  GPCEGWIDDTMVFHYDDCVAKFPSYPAKIPTDYSACKGDKCLFVFYWLAVHSPE----WQ  386745

Query  133     VY  134
               +Y
Sbjct  386746  IY  386751

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 2/53 (4%)
 Frame = -2

Query  76      GPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWWYWLGIKYVE  126
               GPCE+WLD+  V    NC   FP       +DYS C   C L +Y L +  VE
Sbjct  383433  GPCELWLDEAVVFQASNCAVAFPTRPATCAVDYSNCSGRCVLRFYALALTGVE  383275

>PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:pug:scf1117875582038:1:913258:1 
REF
Length=913258

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 64/146 (44%), Gaps = 46/146 (32%)
 Frame = +1

Query  22      QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS---------NSSF-----  67
               ++HGY +LR+ LD++            CG T+ K   + IP+         N+ F     
Sbjct  601372  KKHGYKTLRSFLDNKGQ---------TCGWTNSKATPKAIPADGKVVFQHVNAGFTHQVH  601524

Query  68      -----------QTSGYTLD---GPCEVWLDDTKVAAGRNCHTQFP-----HGQHEIDYSA  108
                          +   +TL+   GPCE+WLD+  V    NC   F        +  +D+S+
Sbjct  601525  *VVCCVSLKNIEVCTHTLNASQGPCEIWLDNKMVLHNDNCEKAFAGKGITESKMPVDFSS  601704

Query  109     CGDSCTLWWYWLGIKYVEGAYSWQVY  134
               C  SC L +YWLG +  +    WQVY
Sbjct  601705  CKGSCMLRFYWLGFQNEQ----WQVY  601770

>ALLA:FR824076 dna:supercontig supercontig:ENA1:FR824076:1:147313:1 
REF
Length=147313

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 23/119 (19%)
 Frame = +3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLD--GP  77
              + +LR  L D+  Y         CG T+P  + +PIP++ +          G+     GP
Sbjct  47661  FQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGP  47813

Query  78     CEVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
              CEVWL++ +V    NC  H +    +  ID+S C + C L ++WL +   +    WQVY
Sbjct  47814  CEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQVY  47978

>PHSO:scaffold_31
Length=53937

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 45/101 (45%), Gaps = 7/101 (7%)
 Frame = +3

Query  48     DCGLTSP-KTETQPIPSNSSFQTSGYTLDGPCEVWLDD-TKVAAGRNCHTQFPHGQHEID  105
              +CG T P     QP+P    +   G   DGPCE+W DD   +    NC   +P G+   +
Sbjct  11535  ECGFTDPVDGAVQPLPDQVEWYGGGMIHDGPCEIWCDDEVAMPFTPNCRAAYPDGKFPYE  11714

Query  106    YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
               + C     L  YWLG         WQVY +C  + +  +A
Sbjct  11715  KAKCEGKKRLTMYWLGT-----LLEWQVYIDCAKIGEGGSA  11822

>PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 
genomic scaffold, whole genome shotgun sequence
Length=80461

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -2

Query  23     EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
              ++GY SL   +D  + YKV++ A   CG T PK   Q  P + + +T+GYT DGPCE+++
Sbjct  80421  DNGYKSLLDFMD-RAKYKVSKGADQACGWTDPKGIPQQFPEDGTMRTTGYTHDGPCEIYM  80245

Query  83     DDTKVAAGRNCHTQFP  98
               +    +  NCH   P
Sbjct  80244  GEKLALSYLNCHESIP  80197

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  39     YKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
              YKVTE A   CG + P    Q IP + + +TS YT DGPCE+++
Sbjct  40621  YKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPCEIYM  40490

>PYIW:scaffold_532 piw_scaffold_532 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_532:1:17058:1 
REF
Length=17058

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 19/128 (15%)
 Frame = -2

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS------NSSFQTSGY--TLDGP  77
             Y+ ++ M+    +  V   A  DCG ++PKT+ Q + S      N+     G+  + +GP
Sbjct  8690  YSDIKTMILKNQV--VVSGAAADCGFSTPKTK-QTLSSSVWWGKNTDLTGEGFVESHEGP  8520

Query  78    CEVWLDDTKVAAGRNCHTQF----PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
             CE W DD  V    NC T +       +  ID S C  +  L +YW+ +   E    WQV
Sbjct  8519  CEAWCDDVMVMQNTNCATAYNTAGKAAEVPIDNSKCSSASQLTFYWIAMHTNE----WQV  8352

Query  134   YKNCVALS  141
             Y  C+ +S
Sbjct  8351  YSKCLLIS  8328

>PYIR:scaffold_3497 pir_scaffold_3497 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_3497:1:1521:1 
REF
Length=1521

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 58/128 (45%), Gaps = 14/128 (11%)
 Frame = -1

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
             ++   Y S+R +++ + +  +   A   CG+TS     QP+P+     S   + G+T   
Sbjct  1077  IKTSAYKSVRDLINAKGV--MMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSH  904

Query  76    -GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
              GPCEVW DD       NC   +P    E  ID+S C     L   WL +     + +WQ
Sbjct  903   QGPCEVWCDDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLALH----SPTWQ  736

Query  133   VYKNCVAL  140
              Y NC  L
Sbjct  735   AYINCAVL  712

>HYAP:scaffold_463 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_463:1:12715:1 
REF
Length=12715

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 60/137 (44%), Gaps = 30/137 (22%)
 Frame = -1

Query  18    QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS--------NSSFQT  69
             +S     GY SLR MLD +             G  + +T+  P+           +  + 
Sbjct  7804  KSSFANAGYKSLRDMLDQQVP-----------GCANTRTDVAPVDVAGLTVMNWQNDKEH  7658

Query  70    SGY--TLDGPCEVWLDDTKVAAGRNC----HTQFPHGQHEIDYSACGDSCTLWWYWLGIK  123
              G+  +  GPCE W+DDT V    +C     T FP      D+S C   CTL +YWL + 
Sbjct  7657  KGFIDSHHGPCETWIDDTMVDRQDDCVATYGTGFP-ASVNADFSRCSGVCTLRFYWLALH  7481

Query  124   YVEGAYSWQVYKNCVAL  140
              V    +WQVYK CV +
Sbjct  7480  EV----NWQVYKQCVPI  7442

>PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 
genomic scaffold, whole genome shotgun sequence
Length=5928454

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = -3

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                +GPCE W+D+T+V    NC  QF     ++  DYS+C   C   +YWL +       +WQ
Sbjct  5326202  EGPCEAWIDETRVFHHDNCAAQFKSYPAKVPTDYSSCKGDCLFVFYWLALHEP----NWQ  5326035

Query  133      VYKNCVALSK  142
                +YK CV ++ 
Sbjct  5326034  IYKQCVPITN  5326005

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 6/69 (9%)
 Frame = -1

Query  76       GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
                GPCE W+DD +V    +C   F     +  ID+S+C   CT  +YWL +       +WQV
Sbjct  5289247  GPCEAWIDDKRVFHSDDCRADFTTYPAEIPIDFSSCSGDCTFTFYWLALHEP----NWQV  5289080

Query  134      YKNCVALSK  142
                YK C  ++ 
Sbjct  5289079  YKQCAPITN  5289053

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = -3

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                +GPCE W+ +T++    +C  QF     +I  DYS+C   C L +YWL +       +WQ
Sbjct  5331737  EGPCEAWIGETQIFHHNDCAAQFKSYPAKIPADYSSCKGDCLLVFYWLALHEP----NWQ  5331570

Query  133      VYKNCVALSK  142
                +YK CV ++ 
Sbjct  5331569  IYKQCVPITN  5331540

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 10/83 (12%)
 Frame = +2

Query  65       SSFQTSGYT----LDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWY  118
                +SF  SG T    L GPCE+W+D+  V    NC   FP       +DY +C D C L +Y
Sbjct  5329040  ASFSRSGITSFVSLQGPCELWIDEAVVFQANNCAVAFPTSPATCPVDYLSCYDKCVLRFY  5329219

Query  119      WLGIKYVEGAYSWQVYKNCVALS  141
                 + +    G Y WQ +    AL+
Sbjct  5329220  AMALT---GVY-WQAFSTLNALN  5329276

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 38/74 (51%), Gaps = 13/74 (18%)
 Frame = -2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC-GDSCTLWWYWLGIKYVEGAYSWQ  132
                GPCE W+D+  V    +C  +FP    +I  DYS C GD C   +YWL +   +    WQ
Sbjct  5323509  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSFCKGDKCLFVFYWLALHTPQ----WQ  5323342

Query  133      VYKNCVALSKTATA  146
                +Y      SKT T+
Sbjct  5323341  IY------SKTPTS  5323318

>PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_123:1:61624:1 
REF
Length=61624

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 7/95 (7%)
 Frame = -2

Query  48     DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQF--PHGQHEID  105
              +CG+T+ K E +     S+ + +G++  GPCEVW D TK+A   +C   +     +  ID
Sbjct  53778  ECGMTT-KDEAKRAELPSTIKYTGFSHPGPCEVWCDKTKLAYAVDCQKTYGSQDAKIPID  53602

Query  106    YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               S C  +  L  YW+G+        WQVY NCV L
Sbjct  53601  ASKCAGADRLTLYWIGVH----GDPWQVYTNCVYL  53509

>SADI:scaffold_24 supercont1.24 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.24:1:724546:1 
REF
Length=724546

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 8/63 (13%)
 Frame = -3

Query  76      GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSW  131
               GPCEVWLDD +V    +C T FP        +DYS+C GD C L +YWL +   +    W
Sbjct  452981  GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQPQ----W  452814

Query  132     QVY  134
               QVY
Sbjct  452813  QVY  452805

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 8/63 (13%)
 Frame = +3

Query  76      GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSW  131
               GPCEVWLDD +V    +C T FP        +DYS+C GD C L +YWL +   +    W
Sbjct  440046  GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQPQ----W  440213

Query  132     QVY  134
               QVY
Sbjct  440214  QVY  440222

>ALCA:scaffold_168 AcNc2_CONTIG_168_length_51659 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_168_length_51659:1:51659:1 
REF
Length=51659

 Score = 58.2 bits (139),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 23/119 (19%)
 Frame = -3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLD--GP  77
              + +LR  L D+  Y         CG T+P    +PIP++++          G+     GP
Sbjct  27846  FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  27694

Query  78     CEVWLDDTKVAAGRNCHTQF--PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
              CEVWL +T+V    NC   F     +  I++S+C   C L ++WL +   +    WQVY
Sbjct  27693  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVY  27529

>PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:pug:scf1117875582028:1:960197:1 
REF
Length=960197

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 60/129 (47%), Gaps = 29/129 (22%)
 Frame = -1

Query  25      GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP---------SNSSFQTSGY--T  73
               GY+SL+A+LD  +            G  + + +  P+           N  F   G+  +
Sbjct  821642  GYSSLKALLDPVAP-----------GCGNSRVDVPPVGVSRLAAMEFRNDEFH-EGFVNS  821499

Query  74      LDGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
                 GPCEVW+D+ ++  G +C  QF        +++S C   CTL +YWL +       +W
Sbjct  821498  HHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLALH----EPTW  821331

Query  132     QVYKNCVAL  140
               QVYK CV +
Sbjct  821330  QVYKQCVPI  821304

>PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.1, whole genome shotgun 
sequence
Length=4724858

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (48%), Gaps = 26/143 (18%)
 Frame = +2

Query  11       VNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---  67
                 NT++  +S+     + +L+AM+D             DCG TS       + S SS    
Sbjct  4462289  ANTAMFTKSFPNSK-FKTLKAMMD---------TVASDCGKTSLTGSPVDVSSLSSMTWQ  4462438

Query  68       ---QTSGY--TLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYW  119
                   +  G+  +  GPCE W+DDT+V    +C   +T +P  +  +D+S+C   CT  +YW
Sbjct  4462439  NDQEQKGFIDSHRGPCEGWIDDTRVFHSDDCRADYTGYP-AEIPVDFSSCSGDCTFTFYW  4462615

Query  120      LGIKYVEGAYSWQVYKNCVALSK  142
                L +       +WQVYK C  ++ 
Sbjct  4462616  LALHEP----NWQVYKQCAPITN  4462672

 Score = 52.0 bits (123),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 6/70 (9%)
 Frame = -3

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
                +GPCE W+ +T+V    NC  +F     +I  DYS+C   C   +YWL +       +WQ
Sbjct  4473237  EGPCEAWIGETQVFHYDNCAARFKSYPAKIPADYSSCKGDCLFAFYWLALHEP----NWQ  4473070

Query  133      VYKNCVALSK  142
                +YK CV ++ 
Sbjct  4473069  IYKQCVPITN  4473040

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = -2

Query  75       DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGI  122
                +GPCE W+DDT++    NC  QF     +I  DYS+C   C   +YWL +
Sbjct  1914745  EGPCEAWIDDTRIFHYDNCAAQFKSYPAKIPADYSSCKGDCLFAFYWLAL  1914596

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query  73       TLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYS  130
                +L GPCE+W+D+  V    NC   FP       ++YS+C D C L +Y L +       +
Sbjct  1916260  SL*GPCELWIDEGVVFQANNCAVAFPSSPATCPVNYSSCNDKCVLRFYALSL----AGTA  1916427

Query  131      WQVYKNCVALSKTAT  145
                WQ +    +L   A+
Sbjct  1916428  WQAFSTLNSLPLLAS  1916472

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +3

Query  73       TLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYS  130
                +L GPCE+W+D+  V    NC   FP       ++YS+C D C L +Y L +       +
Sbjct  4478703  SL*GPCELWIDEGVVFQANNCAVAFPSSPATCPVNYSSCNDKCVLRFYALSL----AGTA  4478870

Query  131      WQVYKNCVALSKTAT  145
                WQ +    +L   A+
Sbjct  4478871  WQAFSTLNSLPLLAS  4478915

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 7/64 (11%)
 Frame = +2

Query  74       LDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC-GDSCTLWWYWLGIKYVEGAYS  130
                L GPCE W+D+  V    +C  +FP    +I  DYS+C GD C   +YWL +   E    
Sbjct  4458293  LQGPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLALHSPE----  4458460

Query  131      WQVY  134
                WQ+Y
Sbjct  4458461  WQIY  4458472

 Score = 46.2 bits (108),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 7/64 (11%)
 Frame = -3

Query  74       LDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC-GDSCTLWWYWLGIKYVEGAYS  130
                L GPCE W+D+  V    +C  +FP    +I  DYS+C GD C   +YWL +   E    
Sbjct  4470405  LQGPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLALHSPE----  4470238

Query  131      WQVY  134
                WQ+Y
Sbjct  4470237  WQIY  4470226

>PYVX:scaffold_341 pve_scaffold_341 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_341:1:29233:1 
REF
Length=29233

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 35/69 (51%), Gaps = 12/69 (17%)
 Frame = -1

Query  74     LDGPCEVWLDDTKVAAGRNCHTQFPHG--------QHEIDYSACGDSCTLWWYWLGIKYV  125
              + GPCEVW DDT V  G NC  ++P G        Q  +DY+ C   C L +YWLG +  
Sbjct  23716  VQGPCEVWFDDTMVLHGDNCEDEYPGGDVDTTDYSQMTVDYTQCSGDCVLRFYWLGFQ--  23543

Query  126    EGAYSWQVY  134
                   WQ Y
Sbjct  23542  --NEMWQAY  23522

>PHPA:scaffold_81 NW_008649067.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.81, whole genome shotgun 
sequence
Length=244838

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 17/99 (17%)
 Frame = +3

Query  49     CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFP-----  98
              CG T      +PIPS+        +  G+T  GPCE++LDD  V  G +C  ++P     
Sbjct  87438  CGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDG  87617

Query  99     ---HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                   +  +D+S+C   CTL  YWL  +  +    WQ Y
Sbjct  87618  SSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ----WQTY  87722

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 37/66 (56%), Gaps = 7/66 (11%)
 Frame = -3

Query  74      LDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSAC-GDSCTLWWYWLGIKYVEGAYS  130
               L GPCE W+DDTKV    +C  +FP    +I  DYSAC GD C   +YWL +     +  
Sbjct  134385  LQGPCEGWIDDTKVFHYDDCVAEFPSYPAKIPTDYSACKGDKCLFVFYWLALH----SPK  134218

Query  131     WQVYKN  136
               WQ+Y  
Sbjct  134217  WQIYST  134200

 Score = 31.6 bits (70),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (51%), Gaps = 10/69 (14%)
 Frame = -1

Query  75      DGPCEVWLDDTKVAAGRNCHTQFPHGQHEID--YSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               +G CEV + +T+V+   NC  +F     +I   +S+    C    YWL +       +WQ
Sbjct  136214  EGHCEV*IGETQVSHYDNCAARFKSYPTKIPVVHSSRKSDC----YWLALHEP----NWQ  136059

Query  133     VYKNCVALS  141
               +YK CV ++
Sbjct  136058  IYKQCVPIT  136032

>APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.49:1:457786:1 
REF
Length=457786

 Score = 52.0 bits (123),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 7/62 (11%)
 Frame = +2

Query  76      GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
               GPCE+WLD+T+V    +C T FP        +D+++C  SCT+ +YW+ +        WQ
Sbjct  302651  GPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALH----QDLWQ  302818

Query  133     VY  134
               VY
Sbjct  302819  VY  302824

 Score = 28.1 bits (61),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 21/43 (49%), Gaps = 9/43 (21%)
 Frame = +1

Query  22      QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN  64
               Q  G+ +LRAMLD +           DCG +      +PIPS+
Sbjct  302440  QATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSD  302541

>PYIW:scaffold_712 piw_scaffold_712 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_712:1:15016:1 
REF
Length=15016

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 50/115 (43%), Gaps = 31/115 (27%)
 Frame = -3

Query  49    CGLTSPKTETQPIPSNSSFQTS---------------------GYTL------DGPCEVW  81
             CG  +P    QPIPS+     S                     G+ L       GPCE+W
Sbjct  1862  CGKNNPNGAVQPIPSDKKVHYSRAIVHPVRPSESVLLLFISVRGF*LARI*S*QGPCEIW  1683

Query  82    LDDTKVAAGRNCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             LD+TKV +  +C   F        ID+S+C   C L +YWLG++  +G   WQ Y
Sbjct  1682  LDNTKVYSNADCEAAFGSSIPVFNIDWSSCASKCVLRFYWLGLQ--DGGERWQSY  1524

 Score = 35.0 bits (79),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query  82    LDDTKVAAGRNCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             LD+TKV +  +C   F        ID+S+C   C L +YWLG++  +GA  WQ Y
Sbjct  1408  LDNTKVYSNADCEKTFGSSIPTWNIDWSSCKSKCVLRFYWLGLQ-DQGAL-WQSY  1250

>PYIR:scaffold_1966 pir_scaffold_1966 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1966:1:4262:1 
REF
Length=4262

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = +1

Query  73    TLDGPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAY  129
             T+ GPCE+WLDD +V +  NC   F   P  +  +D+S+C ++C L +YWL +       
Sbjct  1786  TM*GPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLALH----EP  1953

Query  130   SWQVY  134
             +WQVY
Sbjct  1954  TWQVY  1968

>PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3542:1:2951:1 
REF
Length=2951

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 23/130 (18%)
 Frame = -3

Query  25    GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGY------TLDG  76
             GY SL+ ++D +         +  CG +        +   SS  FQ + Y      +  G
Sbjct  1713  GYKSLKELMDKQ---------VPGCGFSRTDIAAVDVSGMSSMKFQNNEYKEGFLGSHHG  1561

Query  77    PCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             PCE W+D+TKV    +C   +P       + Y+AC  +C L +YWL +     +  WQ Y
Sbjct  1560  PCEGWIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALH----SQKWQAY  1393

Query  135   KNCVALSKTA  144
             K+CV +   A
Sbjct  1392  KHCVPIKAGA  1363

>PYIR:scaffold_46 pir_scaffold_46 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_46:1:69731:1 
REF
Length=69731

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (56%), Gaps = 7/62 (11%)
 Frame = +2

Query  76    GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCEVWLDD +V +  NC   F   P  +  +D+S+C   C L +YWL +       +WQ
Sbjct  2735  GPCEVWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYWLALH----EPTWQ  2902

Query  133   VY  134
             VY
Sbjct  2903  VY  2908

>PYIW:scaffold_182 piw_scaffold_182 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_182:1:25962:1 
REF
Length=25962

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 58/130 (45%), Gaps = 23/130 (18%)
 Frame = +1

Query  25    GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGY------TLDG  76
             GY SL+ MLD         +++  CG T+P      +    S  +Q + Y      +  G
Sbjct  1549  GYTSLKEMLD---------KSVSGCGYTNPNAAPVDVSGLKSMKYQNNEYKEGFLGSHRG  1701

Query  77    PCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             PCE W+D+TK+    +C   +P       +DYS C  +C L +YWL +     +  WQVY
Sbjct  1702  PCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVH----SPKWQVY  1869

