Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHRA:scaffold_16952700345225112515e-162
PHRA:scaffold_5615290915366125112519e-157
PHCA:scaffold_84984039915525110482e-129
PHPA:scaffold_6324836724905623010384e-128
PHSO:scaffold_12797180279786923010173e-125
PHIF:NW_003303697.13983453990342309601e-117
PHKE:scaffold_9865094657832309564e-117
PHKE:scaffold_281327741334632308137e-98
PHRA:scaffold_512016982023872307908e-95
PHIF:NW_003303744.1221792222186022307423e-88
PHPA:scaffold_167796897803692307273e-86
PHPA:scaffold_593065713072482307151e-84
PHSO:scaffold_4463297946336532317132e-84
PHCA:scaffold_443328173334942307122e-84
PHKE:scaffold_323571363932317019e-83
PHPA:scaffold_642334092340952346701e-78
PHSO:scaffold_11138276613834282306682e-78
PHCA:scaffold_362383452390102306551e-76
PHPA:scaffold_12116664811673132306462e-75
PHIF:NW_003307367.1440250672306453e-75
PHIF:NW_003303754.1223319922338642306419e-75
PHIF:NW_003303619.11475261482032316401e-74
PHRA:scaffold_75628175634792306355e-74
PHPA:scaffold_11148344489882306251e-72
PHCA:scaffold_14645876465532316065e-70
PHIF:NW_003303731.1120795412084751785395e-70
PHSO:scaffold_5640746764081112306048e-70
PHRA:scaffold_37813768144122306048e-70
PHRA:scaffold_196134219862306048e-70
PHRA:scaffold_1769567702112306031e-69
PHRA:scaffold_780689375372306022e-69
PHCA:scaffold_149924329930762306012e-69
PHKE:scaffold_19223714244212516012e-69
PHCA:scaffold_464346304352742306012e-69
PHKE:scaffold_30942303429472305977e-69
PHCA:scaffold_871635821642262305951e-68
PHSO:scaffold_3828029582809392305933e-68
PHIF:NW_003303739.1153737515380192305933e-68
PHPA:scaffold_484013314019752305923e-68
PHRA:scaffold_215101955108362295923e-68
PHCA:scaffold_513067873074312305906e-68
PHPA:scaffold_151235861242302305881e-67
PHPA:scaffold_6890380910242305881e-67
PHRA:scaffold_126077266084272495801e-66
PHSO:scaffold_62749212755652305783e-66
PHRA:scaffold_846157162495773e-66
PHIF:NW_003303758.1407588640765302305756e-66
PHKE:scaffold_8946026466702345756e-66
PHKE:scaffold_89365713012305642e-64
PHPA:scaffold_652760922767902375623e-64
PHPA:scaffold_112303652310092305606e-64
PHKE:scaffold_52716519171452245598e-64
PHPA:scaffold_343078853085292305598e-64
PLHA:NW_020189861.13224973231352285591e-63
PHPA:scaffold_13639410922375581e-63
PHKE:scaffold_562341140552305571e-63
PHPA:scaffold_10145464814551361665572e-63
PHRA:scaffold_602936632943012285562e-63
PHRA:scaffold_314670744677332355563e-63
PYVX:scaffold_8849963106642495553e-63
PHIF:NW_003303732.1105124110518852305544e-63
PHRA:scaffold_968935695792305536e-63
PHCA:scaffold_252532012538452305536e-63
PHPA:scaffold_366117956124392305501e-62
PHCA:scaffold_154247834254272305492e-62
PYUU:scaffold_12974218574224952285483e-62
PHIF:NW_003303713.14537074543062135474e-62
PHPA:scaffold_88526259332335441e-61
PHSO:scaffold_74261114267552305441e-61
PYIR:scaffold_432553331912285431e-61
PHIF:NW_003303746.1250086325015072305386e-61
PHCA:scaffold_391313021319462345379e-61
PHCA:scaffold_16260512642315361e-60
PHKE:scaffold_523340841002535352e-60
HYAP:scaffold_971856361862772295324e-60
PHRA:scaffold_981404441410942345307e-60
PHRA:scaffold_1409348241412355299e-60
PHRA:scaffold_436240230522345253e-59
PHRA:scaffold_293819713826302335244e-59
PHKE:scaffold_44413200138652355236e-59
PHKE:scaffold_4951628122325131e-57
PHKE:scaffold_15523229692314898e-57
PHKE:scaffold_364117818252315024e-56
PHRA:scaffold_751445211451622285015e-56
PHRA:scaffold_1415266033102315015e-56
PLHA:NW_020187213.1130045513010992305007e-56
PYIW:scaffold_3359187124702154989e-56
PHKE:scaffold_24225932265762304991e-55
PHRA:scaffold_911487521493992304981e-55
PHRA:scaffold_2433177723431974936e-55
PHRA:scaffold_407736280092304901e-54
PHIF:NW_003303741.14944444951182304892e-54
PHPA:scaffold_1182504218256832254822e-53
PHCA:scaffold_501986161991461874822e-53
HYAP:scaffold_5386476871262314795e-53
PHPA:scaffold_712225782232912534788e-53
HYAP:scaffold_781259691266192324779e-53
PHIF:NW_003306740.1116918672474742e-52
PHRA:scaffold_10837174378212314742e-52
PHPA:scaffold_423766343772872294725e-52
PHRA:scaffold_672648652655722514708e-52
PHKE:scaffold_21111293117511713999e-52
PHRA:scaffold_193311203317732324691e-51
PHCA:scaffold_1789764104052354681e-51
PHIF:NW_003303749.1234231523429802374645e-51
PHPA:scaffold_247669327676302474636e-51
PHSO:scaffold_3340509412162464629e-51
PHPA:scaffold_5150131815019892414602e-50
PHIF:NW_003303150.112522131602274602e-50
PHCA:scaffold_164038254045922694592e-50
PHRA:scaffold_213660212462304573e-50
PHKE:scaffold_1389138619672024504e-50
PHIF:NW_003303722.17706337713072444575e-50
PHKE:scaffold_819711376972034565e-50
PHIF:NW_003303715.1105445910552232704541e-49
PHRA:scaffold_516783584882334531e-49
PHRA:scaffold_27624989681723673e-49
PHPA:scaffold_313192483198982314513e-49
PHCA:scaffold_534081554089192754504e-49
PHKE:scaffold_899234229772374494e-49
HYAP:scaffold_190558912332374355e-49
PHSO:scaffold_210059907100605932474495e-49
PHRA:scaffold_2258235930122334461e-48
HYAP:scaffold_64126119082304461e-48
HYAP:scaffold_711583931590342284452e-48
PLHA:NW_020187532.1316413031647892314433e-48
PLHA:NW_020187732.1232819023288492304415e-48
PHRA:scaffold_31914408148661604372e-47
PHPA:scaffold_6092763934612474363e-47
PHSO:scaffold_8324477932454652424363e-47
PHRA:scaffold_765706177112314345e-47
PHRA:scaffold_14923440240902314346e-47
PHCA:scaffold_271373951379972274336e-47
PLHA:NW_020187575.1174833217489852364336e-47
PHPA:scaffold_275425025432632694284e-46
HYAP:scaffold_22028072287222324258e-46
PHPA:scaffold_62785812792822494241e-45
PHPA:scaffold_7107784510786092724241e-45
PHPA:scaffold_543589483594181624042e-45
PHKE:scaffold_82151682157972314212e-45
PHPA:scaffold_225081705088682474204e-45
PHKE:scaffold_27726685271191523873e-44
PHIF:NW_003303743.1171190217126632734091e-43
PHPA:scaffold_93338463346072694072e-43
PYAP:scaffold_973778684122324045e-43
PHCA:scaffold_54737711442703992e-42
PHRA:scaffold_140511355021452574e-42
PYAP:scaffold_984690174852043958e-42
PHIF:NW_003303756.1401119840119502663958e-42
PHCA:scaffold_477253330631923903e-41
PLHA:NW_020188871.12508942353775e-41
PHIF:NW_003303667.11694321700942373896e-41
HYAP:scaffold_334679804686002233888e-41
HYAP:scaffold_4030776313962233861e-40
PHIF:NW_003303729.1161673016171401453603e-40
PHRA:scaffold_271296736652553843e-40
PLHA:NW_020187243.1172479917254102173833e-40
HYAP:scaffold_20877092401753237e-40
PLHA:NW_020189293.17221277227712353791e-39
PHKE:scaffold_33340374409882193791e-39
PHSO:scaffold_167073247076681233763e-39
HYAP:scaffold_16601958152263735e-39
PHKE:scaffold_10431102317222323745e-39
HYAP:scaffold_14988967893111223008e-39
PHCA:scaffold_139558162102333711e-38
PYAP:scaffold_530473353562313711e-38
PLHA:NW_020187244.1235674623573842303674e-38
PHKE:scaffold_1562113014771243571e-37
PHIF:NW_003303720.17317397325062723622e-37
PYAP:scaffold_1161106452333594e-37
PHCA:scaffold_6114973111501081343524e-36
PYAR:scaffold_465954811772343504e-36
PHKE:scaffold_56313778141551363525e-36
HYAP:scaffold_732503332510222483472e-35
PYUU:scaffold_19819533795591912202e-35
PHIF:NW_003303734.1144475414450981232823e-35
PHIF:NW_003303725.1148854214892372473264e-35
PHIF:NW_003303745.11277961284702423421e-34
PHKE:scaffold_499767582382023181e-34
PHIF:NW_003303698.12157112163492343341e-33
HYAP:scaffold_582671802678182333341e-33
PLHA:NW_020188258.19553239559972403331e-33
PLHA:NW_020187210.15469065475502333331e-33
PLHA:NW_020189809.14011024016231803313e-33
PHCA:scaffold_371410941415071573286e-33
PHIF:NW_003307271.165511791892779e-33
PHKE:scaffold_14761523621522323252e-32
PHIF:NW_003303721.1154427215449342293252e-32
PHPA:scaffold_11079336796411051856e-32
PHKE:scaffold_56433211142833208e-32
PHPA:scaffold_472806262812762283209e-32
HYAP:scaffold_891638291644432213182e-31
HYAP:scaffold_105454905461312343138e-31
PYIW:scaffold_2677238628141583092e-30
PHSO:scaffold_149224039230202283093e-30
PHIF:NW_003303719.1331891332157893075e-30
PHRA:scaffold_51233311943041e-29
PHKE:scaffold_993282032511623041e-29
PHSO:scaffold_212941762946221573032e-29
PHCA:scaffold_115035135038841353004e-29
HYAP:scaffold_6371390720162302916e-28
PHCA:scaffold_172057202063462162891e-27
PLHA:NW_020189786.18017568024092372854e-27
PYAR:scaffold_5083118216791832791e-26
PHRA:scaffold_21435584360151592811e-26
PHKE:scaffold_1835515055383891961e-26
PHIF:NW_003303717.1864428864712952759e-26
PHRA:scaffold_2309333596962731e-25
PHIF:NW_003303757.158330155833215741833e-25
PHRA:scaffold_1828444665742694e-25
PHIF:NW_003305543.113311606932685e-25
PHPA:scaffold_88602938607901822688e-25
PHIF:NW_003303513.155123556171742671e-24
PHKE:scaffold_753824385541112652e-24
PYAR:scaffold_1934476153002012642e-24
PHKE:scaffold_89043054556852624e-24
PHIF:NW_003303706.13491663499332702616e-24
PHCA:scaffold_384497014501351592581e-23
PHCA:scaffold_772072292076061372475e-22
PHPA:scaffold_4106593110664131692342e-20
PHRA:scaffold_15936262366811552307e-20
PYAR:scaffold_803433051092183e-19
HYAP:scaffold_18222532222783842211e-18
PHIF:NW_003303458.149647500661502141e-17
PHIF:NW_003303555.180040803241032051e-16
PHRA:scaffold_22717161928722006e-16
PHKE:scaffold_65688829133851972e-15
PHPA:scaffold_33057395945701927e-15
PHPA:scaffold_32475817817801856e-14
PHIF:NW_003303733.19868489873211781738e-14
PHPA:scaffold_343108015651631706e-12
PHKE:scaffold_2193660536697311198e-12
PLHA:NW_020189964.123382452338499941653e-11
PHPA:scaffold_38163821441871502e-09
PHRA:scaffold_37512581129131221484e-09
PHIF:NW_003303730.1352126352374911246e-09
PHIF:NW_003303606.1100522100644411288e-09
PHPA:scaffold_1346154561772761422e-08
PYAR:scaffold_848326208611373e-08
PYIW:scaffold_400322152430801395e-08
PHIF:NW_003303696.1107687107809411315e-07
PHKE:scaffold_106537633927551262e-06
PHIF:NW_003303594.1179663179764341262e-06
PHKE:scaffold_1622293723074461227e-06
PHRA:scaffold_666379663897341155e-05
PHIF:NW_003303724.112138021214014871117e-05
PYIW:scaffold_1581218112366701148e-05
PYIR:scaffold_491773228521101e-04
PYVX:scaffold_14440577410321611122e-04
PHKE:scaffold_4821843718550381094e-04
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYRA_81102