Query  135   KNCVALSKTA  144
                   S  A
Sbjct  1870  SKSACSSTIA  1899

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 36/68 (53%), Gaps = 6/68 (9%)
 Frame = -3

Query  76    GPCEVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCE+W++ T+V    +C  +T        +DYS C   CT+ +Y L +  ++    WQ+
Sbjct  4099  GPCEIWIEKTRVFQTNDCRGYTDAYPAVFPVDYSVCKGDCTITFYLLAVHELK----WQI  3932

Query  134   YKNCVALS  141
             Y    ++S
Sbjct  3931  YSKLPSVS  3908

 Score = 39.7 bits (91),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -3

Query  76     GPCEVWLDDTKVAAGRNCHTQFP-HGQHEIDYSACGDSCTLWWYWL  120
              GPCEVW+D  +    +NC   F        DYSAC  +C L  YWL
Sbjct  21565  GPCEVWIDSKRAFEHQNCAKLFEVTPTIPFDYSACHGTCLLTLYWL  21428

>PHIF:NW_003303307.1 Phytophthora infestans T30-4 supercont1.454 
genomic scaffold, whole genome shotgun sequence
Length=44621

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%), Gaps = 12/121 (10%)
 Frame = +1

Query  24    HGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQ-PIPSNSSFQTSGYTLDGPCEVW  81
              GY SL   +  ++ LY  + +   DCG T  K   +  +P+    + +G+T  GPCE+W
Sbjct  742   KGYDSLGEFIAKNQELY--SSDIDPDCGWTVYKDSARSALPTQ--LEYTGFTHPGPCEIW  909

Query  82    LDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
              DDTK+    +C T++P    +I Y  S C ++  L  +W+GI        WQ+Y +CV 
Sbjct  910   CDDTKLLFDYDCWTKYPAIPAKIPYDKSKCANANRLTIFWIGIH----GTPWQIYTDCVW  1077

Query  140   L  140
             L
Sbjct  1078  L  1080

>PYAP:scaffold_94 pag1_scaffold_94 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_94:1:69112:1 
REF
Length=69112

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (47%), Gaps = 27/135 (20%)
 Frame = -1

Query  25    GYASLRAMLD----DESLYKVTEEALFDCGLTSPKTETQP-----IPSNSSFQTSGYTLD  75
             G++SLR++LD    D    ++   A+   GLTS K +        IPS+           
Sbjct  5671  GFSSLRSILDLIVTDCGATRIDVPAVDVTGLTSMKFQNDEDKKGLIPSHR----------  5522

Query  76    GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACG--DSCTLWWYWLGIKYVEGAYSW  131
             GP E+W+D  +   G +C  +F        +DYS C    +C L +YWL +        W
Sbjct  5521  GPREIWIDSKRAFHGDDCAAEFTGYPAVLPVDYSLCPPQKTCILRFYWLALH----ESLW  5354

Query  132   QVYKNCVALSKTATA  146
             QVYK CV + +T +A
Sbjct  5353  QVYKQCVPIERTGSA  5309

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 8/117 (7%)
 Frame = +1

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLD  83
              Y +L+ ++D+  L K       +CG +  + + QP+P    ++  +   +  GPCEVW D
Sbjct  27049  YKTLKDLVDE--LSKPEGGTSKECGFSKEEGKPQPLPDKVEWEGFSGSPSHVGPCEVWCD  27222

Query  84     DTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              D       NC   F  G+   D + C     L   WL + +V+    WQVY  C  L
Sbjct  27223  DVLAFHDDNCVKNFADGKLPYDKAKCAGKKRLRSIWLAL-HVD---KWQVYPYCATL  27381

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 6/67 (9%)
 Frame = -3

Query  76     GPCEVWLDDTKVAAGRNCHTQF--PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              GPCEVW D T+V    NC   +     +  I  S C ++  L +YWL +  +    +WQV
Sbjct  43190  GPCEVWCDSTRVFHHDNCAGAYRTAPAKLPIKKSKCTNAKQLTFYWLALHEI----NWQV  43023

Query  134    YKNCVAL  140
              Y NCV+L
Sbjct  43022  YINCVSL  43002

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (54%), Gaps = 6/71 (8%)
 Frame = -2

Query  76     GPCEVWLDDTKVAAGRNCHTQF--PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              GPCEVW D+ +V    NC   +     +  I+ + C ++  L +YWL +  +    +WQV
Sbjct  42105  GPCEVWCDNQRVFQNDNCAGAYRTAPAKLPINKAKCANAKQLTFYWLALHEI----NWQV  41938

Query  134    YKNCVALSKTA  144
              Y NCV+L   A
Sbjct  41937  YINCVSLKGGA  41905

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 58/129 (45%), Gaps = 25/129 (19%)
 Frame = +2

Query  19     SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTS  70
              +W++   + SL+ ++       V +  + +CG+++   + QP+P        SN  F  S
Sbjct  50927  AWIKTSEFKSLKDLI-------VKKGNVGECGISA-LGDPQPLPDQVEWAHSSNEGFTPS  51082

Query  71     GYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGA  128
                   GPCEVW DD       NC   +     ++ Y  S C  +  L +YWL +      
Sbjct  51083  H---QGPCEVWCDDKMAFHDDNCAKDYTSAPAKLPYDKSKCVGAKKLTFYWLALHDP---  51244

Query  129    YSWQVYKNC  137
               +WQ+Y NC
Sbjct  51245  -NWQIYINC  51268

>PYAP:scaffold_630 pag1_scaffold_630 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_630:1:18565:1 
REF
Length=18565

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 59/126 (47%), Gaps = 18/126 (14%)
 Frame = -1

Query  21     MQEHGYASLRAMLDDESLYKVTEEALF------DCGLTSPKTETQPIPSNSSFQTSGYTL  74
              M++ GY +LR ++    +  V   A+       +CGLT    E QPIP    F    +  
Sbjct  17224  MEKEGYTTLRQLI----MKNVKLSAINGLTGKKECGLTITTGEKQPIPDEIDFP---WGH  17066

Query  75     DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
               GPCEVW D+ ++   ++C      G+ ++D + C     +   ++G+       +W+VY
Sbjct  17065  PGPCEVWCDNNRIFYNQDCQANN-VGKVKVDKTKCAGVNIIQAMYIGVHVA----NWEVY  16901

Query  135    KNCVAL  140
               NC  +
Sbjct  16900  ANCAPM  16883

 Score = 52.0 bits (123),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 56/122 (46%), Gaps = 10/122 (8%)
 Frame = -2

Query  21     MQEHGYASLRAM-LDDESLYKVT-EEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPC  78
              M+  GY +LR + + + +L  +       +CGLT      QP+P    F    +   GPC
Sbjct  15378  METEGYTTLRQLIMKNVNLSTIDGHTGTKECGLTITTGPKQPLPDAVDFP---WGHPGPC  15208

Query  79     EVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              EVW D+ ++   +NC      G+  ID + C     +   ++G+       +W+VY NC 
Sbjct  15207  EVWCDNNRIFFNKNCQAN-NVGKVPIDKTKCAGVNIIQAMYIGVHVA----NWEVYANCA  15043

Query  139    AL  140
               +
Sbjct  15042  PI  15037

 Score = 38.9 bits (89),  Expect = 0.020, Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 20/99 (20%)
 Frame = -1

Query  48     DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYS  107
              +CG++      Q +     +    +   GPCE+W D+T++    +C      G  +ID S
Sbjct  13735  ECGMSQANGARQALTDTVEWT---WAHPGPCEIWCDNTRLFFNADCSGN-NVGNVKIDKS  13568

Query  108    ACGDSCTLWWYWLGIKYVEGAY------SWQVYKNCVAL  140
               C           G  +++G Y      +W+VY NCV L
Sbjct  13567  KCK----------GANFLQGMYVGTHVPNWEVYVNCVPL  13481

 Score = 38.9 bits (89),  Expect = 0.020, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 3/46 (7%)
 Frame = -2

Query  48     DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNC  93
              +CG      E QP+P    F    +   GPCEVW D+TKV    NC
Sbjct  12306  ECGWGKVNGEPQPLPDAVEFT---WAHPGPCEVWCDNTKVFYNINC  12178

>PYAP:scaffold_23 pag1_scaffold_23 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_23:1:110862:1 
REF
Length=110862

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = -1

Query  48     DCGLTSPKT-ETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEID  105
              +CG T P +   QP+P+   +       DGPCEVW D+T V     NC   +P G+   +
Sbjct  10845  ECGFTDPNSGPVQPLPNQLEWYGGQMNHDGPCEVWCDNTVVIPFTANCAKTYPTGKFNYN  10666

Query  106    YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
               +AC     L  YW+          WQVY +C  +   A
Sbjct  10665  KAACQGKKRLTMYWMST-----LMEWQVYIDCAKIGGGA  10564

 Score = 36.6 bits (83),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 18/55 (33%), Positives = 25/55 (45%), Gaps = 5/55 (9%)
 Frame = -2

Query  92    NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
             NC   FP G+ + D + C     L  YW+G         WQVY NC  + +  +A
Sbjct  8972  NCAATFPDGKFKYDKAKCVGKKRLTMYWMGT-----LLQWQVYINCAKIGEGGSA  8823

 Score = 34.7 bits (78),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (49%), Gaps = 1/47 (2%)
 Frame = -1

Query  47    FDCGLTSPKT-ETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRN  92
              +CGLT P +   QP+P    +       DGPCEV  DD  V   RN
Sbjct  9099  LECGLTDPTSGPVQPLPDQLEWYGGKMNHDGPCEV*CDDEVVQLCRN  8959

>PYAR:scaffold_480 par_scaffold_480 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_480:1:17633:1 
REF
Length=17633

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 6/69 (9%)
 Frame = +1

Query  76   GPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            GPCE+W+D+T +     C ++FP    EI   +SAC  +CTL +YWL +   +    WQV
Sbjct  133  GPCEIWIDNTMIFHEDECVSRFPAYPAEIPVSFSACKGTCTLTFYWLALHEPQ----WQV  300

Query  134  YKNCVALSK  142
            YK C  +  
Sbjct  301  YKQCALIKN  327

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 6/67 (9%)
 Frame = -2

Query  76     GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              GPCEVW+ +T V     C ++FP    +  + +SAC  +CTL +YWL +   +    WQV
Sbjct  17422  GPCEVWIGNTMVLHEDECVSRFPGFPAEMPVSFSACQGTCTLTFYWLALHEPQ----WQV  17255

Query  134    YKNCVAL  140
              YK C  +
Sbjct  17254  YKQCALI  17234

>PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.460, whole genome 
shotgun sequence
Length=3430