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHRA:scaffold_1695                                                    486     5e-162
PHRA:scaffold_56                                                      486     9e-157
PHCA:scaffold_84 PHYCAscaffold_84                                     408     2e-129
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  404     4e-128
PHSO:scaffold_1                                                       396     3e-125
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  374     1e-117
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  372     4e-117
PHKE:scaffold_28 scf_22126_28.1 dna:supercontig supercontig:PhyKe...  317     7e-98 
PHRA:scaffold_51                                                      308     8e-95 
PHIF:NW_003303744.1 Phytophthora infestans T30-4 supercont1.15 ge...  290     3e-88 
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  284     3e-86 
PHPA:scaffold_59 NW_008649045.1 Phytophthora parasitica INRA-310 ...  280     1e-84 
PHSO:scaffold_4                                                       279     2e-84 
PHCA:scaffold_44 PHYCAscaffold_44                                     278     2e-84 
PHKE:scaffold_323 scf_22126_323.1_contig_1 dna:supercontig superc...  274     9e-83 
PHPA:scaffold_64 NW_008649050.1 Phytophthora parasitica INRA-310 ...  262     1e-78 
PHSO:scaffold_11                                                      261     2e-78 
PHCA:scaffold_36 PHYCAscaffold_36                                     256     1e-76 
PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 ...  253     2e-75 
PHIF:NW_003307367.1 Phytophthora infestans T30-4 supercont1.1021 ...  253     3e-75 
PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 gen...  251     9e-75 
PHIF:NW_003303619.1 Phytophthora infestans T30-4 supercont1.140 g...  251     1e-74 
PHRA:scaffold_7                                                       249     5e-74 
PHPA:scaffold_111 NW_008649097.1 Phytophthora parasitica INRA-310...  245     1e-72 
PHCA:scaffold_146 PHYCAscaffold_146                                   238     5e-70 
PHIF:NW_003303731.1 Phytophthora infestans T30-4 supercont1.28 ge...  212     5e-70 
PHSO:scaffold_5                                                       237     8e-70 
PHRA:scaffold_378                                                     237     8e-70 
PHRA:scaffold_196                                                     237     8e-70 
PHRA:scaffold_17                                                      236     1e-69 
PHRA:scaffold_780                                                     236     2e-69 
PHCA:scaffold_14 PHYCAscaffold_14                                     236     2e-69 
PHKE:scaffold_192 scf_22126_192.1 dna:supercontig supercontig:Phy...  236     2e-69 
PHCA:scaffold_46 PHYCAscaffold_46                                     236     2e-69 
PHKE:scaffold_309 scf_22126_309.1 dna:supercontig supercontig:Phy...  234     7e-69 
PHCA:scaffold_87 PHYCAscaffold_87                                     233     1e-68 
PHSO:scaffold_3                                                       233     3e-68 
PHIF:NW_003303739.1 Phytophthora infestans T30-4 supercont1.20 ge...  233     3e-68 
PHPA:scaffold_48 NW_008649034.1 Phytophthora parasitica INRA-310 ...  232     3e-68 
PHRA:scaffold_21                                                      232     3e-68 
PHCA:scaffold_51 PHYCAscaffold_51                                     231     6e-68 
PHPA:scaffold_15 NW_008649001.1 Phytophthora parasitica INRA-310 ...  231     1e-67 
PHPA:scaffold_68 NW_008649054.1 Phytophthora parasitica INRA-310 ...  231     1e-67 
PHRA:scaffold_12                                                      228     1e-66 
PHSO:scaffold_6                                                       227     3e-66 
PHRA:scaffold_846                                                     226     3e-66 
PHIF:NW_003303758.1 Phytophthora infestans T30-4 supercont1.1 gen...  226     6e-66 
PHKE:scaffold_89 scf_22126_89.1 dna:supercontig supercontig:PhyKe...  226     6e-66 
PHKE:scaffold_893 scf_22126_893.1_contig_1 dna:supercontig superc...  221     2e-64 
PHPA:scaffold_65 NW_008649051.1 Phytophthora parasitica INRA-310 ...  221     3e-64 
PHPA:scaffold_11 NW_008648997.1 Phytophthora parasitica INRA-310 ...  220     6e-64 
PHKE:scaffold_527 scf_22126_527.1 dna:supercontig supercontig:Phy...  219     8e-64 
PHPA:scaffold_34 NW_008649020.1 Phytophthora parasitica INRA-310 ...  219     8e-64 
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  219     1e-63 
PHPA:scaffold_136 NW_008649122.1 Phytophthora parasitica INRA-310...  219     1e-63 
PHKE:scaffold_562 scf_22126_562.1 dna:supercontig supercontig:Phy...  219     1e-63 
PHPA:scaffold_10 NW_008648996.1 Phytophthora parasitica INRA-310 ...  219     2e-63 
PHRA:scaffold_60                                                      218     2e-63 
PHRA:scaffold_31                                                      218     3e-63 
PYVX:scaffold_884 pve_scaffold_884 dna:supercontig supercontig:pv...  218     3e-63 
PHIF:NW_003303732.1 Phytophthora infestans T30-4 supercont1.27 ge...  218     4e-63 
PHRA:scaffold_9                                                       217     6e-63 
PHCA:scaffold_25 PHYCAscaffold_25                                     217     6e-63 
PHPA:scaffold_36 NW_008649022.1 Phytophthora parasitica INRA-310 ...  216     1e-62 
PHCA:scaffold_15 PHYCAscaffold_15                                     216     2e-62 