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 7/73 (10%)
 Frame = -3

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
            + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  GPCE+WL
Sbjct  668  NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  507

Query  83   DDTKVAAGRNCHT  95
            DDTKV    +C T
Sbjct  506  DDTKVLYEDDCFT  468

>SADI:scaffold_390 supercont1.390 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.390:1:1004:1 
REF
Length=1004

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 8/64 (13%)
 Frame = -1

Query  76   GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSW  131
            GPCEVWLD+ +V    +C T F   P     +DYS+C GD C L +YW+ +   E    W
Sbjct  860  GPCEVWLDNKRVFQNDDCATNFGDKPAAHLPVDYSSCAGDGCMLRFYWIALHQPE----W  693

Query  132  QVYK  135
            QVY 
Sbjct  692  QVYS  681

>PYUU:scaffold_2033 scf1117875582033 dna:supercontig supercontig:pug:scf1117875582033:1:91152:1 
REF
Length=91152

 Score = 51.6 bits (122),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +3

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              GPCE+WLDD +V    +C   F        ID+S+C  +C L ++WLG++  +    WQV
Sbjct  27753  GPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQV  27926

Query  134    YKNCVALSKTAT  145
              Y      + T +
Sbjct  27927  YSTFTVQTSTIS  27962

 Score = 25.8 bits (55),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 25/49 (51%), Gaps = 9/49 (18%)
 Frame = +1

Query  22     QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS  70
              +E G+ +LR+ ++D+        AL  CG T P    + IPS++    S
Sbjct  27517  KEKGFDTLRSYIEDKG-------AL--CGKTDPNATPKAIPSDNKVHFS  27636

>PYAR:scaffold_1366 par_scaffold_1366 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1366:1:8801:1 
REF
Length=8801

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 53/133 (40%), Gaps = 13/133 (10%)
 Frame = -3

Query  8     EQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
             E    T  +  +  +  G   LR  L+D+            CG +      + IP++   
Sbjct  1635  EGTFKTGAQYAAKAKAEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKI  1483

Query  68    Q-TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYV  125
                S     GPCEVW DD       +C   F       +D+S C  SC L +YWLG++  
Sbjct  1482  SLASTIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--  1309

Query  126   EGAYSWQVYKNCV  138
             +G   WQ Y   V
Sbjct  1308  DGGKRWQSYSTIV  1270

>PYIW:scaffold_270 piw_scaffold_270 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_270:1:22416:1 
REF
Length=22416

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = +1

Query  76     GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGI  122
              GPCEVW+D+ ++  G +C  QFP       +D+SAC   CTL +YWL +
Sbjct  16951  GPCEVWIDNKRMFHGDDCRAQFPGFPAAVPVDFSACKGKCTLTFYWLAL  17097

>PYUU:scaffold_1789 scf1117875581789 dna:supercontig supercontig:pug:scf1117875581789:1:837833:1 
REF
Length=837833

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 58/144 (40%), Gaps = 42/144 (29%)
 Frame = +2

Query  22      QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP---------SNSSFQTSGY  72
               ++ GY +LR+ L+++            CG T P T  + IP         SN  F     
Sbjct  698210  KQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPVR  698362

Query  73      T--------------LD------GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACG  110
               T              LD      GPCE+WLD+  +    NC   FP       +D+S+C 
Sbjct  698363  TAT*MSLSCCCMKAHLDVSRFPQGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCK  698542

Query  111     DSCTLWWYWLGIKYVEGAYSWQVY  134
                +C L  YWLG +  +    WQ Y
Sbjct  698543  GTCMLRMYWLGFQ--DQGQRWQTY  698608

>PYAP:scaffold_74 pag1_scaffold_74 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_74:1:72664:1 
REF
Length=72664

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 37/69 (54%), Gaps = 9/69 (13%)
 Frame = -3

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
             GPCEVW+DD KV    +C  +F  GQ      +D+S C   C L +YW+ +   +    W
Sbjct  2366  GPCEVWIDDNKVFHDDDCSAKF-DGQFPASIPVDFSKCKGKCELTFYWIALHQAQ----W  2202

Query  132   QVYKNCVAL  140
             Q+YK C  +
Sbjct  2201  QLYKQCAPI  2175

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 59/134 (44%), Gaps = 30/134 (22%)
 Frame = -2

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-----  75
              ++  Y S++ M+D           + DCG T   T+ +P+   S  ++  +  D     
Sbjct  3894  FKQSSYKSIKEMMD---------PVVADCGNTL--TDGEPV-DVSGMKSVKWANDQERVG  3751

Query  76    ------GPCEVWLDDTKV-AAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVE  126
                   GPCEVW+D+  V     +C  +F     +  +DYS C   C L +YWL +    
Sbjct  3750  FVKSHTGPCEVWIDNKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLALH---  3580

Query  127   GAYSWQVYKNCVAL  140
                +WQVYK C  +
Sbjct  3579  -EPNWQVYKQCAPI  3541

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 35/68 (51%), Gaps = 7/68 (10%)
 Frame = -3

Query  76   GPCEVWLDDTKV-AAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
            GPCEVW+D+  V     +C  +F     +  +DYS C   C L +YWL +       +WQ
Sbjct  854  GPCEVWIDNKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLALH----EPNWQ  687

Query  133  VYKNCVAL  140
            VYK C  +
Sbjct  686  VYKQCAPI  663

>PLHA:NW_020188786.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1878, whole genome shotgun sequence
Length=366298

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = +3

Query  25      GYASLRAML-DDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
               GY SL   +  ++ LY  +++   DCGLT+ K T    +P+  ++  SG+T  GPCEV  
Sbjct  242514  GYKSLGDFITKNQELY--SDKMSPDCGLTTFKDTARSKLPAQLTY--SGFTHPGPCEVRC  242681

Query  83      DDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
               DDT V +  +C T+F         D + C ++  +  YWL +        WQVY NC
Sbjct  242682  DDTIVLSENDCQTKFSAIPAIMSYDKAKCANANRMTIYWLALH----GDPWQVYTNC  242840

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 68/133 (51%), Gaps = 14/133 (11%)
 Frame = +2

Query  10      GVNTSIEAQSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQ-PIPSNSSF  67
               G   +I+A   +   G  SL A +  ++ LY  +++    CGLT+ K  ++  +P+    
Sbjct  244352  GAVNTIKAN--LDTKGGGSLNAFISKNQKLY--SDQIDPHCGLTTYKEGSRSKLPAQ--L  244513

Query  68      QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
               + +G+T  GPCE+  DD KV    +C  ++P    +I Y  + C ++  +  +W+ +   
Sbjct  244514  EYTGFTHPGPCEIRCDDEKVLFEYDCQAKYPAIPAKIPYDKAKCANANRMTIHWIAVHAT  244693

Query  126     EGAYSWQVYKNCV  138
               E    WQVY +CV
Sbjct  244694  E----WQVYTDCV  244720

>PYVX:scaffold_622 pve_scaffold_622 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_622:1:17888:1 
REF
Length=17888

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 43/94 (46%), Gaps = 12/94 (13%)
 Frame = +1

Query  55    KTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDY  106
             KTE+  I   +S  +    L GPCE+W DDT    G NC  ++P G           +DY
Sbjct  2056  KTESLSILMVASPLSRCNCL*GPCEIWFDDTLALRGDNCENEYPGGAVGSTDYSAIPVDY  2235

Query  107   SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             S C   C L +YWLG +       WQ Y   +A 
Sbjct  2236  SLCKGDCVLRFYWLGFQNA----MWQSYSEDLAF  2325

>PYIR:scaffold_1361 pir_scaffold_1361 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1361:1:7810:1 
REF
Length=7810

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 36/72 (50%), Gaps = 4/72 (6%)
 Frame = -1

Query  67    FQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVE  126
              + SG+   GPCE W D  K+A   +C  ++  G   ID S C  +  L  YWL +  V 
Sbjct  4420  IKHSGFFHPGPCEAWCDGNKIAYDVDCSKKYASGSIPIDASKCSGADKLSLYWLAVHGVP  4241

Query  127   GAYSWQVYKNCV  138
                 WQVY +CV
Sbjct  4240  ----WQVYSDCV  4217

>PHKE:scaffold_884 scf_22126_884.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_884.1_contig_1:1:6277:1 
REF
Length=6277

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 12/73 (16%)
 Frame = -2

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQHE--------IDYSACGDSCTLWWYWLGIKYVEG  127
             GPCEV++DD  V  G NC  ++P G  E        IDYS+C   C L +YWLG +  + 
Sbjct  3858  GPCEVYIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ-  3682

Query  128   AYSWQVYKNCVAL  140
                WQ Y   + +
Sbjct  3681  ---WQSYGKLMRI  3652

>PYAP:scaffold_793 pag1_scaffold_793 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_793:1:13419:1 
REF
Length=13419

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
 Frame = +3

Query  48    DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDY  106
             +CG + PK   QP+P    F T G+   GPCE + D+  V     +C   +P G    D 
Sbjct  2964  ECGYSDPKGTPQPLPEKIQFHT-GFMHWGPCEAYCDNVLVTKHAADCKVAYPGGAVPYDK  3140

Query  107   SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
             + C       +YWLG+     A  WQ Y    A S
Sbjct  3141  AKCAGKKQFKFYWLGMDSGNSA-PWQAYGKSFAFS  3242

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 42/91 (46%), Gaps = 6/91 (7%)
 Frame = +1

Query  49    CGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYS  107
             CG + PK   QP+P    F T G+   GPCE + DD  V     +C   +P G    D +
Sbjct  1129  CGYSDPKGTPQPLPEKIQFHT-GFIHWGPCEAYCDDVLVTKHTADCRAAYPAGAVPYDKA  1305

Query  108   ACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
              C       ++WL +   +G+  WQVY   +
Sbjct  1306  KCAGKKQFTFWWLTM---DGS-PWQVYSTSL  1386

>PYIW:scaffold_360 piw_scaffold_360 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_360:1:20022:1 
REF
Length=20022

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 58/130 (45%), Gaps = 11/130 (8%)
 Frame = +2

Query  22    QEHGYASLRA-MLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGP  77
             +++G+ SLRA ++D+++  K   +      +CG T P    QP+P    +    +  +GP
Sbjct  2720  KKNGFKSLRAFIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGP  2899

Query  78    CEVWLDDTKVAAGRNCHTQFPHG---QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             CE W DD  V         +  G   Q   D + C     L +YWL   +V     +Q Y
Sbjct  2900  CEAWCDDVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLAT-FVS---PFQAY  3067

Query  135   KNCVALSKTA  144
              NCV +   A
Sbjct  3068  TNCVPIKSGA  3097

>PYVX:scaffold_1070 pve_scaffold_1070 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1070:1:7524:1 
REF
Length=7524

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 51/126 (40%), Gaps = 9/126 (7%)
 Frame = -3

Query  21    MQEHGYASLRAMLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGP  77
               E  Y SL+ + D     +       A  +CG +      + +P    +       DGP
Sbjct  1726  FNESTYTSLKDLADQTMEMQTLSPFGTATKECGFSLANGTARALPEYVEWNQFTTGHDGP  1547

Query  78    CEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
             CEVW DDT      NC   +P    ++ Y  S C  +  L  YW+ +        WQVY 
Sbjct  1546  CEVWCDDTLAFQDDNCAVNYPDDPAKLPYDISKCTGASMLTSYWIALH----GLPWQVYI  1379

Query  136   NCVALS  141
             NCV L+
Sbjct  1378  NCVPLN  1361

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 6/99 (6%)
 Frame = -1

Query  45    ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI  104
             A  +CG +      + +P+   +     + +GPCEVW DDT+V    NC   +     ++
Sbjct  4464  ATKECGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTRVFEDWNCAVDYTTSPAKL  4285

Query  105   DYSA--CGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
              Y A  C  +  L   WL +     A  WQVY NC  LS
Sbjct  4284  PYDASKCEGAKMLTSIWLALH----ALPWQVYTNCAPLS  4180

 Score = 45.8 bits (107),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 34/69 (49%), Gaps = 6/69 (9%)
 Frame = -3

Query  75    DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
             DGPCE+W D+T V + +NC   +P       Y  S C  +  L   WL +     +  WQ
Sbjct  6220  DGPCEIWCDETLVFSDQNCAVNYPDDPAVFPYDKSKCEGASMLTAIWLALH----SPPWQ  6053

Query  133   VYKNCVALS  141
             V+ NC  L+
Sbjct  6052  VFTNCAPLT  6026

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 42/99 (42%), Gaps = 8/99 (8%)
 Frame = -2

Query  45    ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNC---HTQFPHGQ  101
             A  +CG +      + +P    +     +  GPCEVW DDT V    NC   +T  P  Q
Sbjct  3164  ATAECGYSLADGTARDLPEYVEWNQLTSSHQGPCEVWCDDTLVFENWNCAYTYTADP-AQ  2988

Query  102   HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                D S C  +  L  YW+ +        WQVY NC  L
Sbjct  2987  LPYDASKCEGASMLTSYWIALH----GLPWQVYTNCAPL  2883

 Score = 31.6 bits (70),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 18/73 (25%), Positives = 34/73 (47%), Gaps = 3/73 (4%)
 Frame = -3

Query  13   TSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
            T+  A  +     + +   +L+ +S++     A  +CG +      + +P+   +   G 
Sbjct  214  TAFNASKYTSLKDFVTQTEVLESQSVFGT---ATKECGFSLANGTARDLPTAVQWTGFGD  44

Query  73   TLDGPCEVWLDDT  85
            +  GPCEVW DDT
Sbjct  43   SHHGPCEVWCDDT  5

>PHRA:scaffold_532
Length=10654

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 51/118 (43%), Gaps = 8/118 (7%)
 Frame = +2

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDT  85
             Y SL+ +  D     + + A  +CG +      Q +P+   +     +  GPCEVW DDT
Sbjct  2078  YKSLKELAWDSQ--TLADGASNECGFSVVDGAAQDLPAEVQWDFFTASHQGPCEVWCDDT  2251

Query  86    KVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
              V    NC   +P     + Y  + C  S  L  YW+ +        WQVY NC  L+
Sbjct  2252  LVFENWNCAVDYPETPANLPYDKAKCASSSVLTSYWIALHTTP----WQVYTNCAPLT  2413

>PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.76, whole genome shotgun 
sequence
Length=282732

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 7/71 (10%)
 Frame = +1

Query  18     QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
              +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  G
Sbjct  43780  KSLKSANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  43941

Query  77     PCEVWLDDTKV  87
              PCE+WLDDTKV
Sbjct  43942  PCEIWLDDTKV  43974

>PYAR:scaffold_593 par_scaffold_593 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_593:1:15936:1 
REF
Length=15936

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = -2

Query  92     NCHTQFPHGQ---HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
              NC+  FP GQ   +++D+S C   CT+ WYWL  + +   +SWQ YK C+ +S    A
Sbjct  15929  NCNKDFP-GQPVSYKVDFSVCKGDCTIHWYWLAKRLIGKKWSWQAYKECIPISGGGAA  15759

>PLHA:NW_020188562.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1651, whole genome shotgun sequence
Length=1372582

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 46/101 (46%), Gaps = 6/101 (6%)
 Frame = +2

Query  40      KVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH  99
               K+ + A  +CG +    E Q +P    +   G+   GPCEV  DD  V    NC   F  
Sbjct  921446  KLEKGASKECGFSLVDGEPQELPDKVEWD--GFIHYGPCEVHCDDKLVFQNWNCAIDFKD  921619

Query  100     GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               G+   D +AC  +  L  YW+G+        WQ+Y NC  +
Sbjct  921620  GKLPYDKAACAGASVLTSYWIGLHTTP----WQIYTNCAPI  921730

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (47%), Gaps = 6/103 (6%)
 Frame = +3

Query  40      KVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH  99
               K+ + A  +CG +    + Q +P    +    Y+  GPCEVW DD +V    NC   +  
Sbjct  929250  KLEKGASNECGFSLVDGQPQELPEMVEWDAFSYSHMGPCEVWCDDKRVFQNWNCGVDYTE  929429

Query  100     GQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                  ++ Y  ++C  +  L  YW+ +  V     WQ+Y NC  +
Sbjct  929430  TPAKLPYDKASCEGAAVLSCYWIAVHTVP----WQIYTNCAPI  929546

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 41/101 (41%), Gaps = 6/101 (6%)
 Frame = -2

Query  48      DCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY-  106
               +CG +      + +P    +   G +  GPCE+W D       +NC   +P     + Y 
Sbjct  906270  ECGHSIVNGTARELPDKVKWLAFGLSHQGPCEIWCDKKLAFMDKNCALNYPQDPALLPYD  906091

Query  107     -SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                  C  +  +  YW+ +        WQ+Y NCV L    T+
Sbjct  906090  IKICIGAKMMQAYWIALH----GLPWQLYLNCVPLKSDGTS  905980

 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 52/125 (42%), Gaps = 17/125 (14%)
 Frame = +1

Query  26      YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF--------QTSGYTLDGP  77
               Y S + M+ D  +  V++ A  DCG T+ +  T    +++ +        +  G   +G 
Sbjct  904546  YKSFKEMIMDNQVL-VSKRATADCGFTTTEKVTYGSLNDTIYWGREFDITKGEGLVHEGV  904722

Query  78      CEVWLDDTKVAAGRNCHTQFPHGQHE----IDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
               CE W ++ +V    NC   +          ID + C  +  L +YW+ +        WQV
Sbjct  904723  CESWCENVRVQQDTNCMVTYKAASGSSPIPIDKAKCASAKRLTFYWIAMH----GPIWQV  904890

Query  134     YKNCV  138
               Y   V
Sbjct  904891  YSKLV  904905

>PHRA:scaffold_44
Length=415431

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 53/126 (42%), Gaps = 10/126 (8%)
 Frame = -3

Query  26     YASLRAML---DDESLYKVTEEALFDCGLTSPKT-ETQPIPSNSSFQTSGYTLDGPCEVW  81
              Y+SL+  L    D S  + T     +CG T P +    P+P    +       DGPCEVW
Sbjct  72298  YSSLKEFLLTNQDMSKGRFTMPKTPECGFTDPTSGPVVPLPQELEWYGGKMNHDGPCEVW  72119

Query  82     LDDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               D+  V     NC   +P G+   + + C     L  YW+          WQVY +C  +
Sbjct  72118  CDNEIVLPFTANCAVTYPEGKFPYEKAKCEGKSRLTLYWMST-----LLEWQVYIDCAKI  71954

Query  141    SKTATA  146
               +  +A
Sbjct  71953  GEGGSA  71936

>PHCA:scaffold_3 PHYCAscaffold_3
Length=1611504

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 61/140 (44%), Gaps = 11/140 (8%)
 Frame = -1

Query  8       EQGVNTSIEAQSWMQEHGYASLRA-MLDDESLYK--VTEEALFDCGLTSPKT-ETQPIPS  63
               + G+N +   +++ +   Y SL+  +LD++ + K   T     +CG T P     QP+P 
Sbjct  448032  DAGLNAAAFGRAF-KASKYTSLKEFLLDNQDMSKGRFTMPKTPECGFTDPTGGAVQPLPD  447856

Query  64      NSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                  +       DGPCE+W D+  V     NC   +P G+     + C     L  YW+  
Sbjct  447855  QVEWYGGKMNHDGPCEIWCDNEIVLPFTANCAVTYPEGKFPYQKAKCEGKKRLTMYWMST  447676

Query  123     KYVEGAYSWQVYKNCVALSK  142
                       WQVY +C  + +
Sbjct  447675  -----LMEWQVYIDCAKIGE  447631

>PHRA:scaffold_14
Length=678508

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 49/112 (44%), Gaps = 8/112 (7%)
 Frame = +1

Query  36      ESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNC  93
               E +  + + A   CG T         PSN   +F  S   + GPCE+WLDD   A   NC
Sbjct  384958  EGIKDLADVAGSTCGNTDADAAAVTAPSNDLVTFDVSAVHI-GPCELWLDDILAANATNC  385134

Query  94      HTQFPHGQHEIDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                  +      +DYS C  S C + W WL          W+++ NCV +  TA
Sbjct  385135  WATYTDKTIPLDYSQCTSSQCRVRWVWLATHNDP----WEIFDNCVNVVGTA  385278

>PYAR:scaffold_505 par_scaffold_505 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_505:1:17100:1 
REF
Length=17100

 Score = 52.0 bits (123),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 8/125 (6%)
 Frame = +2

Query  21   MQEHGYASLRA-MLDDESLYKVTEE---ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDG  76
             +++G+ SL+  +++++ + K          +CG T P  + QP+P    + +  +   G
Sbjct  194  FKKNGFTSLKKWIMENQVVGKYDGRPSGGTPECGYTDPNGKEQPLPPQLKWPSPTFQHPG  373