PYUU:scaffold_1297 scf1117875581297 dna:supercontig supercontig:p...  215     3e-62 
PHIF:NW_003303713.1 Phytophthora infestans T30-4 supercont1.46 ge...  215     4e-62 
PHPA:scaffold_88 NW_008649074.1 Phytophthora parasitica INRA-310 ...  214     1e-61 
PHSO:scaffold_7                                                       214     1e-61 
PYIR:scaffold_4 pir_scaffold_4 dna:supercontig supercontig:pir_sc...  213     1e-61 
PHIF:NW_003303746.1 Phytophthora infestans T30-4 supercont1.13 ge...  211     6e-61 
PHCA:scaffold_39 PHYCAscaffold_39                                     211     9e-61 
PHCA:scaffold_162 PHYCAscaffold_162                                   211     1e-60 
PHKE:scaffold_523 scf_22126_523.1 dna:supercontig supercontig:Phy...  210     2e-60 
HYAP:scaffold_97 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_9...  209     4e-60 
PHRA:scaffold_98                                                      208     7e-60 
PHRA:scaffold_1409                                                    208     9e-60 
PHRA:scaffold_436                                                     206     3e-59 
PHRA:scaffold_29                                                      206     4e-59 
PHKE:scaffold_444 scf_22126_444.1 dna:supercontig supercontig:Phy...  206     6e-59 
PHKE:scaffold_495 scf_22126_495.1_contig_1 dna:supercontig superc...  202     1e-57 
PHKE:scaffold_1552 scf_22126_1552.1_contig_1 dna:supercontig supe...  192     8e-57 
PHKE:scaffold_364 scf_22126_364.1 dna:supercontig supercontig:Phy...  197     4e-56 
PHRA:scaffold_75                                                      197     5e-56 
PHRA:scaffold_1415                                                    197     5e-56 
PLHA:NW_020187213.1 Plasmopara halstedii genome assembly, contig:...  197     7e-56 
PYIW:scaffold_3359 piw_scaffold_3359 dna:supercontig supercontig:...  196     9e-56 
PHKE:scaffold_242 scf_22126_242.1 dna:supercontig supercontig:Phy...  196     1e-55 
PHRA:scaffold_91                                                      196     1e-55 
PHRA:scaffold_2433                                                    194     6e-55 
PHRA:scaffold_407                                                     193     1e-54 
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  192     2e-54 
PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 u...  190     2e-53 
PHCA:scaffold_50 PHYCAscaffold_50                                     190     2e-53 
HYAP:scaffold_53 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  189     5e-53 
PHPA:scaffold_71 NW_008649057.1 Phytophthora parasitica INRA-310 ...  188     8e-53 
HYAP:scaffold_78 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  188     9e-53 
PHIF:NW_003306740.1 Phytophthora infestans T30-4 supercont1.1923 ...  187     2e-52 
PHRA:scaffold_108                                                     187     2e-52 
PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 ...  186     5e-52 
PHRA:scaffold_67                                                      185     8e-52 
PHKE:scaffold_211 scf_22126_211.1_contig_1 dna:supercontig superc...  158     9e-52 
PHRA:scaffold_19                                                      185     1e-51 
PHCA:scaffold_178 PHYCAscaffold_178                                   184     1e-51 
PHIF:NW_003303749.1 Phytophthora infestans T30-4 supercont1.10 ge...  183     5e-51 
PHPA:scaffold_24 NW_008649010.1 Phytophthora parasitica INRA-310 ...  182     6e-51 
PHSO:scaffold_33                                                      182     9e-51 
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  181     2e-50 
PHIF:NW_003303150.1 Phytophthora infestans T30-4 supercont1.629 g...  181     2e-50 
PHCA:scaffold_16 PHYCAscaffold_16                                     181     2e-50 
PHRA:scaffold_2136                                                    180     3e-50 
PHKE:scaffold_1389 scf_22126_1389.1_contig_1 dna:supercontig supe...  177     4e-50 
PHIF:NW_003303722.1 Phytophthora infestans T30-4 supercont1.37 ge...  180     5e-50 
PHKE:scaffold_819 scf_22126_819.1 dna:supercontig supercontig:Phy...  180     5e-50 
PHIF:NW_003303715.1 Phytophthora infestans T30-4 supercont1.44 ge...  179     1e-49 
PHRA:scaffold_516                                                     179     1e-49 
PHRA:scaffold_2762                                                    145     3e-49 
PHPA:scaffold_31 NW_008649017.1 Phytophthora parasitica INRA-310 ...  178     3e-49 
PHCA:scaffold_53 PHYCAscaffold_53                                     177     4e-49 
PHKE:scaffold_899 scf_22126_899.1_contig_1 dna:supercontig superc...  177     4e-49 
HYAP:scaffold_1905 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold...  172     5e-49 
PHSO:scaffold_2                                                       177     5e-49 
PHRA:scaffold_2258                                                    176     1e-48 
HYAP:scaffold_64 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_6...  176     1e-48 
HYAP:scaffold_71 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  176     2e-48 
PLHA:NW_020187532.1 Plasmopara halstedii genome assembly, contig:...  175     3e-48 
PLHA:NW_020187732.1 Plasmopara halstedii genome assembly, contig:...  174     5e-48 
PHRA:scaffold_319                                                     172     2e-47 
PHPA:scaffold_60 NW_008649046.1 Phytophthora parasitica INRA-310 ...  172     3e-47 
PHSO:scaffold_8                                                       172     3e-47 
PHRA:scaffold_765                                                     171     5e-47 
PHRA:scaffold_149                                                     171     6e-47 
PHCA:scaffold_27 PHYCAscaffold_27                                     171     6e-47 
PLHA:NW_020187575.1 Plasmopara halstedii genome assembly, contig:...  171     6e-47 
PHPA:scaffold_27 NW_008649013.1 Phytophthora parasitica INRA-310 ...  169     4e-46 
HYAP:scaffold_220 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  168     8e-46 
PHPA:scaffold_6 NW_008648992.1 Phytophthora parasitica INRA-310 u...  167     1e-45 
PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 u...  167     1e-45 
PHPA:scaffold_54 NW_008649040.1 Phytophthora parasitica INRA-310 ...  160     2e-45 
PHKE:scaffold_8 scf_22126_8.1_contig_1 dna:supercontig superconti...  166     2e-45 
PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 ...  166     4e-45 
PHKE:scaffold_277 scf_22126_277.1_contig_1 dna:supercontig superc...  153     3e-44 
PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 ge...  162     1e-43 
PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 u...  161     2e-43 
PYAP:scaffold_973 pag1_scaffold_973 dna:supercontig supercontig:p...  160     5e-43 
PHCA:scaffold_547 PHYCAscaffold_547                                   158     2e-42 
PHRA:scaffold_140                                                     103     4e-42 
PYAP:scaffold_984 pag1_scaffold_984 dna:supercontig supercontig:p...  156     8e-42 
PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 gen...  156     8e-42 
PHCA:scaffold_477 PHYCAscaffold_477                                   154     3e-41 
PLHA:NW_020188871.1 Plasmopara halstedii genome assembly, contig:...  149     5e-41 
PHIF:NW_003303667.1 Phytophthora infestans T30-4 supercont1.92 ge...  154     6e-41 
HYAP:scaffold_33 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_3...  154     8e-41 
HYAP:scaffold_40 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_4...  153     1e-40 
PHIF:NW_003303729.1 Phytophthora infestans T30-4 supercont1.30 ge...  147     2e-38 
PHRA:scaffold_271                                                     152     3e-40 
PLHA:NW_020187243.1 Plasmopara halstedii genome assembly, contig:...  152     3e-40 
HYAP:scaffold_20 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_2...  136     6e-35 
PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig:...  150     1e-39 
PHKE:scaffold_333 scf_22126_333.1 dna:supercontig supercontig:Phy...  150     1e-39 
PHSO:scaffold_16                                                      149     3e-39 
HYAP:scaffold_1660 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold...  148     5e-39 
PHKE:scaffold_104 scf_22126_104.1 dna:supercontig supercontig:Phy...  148     5e-39 
HYAP:scaffold_149 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  120     8e-39 
PHCA:scaffold_139 PHYCAscaffold_139                                   147     1e-38 
PYAP:scaffold_530 pag1_scaffold_530 dna:supercontig supercontig:p...  147     1e-38 
PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig:...  145     4e-38 
PHKE:scaffold_1562 scf_22126_1562.1 dna:supercontig supercontig:P...  142     1e-37 
PHIF:NW_003303720.1 Phytophthora infestans T30-4 supercont1.39 ge...  144     2e-37 
PYAP:scaffold_1161 pag1_scaffold_1161 dna:supercontig supercontig...  142     4e-37 
PHCA:scaffold_6 PHYCAscaffold_6                                       140     4e-36 
PYAR:scaffold_4659 par_scaffold_4659 dna:supercontig supercontig:...  139     4e-36 
PHKE:scaffold_563 scf_22126_563.1_contig_1 dna:supercontig superc...  140     5e-36 
HYAP:scaffold_73 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  138     2e-35 
PYUU:scaffold_1981 scf1117875581981 dna:supercontig supercontig:p...  89.4    2e-35 
PHIF:NW_003303734.1 Phytophthora infestans T30-4 supercont1.25 ge...  113     3e-35 
PHIF:NW_003303725.1 Phytophthora infestans T30-4 supercont1.34 ge...  130     4e-35 
PHIF:NW_003303745.1 Phytophthora infestans T30-4 supercont1.14 ge...  136     1e-34 
PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig superc...  127     1e-34 
PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 ge...  133     1e-33 
HYAP:scaffold_58 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  133     1e-33 
PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig:...  132     1e-33 
PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig:...  132     1e-33 
PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig:...  132     3e-33 
PHCA:scaffold_37 PHYCAscaffold_37                                     130     6e-33 
PHIF:NW_003307271.1 Phytophthora infestans T30-4 supercont1.1289 ...  111     9e-33 
PHKE:scaffold_147 scf_22126_147.1 dna:supercontig supercontig:Phy...  129     2e-32 
PHIF:NW_003303721.1 Phytophthora infestans T30-4 supercont1.38 ge...  129     2e-32 
PHPA:scaffold_110 NW_008649096.1 Phytophthora parasitica INRA-310...  75.9    6e-32 
PHKE:scaffold_564 scf_22126_564.1 dna:supercontig supercontig:Phy...  127     8e-32 
PHPA:scaffold_47 NW_008649033.1 Phytophthora parasitica INRA-310 ...  127     9e-32 
HYAP:scaffold_89 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  127     2e-31 
HYAP:scaffold_10 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1...  125     8e-31 
PYIW:scaffold_2677 piw_scaffold_2677 dna:supercontig supercontig:...  123     2e-30 
PHSO:scaffold_14                                                      123     3e-30 