Query  77   PCEVWLDDTKVAAGR-NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            PCE W DD  V   + +C+     G  + D + C     L +Y+L +   E    +QVY 
Sbjct  374  PCEAWCDDEVVIPYQASCNAYAKQGLMDYDKAKCVGKKMLSFYYLAVHVAE---PFQVYA  544

Query  136  NCVAL  140
            +CV L
Sbjct  545  SCVRL  559

>PYIW:scaffold_3644 piw_scaffold_3644 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3644:1:2839:1 
REF
Length=2839

 Score = 51.6 bits (122),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 53/122 (43%), Gaps = 8/122 (7%)
 Frame = -3

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEV  80
             ++   Y SL+A+    +  K    A  +CG +      QP+P    +     + +GPCEV
Sbjct  1733  LKASSYGSLKALA--FATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEV  1560

Query  81    WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
             W D+T    G NC   +     ++ Y  S C  +  L   WL +       +WQVY NC 
Sbjct  1559  WCDNTMAFHGDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLALHTP----TWQVYTNCA  1392

Query  139   AL  140
              +
Sbjct  1391  PI  1386

>PYAP:scaffold_744 pag1_scaffold_744 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_744:1:14808:1 
REF
Length=14808

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 55/124 (44%), Gaps = 12/124 (10%)
 Frame = +3

Query  26    YASLRAMLDDESLYKVTEEALFDCGLT-SPKTETQPIPSNSSFQ---TSGYTL--DGPCE  79
             Y +LR  +      +V+     +CG T S     QP+P    +Q     G+T   +GPCE
Sbjct  4515  YKTLREFVLKNQRLEVSSVITPECGRTKSDSGNPQPLPEMIVWQHGEGEGFTPSHEGPCE  4694

Query  80    VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
             +W D+T+V    NC   +P     + Y  S C     L   WL +        WQVY NC
Sbjct  4695  IWCDETRVFHEANCARTYPQAPAMLPYDRSRCVGKNRLQLLWLALHEPR----WQVYVNC  4862

Query  138   VALS  141
              +++
Sbjct  4863  ASVA  4874

>PHKE:scaffold_279 scf_22126_279.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_279.1:1:48404:1 
REF
Length=48404

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 45/108 (42%), Gaps = 8/108 (7%)
 Frame = -3

Query  36     ESLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGYTLDGPCEVWLDDTKVAAGRNC  93
              E +    + A   CG T      Q  PSN       S   + G CEVWLD   +A   +C
Sbjct  48072  EGIKDFADAAGSICGNTDANATAQTAPSNGQVILDISAVHI-GSCEVWLDAALMANASDC  47896

Query  94     HTQFPHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               T +      +DYS C G  C L W WL          W+++ NCV +
Sbjct  47895  WTAYTDNTIPVDYSKCTGSQCQLRWVWLATHNDP----WEIFDNCVNI  47764

>PYIW:scaffold_50 piw_scaffold_50 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_50:1:37410:1 
REF
Length=37410

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 14/96 (15%)
 Frame = -1

Query  48    DCG---LTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI  104
             +CG   LT PK   QP+P+   F    +   GPCE W DDTK+ A  +C      G+ ++
Sbjct  1482  ECGKTLLTGPK---QPVPAEIDFP---WGHPGPCEAWCDDTKIFANEDCLGNN-VGKIKV  1324

Query  105   DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             D S C ++  L   + G+ +VE   ++++Y NCV L
Sbjct  1323  DKSKCTNAKRLQVMYAGV-HVE---NYEIYSNCVPL  1228

 Score = 39.7 bits (91),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 5/86 (6%)
 Frame = +2

Query  38     LYK-VTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQ  96
              +YK  T  A   CG T      Q +P    F    +   GPCE W DDT++ +   C   
Sbjct  15224  VYKYATTTADMACGKTVQTGPKQDVPDEIDFP---WNHLGPCEAWCDDTRIFSNEECQGN  15394

Query  97     FPHGQHEIDYSACGDSCTLWWYWLGI  122
                 G+ ++D S C ++  L   ++G+
Sbjct  15395  -KVGKIKVDKSKCANAKRLQVMYVGV  15469

>PYVX:scaffold_698 pve_scaffold_698 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_698:1:15486:1 
REF
Length=15486

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 39/73 (53%), Gaps = 8/73 (11%)
 Frame = +1

Query  74     LDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
              L GPCE W+  T+V    +C   +T +P  +  IDYS+C   C   +YWL +       +
Sbjct  13120  L*GPCEAWIGKTRVFHSDDCAAAYTGYP-AEIPIDYSSCSGDCDFTFYWLALHEP----N  13284

Query  131    WQVYKNCVALSKT  143
              WQVYK C  +S +
Sbjct  13285  WQVYKQCAPISNS  13323

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 8/70 (11%)
 Frame = +1

Query  74     LDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
              + GPCE+W+DDT+V    +C    T FP  +   DYS+C   C + +YWL +       +
Sbjct  15187  MQGPCELWIDDTRVWHYDDCAGDFTSFP-AKVPTDYSSCNGDCLVVFYWLALH----EPN  15351

Query  131    WQVYKNCVAL  140
              WQ+Y     L
Sbjct  15352  WQIYSTFACL  15381

>PYIR:scaffold_630 pir_scaffold_630 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_630:1:19253:1 
REF
Length=19253

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 54/121 (45%), Gaps = 19/121 (16%)
 Frame = +3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS------NSSFQTSGY--TLDGP  77
              Y  ++ M+    +  V   A  DCG ++PKT+ Q + S      N+     G+  + +GP
Sbjct  12462  YNDIKTMILKNQV--VVSGATADCGFSTPKTK-QTLSSSVWWGKNTDLTGEGFVESHEGP  12632

Query  78     CEVWLDDTKVAAGRNCHTQF----PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              CE W DD  V    NC T +       +  ID S C  +    +YW+ +   E    WQV
Sbjct  12633  CEAWCDDVMVMQNTNCATAYNTAGKAAEVPIDNSKCSGASQFTFYWIAMHTNE----WQV  12800

Query  134    Y  134
              Y
Sbjct  12801  Y  12803

>PYAP:scaffold_10 pag1_scaffold_10 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_10:1:143185:1 
REF
Length=143185

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 48/119 (40%), Gaps = 9/119 (8%)
 Frame = +2

Query  26     YASLRAMLDDESLYKVTEEAL---FDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
              Y SL+  L     +    + +    +CG T P +  Q +P    +       DGPCEVW 
Sbjct  54341  YKSLKEFLMKHQTFNEGRDNMPRTLECGFTDPTSGVQQLPDQLEWYGGKMNHDGPCEVWC  54520

Query  83     DDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              DD  V     NC   +P G+ + D +       L  YW+          WQVY +C  +
Sbjct  54521  DDEIVLPFTANCAATYPDGKFKYDKAK*VGKKRLTMYWMAT-----LLQWQVYIDCAKI  54682

>PYAR:scaffold_4887 par_scaffold_4887 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4887:1:1921:1 
REF
Length=1921

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 60/137 (44%), Gaps = 20/137 (15%)
 Frame = -1

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFD-----------CGLTSPKTETQPIPSNSSFQ  68
            W  +   A+ +   + ++ YK   + ++D           CG ++     Q +P    + 
Sbjct  688  WNYDQNQAAYQKAFESQTKYKTLRDLVYDKFVPNGASTKECGFSAMTGTPQSLPDYVEYA  509

Query  69   TSGYTLD--GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKY  124
            T G++    GPCEVW D+T+V    NC   +P    ++ Y  + C  +  L  +WL +  
Sbjct  508  T-GFSESHWGPCEVWCDNTRVFVDPNCRISYPTRPAKLPYDMAKCIGAKRLQTFWLALHE  332

Query  125  VEGAYSWQVYKNCVALS  141
             +    WQVY  C  L+
Sbjct  331  PK----WQVYTACATLN  293

>PYIR:scaffold_452 pir_scaffold_452 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_452:1:24914:1 
REF
Length=24914

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/157 (23%), Positives = 61/157 (39%), Gaps = 48/157 (31%)
 Frame = +2

Query  22     QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSG----------  71
              +E G+A+LR+ L+D+            CG T P    + IP++   + S           
Sbjct  23876  KEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPADRKVRFSRDISHPVRANI  24028

Query  72     -------------------------YTLDGPCEVWLDDTKVAAGRNCHTQFPH--GQHEI  104
                                        ++ GPCE+W+DD +V    +C + F       ++
Sbjct  24029  WCCLTQTRSACAELTRFVLSLTHWLLSM*GPCELWIDDKRVYQNDDCESAFTGVVPSWDV  24208

Query  105    DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
              D++ C   C + +YWL ++       WQVY     LS
Sbjct  24209  DWALCSGKCMIRFYWLSLQ--ASGTRWQVYSKWTRLS  24313

>PYVX:scaffold_496 pve_scaffold_496 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_496:1:22231:1 
REF
Length=22231

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 2/56 (4%)
 Frame = -2

Query  73     TLDGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVE  126
              +L GPCEVWLDD  ++   NC  Q+P    Q+ +D S+C  SC L  Y L +   E
Sbjct  10380  SLQGPCEVWLDDAMISRSWNCREQYPGAPAQYLVDLSSCNGSCLLQVYALELSRSE  10213

>PYIR:scaffold_548 pir_scaffold_548 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_548:1:21425:1 
REF
Length=21425

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 14/115 (12%)
 Frame = +1

Query  28     SLRAMLDDESLYK-VTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTK  86
              +LRA++     YK  T     +CG T      QP+P+   F    +   GPCE W DD K
Sbjct  15700  TLRALI-----YKYATTTDDIECGKTLLDGPKQPVPAEIDFP---WGHPGPCEAWCDDVK  15855

Query  87     VAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
              + A  +C      G+ ++D S C ++  L   + G+ +VE   ++++Y NCV L+
Sbjct  15856  IFADGDCQGNN-VGKIKVDQSKCTNAKRLQVMYAGV-HVE---NYEIYSNCVPLT  16005

>PYAR:scaffold_3173 par_scaffold_3173 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3173:1:3694:1 
REF
Length=3694

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 30/67 (45%), Gaps = 6/67 (9%)
 Frame = +1

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
             GPCEVW DD       NC   FP    ++ Y  S C     L  YWL +   E    WQV
Sbjct  2149  GPCEVWCDDEMAFHDDNCAKNFPAAPAKLPYDKSKCEGKKKLATYWLALHSPE----WQV  2316

Query  134   YKNCVAL  140
             Y  C AL
Sbjct  2317  YIGCAAL  2337

>PHKE:scaffold_191 scf_22126_191.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_191.1:1:65316:1 
REF
Length=65316