PHIF:NW_003303719.1 Phytophthora infestans T30-4 supercont1.40 ge...  122     5e-30 
PHRA:scaffold_512                                                     121     1e-29 
PHKE:scaffold_993 scf_22126_993.1 dna:supercontig supercontig:Phy...  121     1e-29 
PHSO:scaffold_21                                                      121     2e-29 
PHCA:scaffold_11 PHYCAscaffold_11                                     120     4e-29 
HYAP:scaffold_63 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_6...  116     6e-28 
PHCA:scaffold_17 PHYCAscaffold_17                                     115     1e-27 
PLHA:NW_020189786.1 Plasmopara halstedii genome assembly, contig:...  114     4e-27 
PYAR:scaffold_5083 par_scaffold_5083 dna:supercontig supercontig:...  112     1e-26 
PHRA:scaffold_214                                                     112     1e-26 
PHKE:scaffold_183 scf_22126_183.1_contig_1 dna:supercontig superc...  80.1    1e-26 
PHIF:NW_003303717.1 Phytophthora infestans T30-4 supercont1.42 ge...  110     9e-26 
PHRA:scaffold_2309                                                    109     1e-25 
PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 gen...  75.1    3e-25 
PHRA:scaffold_1828                                                    108     4e-25 
PHIF:NW_003305543.1 Phytophthora infestans T30-4 supercont1.3127 ...  107     5e-25 
PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 u...  107     8e-25 
PHIF:NW_003303513.1 Phytophthora infestans T30-4 supercont1.246 g...  107     1e-24 
PHKE:scaffold_753 scf_22126_753.1_contig_1 dna:supercontig superc...  106     2e-24 
PYAR:scaffold_1934 par_scaffold_1934 dna:supercontig supercontig:...  106     2e-24 
PHKE:scaffold_890 scf_22126_890.1_contig_1 dna:supercontig superc...  105     4e-24 
PHIF:NW_003303706.1 Phytophthora infestans T30-4 supercont1.53 ge...  105     6e-24 
PHCA:scaffold_38 PHYCAscaffold_38                                     103     1e-23 
PHCA:scaffold_77 PHYCAscaffold_77                                     99.8    5e-22 
PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 u...  94.7    2e-20 
PHRA:scaffold_159                                                     93.2    7e-20 
PYAR:scaffold_8034 par_scaffold_8034 dna:supercontig supercontig:...  88.6    3e-19 
HYAP:scaffold_18 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1...  89.7    1e-18 
PHIF:NW_003303458.1 Phytophthora infestans T30-4 supercont1.301 g...  87.0    1e-17 
PHIF:NW_003303555.1 Phytophthora infestans T30-4 supercont1.204 g...  83.6    1e-16 
PHRA:scaffold_227                                                     81.6    6e-16 
PHKE:scaffold_656 scf_22126_656.1 dna:supercontig supercontig:Phy...  80.5    2e-15 
PHPA:scaffold_330 NW_008649316.1 Phytophthora parasitica INRA-310...  78.6    7e-15 
PHPA:scaffold_324 NW_008649310.1 Phytophthora parasitica INRA-310...  75.9    6e-14 
PHIF:NW_003303733.1 Phytophthora infestans T30-4 supercont1.26 ge...  71.2    8e-14 
PHPA:scaffold_343 NW_008649329.1 Phytophthora parasitica INRA-310...  70.1    6e-12 
PHKE:scaffold_219 scf_22126_219.1 dna:supercontig supercontig:Phy...  50.4    8e-12 
PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig:...  68.2    3e-11 
PHPA:scaffold_38 NW_008649024.1 Phytophthora parasitica INRA-310 ...  62.4    2e-09 
PHRA:scaffold_375                                                     61.6    4e-09 
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  54.7    7e-07 
PHIF:NW_003303606.1 Phytophthora infestans T30-4 supercont1.153 g...  53.9    8e-09 
PHPA:scaffold_134 NW_008649120.1 Phytophthora parasitica INRA-310...  59.3    2e-08 
PYAR:scaffold_8483 par_scaffold_8483 dna:supercontig supercontig:...  57.4    3e-08 
PYIW:scaffold_4003 piw_scaffold_4003 dna:supercontig supercontig:...  58.2    5e-08 
PHIF:NW_003303696.1 Phytophthora infestans T30-4 supercont1.63 ge...  55.1    5e-07 
PHKE:scaffold_1065 scf_22126_1065.1 dna:supercontig supercontig:P...  53.1    2e-06 
PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 g...  53.1    2e-06 
PHKE:scaffold_162 scf_22126_162.1 dna:supercontig supercontig:Phy...  51.6    7e-06 
PHRA:scaffold_66                                                      48.9    5e-05 
PHIF:NW_003303724.1 Phytophthora infestans T30-4 supercont1.35 ge...  47.4    7e-05 
PYIW:scaffold_158 piw_scaffold_158 dna:supercontig supercontig:pi...  48.5    8e-05 
PYIR:scaffold_4917 pir_scaffold_4917 dna:supercontig supercontig:...  47.0    1e-04 
PYVX:scaffold_144 pve_scaffold_144 dna:supercontig supercontig:pv...  47.8    2e-04 
PHKE:scaffold_482 scf_22126_482.1 dna:supercontig supercontig:Phy...  46.6    4e-04 
PYVX:scaffold_610 pve_scaffold_610 dna:supercontig supercontig:pv...  45.4    7e-04 
PHRA:scaffold_64                                                      40.0    0.009 
PHKE:scaffold_342 scf_22126_342.1_contig_1 dna:supercontig superc...  42.0    0.012 
PHRA:scaffold_477                                                     40.8    0.025 
PHKE:scaffold_1358 scf_22126_1358.1_contig_1 dna:supercontig supe...  40.4    0.029 
PHIF:NW_003303631.1 Phytophthora infestans T30-4 supercont1.128 g...  40.0    0.043 
PHPA:scaffold_565 NW_008649551.1 Phytophthora parasitica INRA-310...  39.3    0.066 
PHKE:scaffold_1404 scf_22126_1404.1_contig_1 dna:supercontig supe...  36.6    0.40  
PHKE:scaffold_253 scf_22126_253.1 dna:supercontig supercontig:Phy...  28.1    1.8   
PHPA:scaffold_52 NW_008649038.1 Phytophthora parasitica INRA-310 ...  33.1    7.2   