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 46/121 (38%), Gaps = 39/121 (32%)
 Frame = -3

Query  49     CGLTSPKTETQPIPSNSSF-----QTSGYT----------------------LDGPCEVW  81
              CG T P  + QPIPS+        +  G+T                      L GPCE++
Sbjct  12748  CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTVRSATKLIILLRD*Y*ETVSLQGPCEIY  12569

Query  82     LDDTKVAAGRNCHTQFPHG--------QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
              LDD  V    +C  +F  G           +DYS+C   C    YWL  +  +    WQ 
Sbjct  12568  LDDKMVLHSDDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQT  12401

Query  134    Y  134
              Y
Sbjct  12400  Y  12398

>PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.8, whole genome shotgun 
sequence
Length=1889443

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 56/140 (40%), Gaps = 11/140 (8%)
 Frame = -2

Query  8        EQGVNTSIEAQSWMQEHGYASLRAML---DDESLYKVTEEALFDCGLTSPKT-ETQPIPS  63
                + G+N +   +++     Y SL+  L    D S  + T     +CG T P     QP+P 
Sbjct  1816722  DAGLNAAAFGRAFKASK-YKSLKEFLLTNQDMSKGRNTMPKTPECGFTDPTGGPVQPLPD  1816546

Query  64       NSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                   +        GPCE+W DD  V     NC   +P G+     + C     L  YW+  
Sbjct  1816545  QCEWYGGKMNHPGPCEIWCDDEIVLPFTVNCADTYPDGKFPYKKAMCEGKKRLTMYWMST  1816366

Query  123      KYVEGAYSWQVYKNCVALSK  142
                        WQVY +C  + +
Sbjct  1816365  -----LLEWQVYIDCAKIGE  1816321

>PYAP:scaffold_209 pag1_scaffold_209 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_209:1:44730:1 
REF
Length=44730

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 37/69 (54%), Gaps = 9/69 (13%)
 Frame = +1

Query  76    GPCEVWLDDTKVAAGR-NC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
             GPCEVW+D+  V     NC   +T +P  +  +DYS C   C L +YWL +       +W
Sbjct  2569  GPCEVWIDNKMVFQELGNCVEKYTSYP-AELPVDYSVCKGKCQLTFYWLALH----EPNW  2733

Query  132   QVYKNCVAL  140
             Q+YK C  +
Sbjct  2734  QIYKQCAPI  2760

>PYIW:scaffold_5060 piw_scaffold_5060 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_5060:1:1596:1 
REF
Length=1596

 Score = 48.9 bits (115),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 49/120 (41%), Gaps = 10/120 (8%)
 Frame = +3

Query  26   YASLRAML---DDESLYKVTEEALFDCGLTSPKT-ETQPIPSNSSFQTSGYTLDGPCEVW  81
            Y +L+  +    D S  + +     +CG T P     Q +P    +   G    GPCEVW
Sbjct  303  YKTLKEFILKNQDMSKGRFSNPKTPECGFTDPTGGAVQTLPDQLEWYGGGMNHPGPCEVW  482

Query  82   LDDTKVAA-GRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             D+  V     NC   +P G+ + D + C     L  YWL          WQVY +C  +
Sbjct  483  CDNEIVVPYTANCVATYPQGKIKYDKAKCVGKNRLTLYWLST-----ILEWQVYIDCAKI  647

>PHKE:scaffold_715 scf_22126_715.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_715.1:1:10757:1 
REF
Length=10757

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 12/67 (18%)
 Frame = +3

Query  76    GPCEVWLDDTKVAAGRNCHTQFPHG--------QHEIDYSACGDSCTLWWYWLGIKYVEG  127
             GPCEV+++D  V  G +C  ++P G        +  IDYS+C   CTL  YWL  +  + 
Sbjct  3183  GPCEVYINDKMVLHGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ-  3359

Query  128   AYSWQVY  134
                WQ Y
Sbjct  3360  ---WQAY  3371

>SADI:scaffold_2 supercont1.2 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.2:1:1527201:1 
REF
Length=1527201

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 4/66 (6%)
 Frame = +1

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
                GPCE+W D+T+V    NC      G   ID + C  + TL ++WL +     + SWQVY 
Sbjct  1020187  GPCELWCDNTRVYDNENCAKNIADGSMPIDTAKCAGAKTLRFFWLALH----SSSWQVYS  1020354

Query  136      NCVALS  141
                  + L+
Sbjct  1020355  T*LLLA  1020372

 Score = 40.8 bits (94),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (7%)
 Frame = -2

Query  76       GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
                GPCE+W D+T++    +C    P G   ID S C  +  L   W+ +   +    WQ Y
Sbjct  1076354  GPCELWCDETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTMLWMALHTPQ----WQAY  1076190

>PYVX:scaffold_1640 pve_scaffold_1640 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1640:1:2714:1 
REF
Length=2714

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 58/142 (41%), Gaps = 9/142 (6%)
 Frame = -2

Query  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
             ++Y  +   NT    Q++ +   Y SL+ +        +   A  +CG +      Q +
Sbjct  679  GMSYNTDPASNTKAYLQAF-KASSYTSLKDLA--FKTQTLVSPASNECGFSVVDGTKQDL  509

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYW  119
            P+   +     +  GPCEVW DD       NC   +P    E+ Y  S C  +  L   W
Sbjct  508  PATVQWDFFTASHQGPCEVWCDDVLAFQDDNCAVSYPETPAELPYDKSKCEGASVLMSIW  329

Query  120  LGIKYVEGAYSWQVYKNCVALS  141
            + +     +  WQVY NC  L+
Sbjct  328  IALH----SPPWQVYTNCAPLT  275

>PYVX:scaffold_155 pve_scaffold_155 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_155:1:43137:1 
REF
Length=43137

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 6/63 (10%)
 Frame = +2

Query  74     LDGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
              L GPCE W+DD +V    +C + +     +  IDYS+C   CT  +YWL +   E    W
Sbjct  42071  LQGPCEAWIDDKRVFQSFDCASVYKAYPAEIPIDYSSCTGDCTFTFYWLPLHEPE----W  42238

Query  132    QVY  134
              Q++
Sbjct  42239  QIF  42247

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 39/79 (49%), Gaps = 16/79 (20%)
 Frame = +1

Query  76     GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLG------------  121
              GPCE W+D+T+V +   C   FP    E  ID+S+C   CT  +YWL             
Sbjct  40477  GPCEAWVDNTRVFSSDCCCRDFPAYPAEIPIDFSSCRGDCTFTFYWLALHEXXXXXXXXX  40656

Query  122    IKYV--EGAYSWQVYKNCV  138
              ++YV   G  SW  YK+ V
Sbjct  40657  LQYVCRPGFLSWLAYKSRV  40713

>PHRA:scaffold_555
Length=10086

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 10/71 (14%)
 Frame = +3

Query  74    LDGPCEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS-CTLWWYWLGIK-  123
             + GPCE+WLDDT V    +C   F    +         IDYS+C  S C   +YWL  + 
Sbjct  9780  VQGPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQG  9959

Query  124   YVEGAYSWQVY  134
                G Y WQ+Y
Sbjct  9960  STSGKYVWQIY  9992

>PYAP:scaffold_983 pag1_scaffold_983 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_983:1:9183:1 
REF
Length=9183

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 6/113 (5%)
 Frame = -3

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDT  85
             Y SL+  +    +         +CG T  K E +  P +S+ + S +   GPCEVW D+T
Sbjct  3919  YESLKDFILGTQIMTPGLNGSPECGFTI-KDEKKRSPISSTVKHSSFFHPGPCEVWCDNT  3743

Query  86    KVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
             K+A   +C + +      ID S C  +  L  YW  +        WQ Y  CV
Sbjct  3742  KLAYALDCQSTY-GSSIPIDASKCKGADRLTLYWTAVH----GSPWQNYIYCV  3599

>PYIR:scaffold_2122 pir_scaffold_2122 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2122:1:3740:1 
REF
Length=3740

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 40/95 (42%), Gaps = 7/95 (7%)
 Frame = +2

Query  48    DCGLTSPKT-ETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEID  105
             +CG T P +   Q +P    +        GPCEVW D+  V     NC   FP G+ + D
Sbjct  2033  ECGFTDPTSGAVQALPDQLEWYGGQMNHPGPCEVWCDNEVVIPFTANCQAAFPSGKMKYD  2212

Query  106   YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              + C     L  YW+          WQVY +C  +
Sbjct  2213  KAKCVGKSRLTLYWMST-----LNEWQVYIDCAKI  2302

>PHKE:scaffold_376 scf_22126_376.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_376.1_contig_1:1:35422:1 
REF
Length=35422

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 55/128 (43%), Gaps = 28/128 (22%)
 Frame = +3

Query  26     YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQT--------SGY--TLD  75
              YASLRA+L         E  + DCG T  + +  P     + +          G+  +  
Sbjct  26532  YASLRALL---------EPVVTDCGNT--RIDISPFNVTGATEMRWQNDQEHKGFIDSHH  26678

Query  76     GPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDY-SACGDSCTLWWYWLGIKYVEGAYSWQ  132
              GPCEVW+D  +V    +C   F     +  +DY S C   C+  +YWL +       SWQ
Sbjct  26679  GPCEVWIDKHRVLHNNDCRATFTSYPARLPVDYDSLCKGECSFTFYWLALH----EPSWQ  26846

Query  133    VYKNCVAL  140
              VY    AL
Sbjct  26847  VYSKYCAL  26870

>PYUU:scaffold_2031 scf1117875582031 dna:supercontig supercontig:pug:scf1117875582031:1:1316296:1 
REF
Length=1316296

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 7/95 (7%)
 Frame = -3

Query  48     DCGLTSP-KTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEID  105
              +CG T P K   Q +P    +        GPCEVW D+  V     +C   +P G+   +
Sbjct  83819  ECGFTDPNKGPVQALPDKLEWYGGRMNHPGPCEVWCDNEVVVPFTADCAATYPQGKISYN  83640

Query  106    YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
               + C     L  YW+          WQVY +C  +
Sbjct  83639  KAKCTGKSRLTLYWMST-----LMEWQVYIDCAKI  83550

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 43/114 (38%), Gaps = 7/114 (6%)
 Frame = +2

Query  35     DESLYKVTEEALFDCGLTSP-KTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRN  92
              D S  + +     +   T P K   Q +P    +        GPCEVW D+  V     +
Sbjct  86489  DLSKGRFSNPKTLNVVFTDPNKGPVQALPDKLEWYGGQMNHPGPCEVWCDNEVVVPFTAD  86668

Query  93     CHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
              C   FP G+   + + C     L  YW+          WQVY +C  +   A A
Sbjct  86669  CAATFPDGKIPYEKAKCTGKSRLTLYWMST-----LMEWQVYIDCAKIGNGAVA  86815

>PYIR:scaffold_2435 pir_scaffold_2435 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2435:1:2828:1 
REF
Length=2828

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 7/95 (7%)
 Frame = +3

Query  48    DCGLTSP-KTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEID  105
             +CG T+P K+  Q +P+   +        GPCEVW D+  V     +C   FP G+   +
Sbjct  2145  ECGFTAPDKSAVQALPNQLEWYGGKMNHPGPCEVWCDNEVVVPFTADCSATFPQGKISYN  2324

Query  106   YSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              + C     L  YW+          WQVY +C  +
Sbjct  2325  KAKCVGKNRLTLYWMST-----LLEWQVYIDCAKI  2414

>PYIR:scaffold_2511 pir_scaffold_2511 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2511:1:2703:1 
REF
Length=2703

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 59/141 (42%), Gaps = 7/141 (5%)
 Frame = -3

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             ++Y  +   NT+     +  +  Y SL+ +    ++ K+   A  +CG +S     QP+P
Sbjct  1879  MSYGTDPQSNTNAYLAGFKAQTKYKSLKDLATSAAV-KLEAGASKECGYSSVTGTAQPLP  1703

Query  63    SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWL  120
                 +     +  GPCEVW DD       NC  H        + D S C     L  +W+
Sbjct  1702  DTVQWDRFDSSHMGPCEVWCDDVLAFEDDNCSVHMTTTPAVLKYDKSKCVGKKMLTSFWI  1523

Query  121   GIKYVEGAYSWQVYKNCVALS  141
              +       +WQ+Y NC  ++
Sbjct  1522  ALHVP----TWQIYTNCAPIA  1472

>PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_976:1:12025:1 
REF
Length=12025

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query  76    GPCEVWLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWWYWL  120
             GPCE+W+D  +V   ++C   FP   G  + DYS C   C L +YWL
Sbjct  5273  GPCEIWIDTKRVFESQDCAKVFPEELGTIKFDYSPCRGECLLTFYWL  5133

 Score = 37.4 bits (85),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 47/97 (48%), Gaps = 22/97 (23%)
 Frame = +3

Query  12    NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP----SNSSF  67
             NT+   ++W +  GY SLR ++D         + +  CG T  +T+  P+     S+  F
Sbjct  6873  NTAQFTEAWPKT-GYKSLRELMD---------KYVPTCGYT--RTDIAPVDVSRMSSMKF  7016

Query  68    QTSGY------TLDGPCEVWLDDTKVAAGRNCHTQFP  98
             Q + Y      +  GPCE W+D+T+V    +C   FP
Sbjct  7017  QNNEYKEGFLNSHHGPCEGWIDNTRVFHYDDCVKSFP  7127

>PYAR:scaffold_1972 par_scaffold_1972 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1972:1:6441:1 
REF
Length=6441

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 49/108 (45%), Gaps = 9/108 (8%)
 Frame = -2

Query  3     LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
             +++ Q    NT   A +W  +  Y ++R M+   + +K    A  +CG  +     QP+P
Sbjct  5018  MSFGQGHEQNTKAFASAWASQTKYKTIREMI--YANFKGDGGATKECGQAAATGPPQPLP  4845

Query  63    SNSSFQTSGYTLD----GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY  106
                 +      LD    GPCEVW DDT+V    NC   +P    ++ Y
Sbjct  4844  DAVEYAGG---LDSTHWGPCEVWCDDTRVFYDANCAVTYPQKPAKLPY  4710

>PHIF:NW_003303565.1 Phytophthora infestans T30-4 supercont1.194 
genomic scaffold, whole genome shotgun sequence
Length=143641

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 58/128 (45%), Gaps = 18/128 (14%)
 Frame = -3

Query  22     QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQ--PIPSNSSFQTSGYTL-DGP  77
                +GY+ +R +LD D  LY        DCG T P    +  P   +++F      +  G 
Sbjct  52001  SSNGYSDIRTLLDSDTDLYGA------DCGYTDPDATAKDPPTTGDATFSRGMVPVRSGW  51840

Query  78     CEVWLDDTKVAAG---RNCHTQFPHGQHEIDYSACGDS-CTLWWYWLGIKYVEGAYSWQV  133
                 W      A G   ++  + F      +DYS C  S C L +YWL  + V+    WQV
Sbjct  51839  MTPWCCPMTTAYGDGTQDTKSVF----TPVDYSLCSTSGCMLRFYWLAFQGVDSDMVWQV  51672

Query  134    YKNCVALS  141
              YK+CV+L+
Sbjct  51671  YKDCVSLT  51648

>PYAR:scaffold_3482 par_scaffold_3482 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3482:1:3236:1 
REF
Length=3236

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 52/124 (42%), Gaps = 9/124 (7%)
 Frame = +2

Query  21    MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTET-QPIPSNSSFQTSGYTLDGPCE  79
              +   Y SL+ ++      KV+  A  +CG  +    T QP+P    +     +  GPCE
Sbjct  1751  FKNSKYKSLKELVLQNQ--KVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCE  1924

Query  80    VWLDDTKVAAGRNCHTQFPHGQHEIDYS--ACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
             VW D+       NC         +++Y   AC  +  L  YW+ +   E    WQVY  C
Sbjct  1925  VWCDNNLAFQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGC  2092

Query  138   VALS  141
               LS
Sbjct  2093  APLS  2104

>PYUU:scaffold_2012 scf1117875582012 dna:supercontig supercontig:pug:scf1117875582012:1:298282:1 
REF
Length=298282

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (43%), Gaps = 13/127 (10%)
 Frame = -3

Query  24      HGYASLRAMLDDESLYKVTE------EALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGP  77
               +G+ SLR  +  +   KV            +CG T P    Q IP   +++ S +   GP
Sbjct  207470  NGFKSLREYI--KKYQKVVPYDGRPAGGTLECGFTDPNGPPQMIPDQIAWRGSTFQHSGP  207297

Query  78      CEVWLDDTKVAAGRNCHT-QFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
               CEV  DD +V    +C   +   G+   D + C     L +YWL    V     +Q+Y +
Sbjct  207296  CEV*CDDERVMYAPSCKVWEATGGKMTYDKAKCIGKKRLTFYWLATFNVP----FQLYTD  207129

Query  137     CVALSKT  143
               C  L  T
Sbjct  207128  CAPLQGT  207108

>PYAR:scaffold_2265 par_scaffold_2265 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2265:1:5585:1 
REF
Length=5585

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 50/107 (47%), Gaps = 9/107 (8%)
 Frame = -2

Query  39    YKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD--GPCEVWLDDTKVAAGRNCHTQ  96
             +K    A  +CG ++     Q +P+   +   G TL   GPCEVW DD +V    NC  +
Sbjct  1117  FKPDGGATKECGQSAMTGTPQSLPAYVEY-GQGLTLQHYGPCEVWCDDVRVFYDPNCSVK  941

Query  97    FPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
             +     ++  D S C  +  L  +WL +   +    WQ Y +C ALS
Sbjct  940   YTEKPAKLPFDKSKCVGAKRLQSFWLALHVPQ----WQAYISCAALS  812

 Score = 41.6 bits (96),  Expect = 0.003, Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 45/89 (51%), Gaps = 5/89 (6%)
 Frame = +1

Query  12    NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSG  71
             N +   +++  +  Y SLR ++   + +K    A  +CG ++     Q +P    + +SG
Sbjct  3286  NQAAYQKAFESQTKYKSLRDLI--YANFKPDGGATKECGRSAMTGPAQSLPEYVEY-SSG  3456

Query  72    YTLD--GPCEVWLDDTKVAAGRNCHTQFP  98
             ++    GPCEVW DD +V A  NC   +P
Sbjct  3457  FSDSHWGPCEVWCDDVRVFADPNCRINYP  3543

 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (52%), Gaps = 5/83 (6%)
 Frame = -1

Query  26    YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL--DGPCEVWLD  83
             Y SLR ++   + ++    A  +CG ++     Q +P+   ++T G+T   +GPCEVW D
Sbjct  4700  YKSLRDLI--YANFRSDGGASKECGQSAMTGTPQALPNFVEYET-GFTRSHEGPCEVWCD  4530

Query  84    DTKVAAGRNCHTQFPHGQHEIDY  106
             D +V    NC  ++P     + Y
Sbjct  4529  DVRVFYEPNCAIKYPTAPARLPY  4461

>PYAR:scaffold_2617 par_scaffold_2617 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2617:1:4678:1 
REF
Length=4678

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 35/69 (51%), Gaps = 3/69 (4%)
 Frame = -2

Query  25    GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDD  84
             G +SL+A +   ++   T  A  +CG      E QP+P+   F    +   GPCEVW D+
Sbjct  1329  GQSSLKAFIMANAVLTGTGHATKECGWALANGEPQPVPAALDFP---WGHPGPCEVWCDN  1159

Query  85    TKVAAGRNC  93
             TKV    NC
Sbjct  1158  TKVFYNENC  1132

>PYIR:scaffold_2812 pir_scaffold_2812 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2812:1:2225:1 
REF
Length=2225

 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 38/90 (42%), Gaps = 6/90 (7%)
 Frame = +1

Query  49    CGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAA-GRNCHTQFPHGQHEIDYS  107
             CG ++P    QP+P    + T G+   GPCE + D+  V     NC   F  G      +
Sbjct  1135  CGFSNPNGTPQPLPDTLQWGT-GFIHPGPCEAYCDNEIVVPYTANCWKTFASGAVPYSKA  1311

Query  108   ACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
              C     L +YWL +        WQVY  C
Sbjct  1312  KCAGKKQLTFYWLAVH----GPPWQVYSKC  1389

>PYAP:scaffold_328 pag1_scaffold_328 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_328:1:32485:1 
REF
Length=32485

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 38/81 (47%), Gaps = 12/81 (15%)
 Frame = -3

Query  68     QTSGYTLDGP------CEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYW  119
              Q SG  ++ P      CE+W D TK+    +C T +P      +ID S C  +  L  YW
Sbjct  27617  QASGAPINAPVTHPGTCEIWCDKTKLVYALDCQTAYPGTPANIKIDTSKCKGTDQLAVYW  27438

Query  120    LGIKYVEGAYSWQVYKNCVAL  140
              L +        WQVY +CV L
Sbjct  27437  LAVH----GTPWQVYNDCVWL  27387

Lambda      K        H        a         alpha
   0.316    0.129    0.422    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14033596764

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40