>PHRA:scaffold_1695
Length=3961

 Score = 486 bits (1251),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%), Gaps = 0/251 (0%)
 Frame = -3

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP
Sbjct  3452  MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  3273

Query  61    AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP
Sbjct  3272  AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  3093

Query  121   DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
             DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY
Sbjct  3092  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  2913

Query  181   YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
             YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV
Sbjct  2912  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  2733

Query  241   FEELLDKTWPF  251
             FEELLDKTWPF
Sbjct  2732  FEELLDKTWPF  2700

 Score = 57.4 bits (137),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  64   KDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVND  100
            KDGSMSG LK SGPQ GECT SRLGSQI ARS WV+D
Sbjct  904  KDGSMSGELK*SGPQFGECTDSRLGSQI*ARSMWVDD  794

 Score = 46.2 bits (108),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = -2

Query  36   VTVSQKTAVKFKPQLKIDAGCHPYPAVQK  64
            V ++QK AVKFKPQLK D GCHPYPA QK
Sbjct  984  VNLTQK-AVKFKPQLKTDDGCHPYPAAQK  901

>PHRA:scaffold_56
Length=334739

 Score = 486 bits (1251),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%), Gaps = 0/251 (0%)
 Frame = +2

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP
Sbjct  152909  MNFRAVFVAAMASLAVAQAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  153088

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP
Sbjct  153089  AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  153268

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
               DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY
Sbjct  153269  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  153448

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
               YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV
Sbjct  153449  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  153628

Query  241     FEELLDKTWPF  251
               FEELLDKTWPF
Sbjct  153629  FEELLDKTWPF  153661

 Score = 305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 177/231 (77%), Gaps = 6/231 (3%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGP-QDG  80
               I HDQV+PF QP+ +TVSQK AVKFKPQLK   GC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  156101  IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  156280

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
               +CT   LGSQIYARS W  DVWAIMY WYFPKG   +         GHRHNWE+VVVWID
Sbjct  156281  DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL----GHRHNWEFVVVWID  156448

Query  141     NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               NP L+N+T+LGVSMSASIGYSK+AP   KY+DGTSVKV+Y+Y+ + GNTAL+LTED GE 
Sbjct  156449  NPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDAGET  156628

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI WDQL  +AR +LN TDWD TL+ L   +MPLKD VF + L K+WPF
Sbjct  156629  QDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  156778

 Score = 57.4 bits (137),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  64      KDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVND  100
               KDGSMSG LK SGPQ GECT SRLGSQI ARS WV+D
Sbjct  155325  KDGSMSGELK*SGPQFGECTDSRLGSQI*ARSMWVDD  155435

 Score = 46.2 bits (108),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = +1

Query  36      VTVSQKTAVKFKPQLKIDAGCHPYPAVQK  64
               V ++QK AVKFKPQLK D GCHPYPA QK
Sbjct  155245  VNLTQK-AVKFKPQLKTDDGCHPYPAAQK  155328

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 408 bits (1048),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 220/251 (88%), Gaps = 0/251 (0%)
 Frame = -3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MNFR V +  +ASLA AQAQVIGHDQVRPFPQP PVTVS K AVKFKPQLKI  GCHPYP
Sbjct  99155  MNFRIVLLVLVASLAGAQAQVIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYP  98976

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              AVQKDGS++GGLKWSGPQDGECTGS+LGSQIYARSAWVNDVWAIMYAWYFPKGR A   P
Sbjct  98975  AVQKDGSITGGLKWSGPQDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLP  98796

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                 R FGHRHNWEYV+VWIDNP  +N+T+LGVSMSA++GY+ Q P +  YVDG SVK+ Y
Sbjct  98795  LITRLFGHRHNWEYVIVWIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEY  98616

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              YYNHLLG+T+LQLTEDTGEFQDLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDGV
Sbjct  98615  YYNHLLGSTSLQLTEDTGEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGV  98436

Query  241    FEELLDKTWPF  251
              F+ELLDK WPF
Sbjct  98435  FQELLDKAWPF  98403

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 404 bits (1038),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGH+QVRPFP+P+PVT SQK AVK+KPQLKI+ GCHPYPAVQKDGS+SGGLKWSGPQDGE
Sbjct  249056  IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  248877

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   P  LR FGHRHNWEY +VWIDN
Sbjct  248876  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  248697

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P LEN+T+LGVSMSAS+GY+ Q P + +YVDG SVK+ YYYNHLLG+T+LQLTE TGEFQ
Sbjct  248696  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  248517

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDGVF+ELL+K WPF
Sbjct  248516  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  248367

>PHSO:scaffold_1
Length=13391543

 Score = 396 bits (1017),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I H+ VRPFPQP PVTVS+K AV+FKPQLKID GCHPYPAVQKDGS+SGGLKW GPQDGE
Sbjct  2797869  INHNLVRPFPQPKPVTVSEKAAVRFKPQLKIDDGCHPYPAVQKDGSISGGLKWGGPQDGE  2797690

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                CTGS+ GSQ+YARS WVNDVWAI+YAWYFPKGR A   P  LR FGHRHNWEY +VWIDN
Sbjct  2797689  CTGSKFGSQVYARSGWVNDVWAIIYAWYFPKGRGAVPLPLILRLFGHRHNWEYAIVWIDN  2797510

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P LENAT+LG SMSAS+GYS Q P + +YVDG+SVKV YYY+HLLGNTAL+LTED GEFQ
Sbjct  2797509  PDLENATILGTSMSASVGYSSQTPLESRYVDGSSVKVEYYYDHLLGNTALRLTEDAGEFQ  2797330

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W+QLS LARYSLNHTDWD+T F  AG+KMPL+DGVFEELLDK WPF
Sbjct  2797329  DLITWEQLSKLARYSLNHTDWDETPFNAAGVKMPLQDGVFEELLDKAWPF  2797180

 Score = 230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP+PVT+S+K AVKFKPQ+ I  GCHPYPAV + G   GGLK  G     
Sbjct  9164773  IDHDQVKPFAQPEPVTISEKAAVKFKPQMHITNGCHPYPAVNEAGETGGGLKTKGAPSAG  9164594

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W   VWAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  9164593  CKGSGWGSQVYGRSTWYRGVWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  9164435

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P LEN  +L VS SA  GYSK AP +   +DGT VKV Y     + N A  +T   G+FQ
Sbjct  9164434  PNLENPKILAVSPSAHSGYSKYAPPNADTLDGTHVKVNYESQWPV-NHATDVTTKGGDFQ  9164258

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W Q+S  AR +LN   W +          P  DG FE  L K WPF
Sbjct  9164257  DLIMWSQMSENARRALNSVGWGK-------ANTPFNDGNFEPKLGKAWPF  9164129

 Score = 221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 142/230 (62%), Gaps = 15/230 (7%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP+ VT+S+K AVKFKPQL I  GCH YPAV + G  SGGLK  G     
Sbjct  9249289  IDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLKTKGAPSAG  9249110

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W  DVWAIMY WYFPK   ++         GHRH+WE+VVVWIDN
Sbjct  9249109  CKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSS-------GIGHRHDWEHVVVWIDN  9248951

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +EN  +L  + SA  GY K AP +   VDG + KVA + +H   + AL  T + G+FQ
Sbjct  9248950  PDVENPKILAGTPSAHSGYHKYAPPNAGTVDGVTTKVA-FESHWPMDHALDSTTEGGDFQ  9248774

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQL+  AR +LN        FG A    P+ DG F+  L + WPF
Sbjct  9248773  DLIMWDQLTDNARRALNSVS-----FGSA--DTPMNDGNFQAELGRAWPF  9248645

 Score = 162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 119/197 (60%), Gaps = 10/197 (5%)
 Frame = +3

Query  33        PDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIY  92
                 P+P T+S+K AVKFKPQL+I  GC+ Y AV   G  SGG+  S   D +C GS LGSQ+Y
Sbjct  12186405  PEPSTISEKAAVKFKPQLRISDGCNSYAAVNAAGDTSGGI--SLGDDSDCDGSNLGSQVY  12186578

Query  93        ARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGV  152
                  RSAW  D+W IMYAWYFP       P         +H+WE +VVWIDNP +E+ TVLGV
Sbjct  12186579  GRSAWYIDMWGIMYAWYFP*DDTDARPY-------RQHSWENIVVWIDNPAVESPTVLGV  12186737

Query  153       SMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA-LQLTEDTGEFQDLIQWDQLSS  211
                 S+S   GY++ AP   + +DG S K+ YY +    +   L++    G+FQDLI W QL+ 
Sbjct  12186738  SVSQGGGYARYAPPYKRNMDGDSPKIKYYLDPEAKDYHWLEVAFFHGDFQDLIMWSQLTE  12186917

Query  212       LARYSLNHTDWDQTLFG  228
                  AR +L   ++     G
Sbjct  12186918  EARTALQGKNFGNAWVG  12186968

 Score = 92.0 bits (227),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 81/163 (50%), Gaps = 24/163 (15%)
 Frame = +1

Query  84        GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                 GS LGSQ+Y R+ W  D+WAIMYAWYFPK              G RH W+  VVW+DNP 
Sbjct  12059116  GSVLGSQVYGRAGWYQDMWAIMYAWYFPKD---VYYRGTFSDKGFRHIWKNAVVWLDNPA  12059286

Query  144       LENATVLGVSMSASI-----GYSKQAPTDVKYVDG----TSVKVAYYYNH----LL----  186
                 +E   +L VS S  I     G  K AP            +S     Y+N     LL    
Sbjct  12059287  VEKPKILAVSTSIGIKGGRYGILKDAPQVCGRSRSGWMQSSPPFTGYFNDSTPMLLSKAD  12059466

Query  187       -GNTALQLTEDT---GEFQDLIQWDQLSSLARYSLNHTDWDQT  225
                  G     L++     GEFQDLI W+QL+  AR +L+ TD+ +T
Sbjct  12059467  DGEDLSSLSQSNVGDGEFQDLIIWEQLTEEARDALSSTDFGET  12059595

 Score = 70.1 bits (170),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  22        IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                 I HD+V+PF QP+PVTVS+  AVKFKP + +   CH  PAV   G  SGGLK +G +D  
Sbjct  12058931  IDHDKVQPFVQPEPVTVSKNAAVKFKPNVLVLWTCHLNPAVNAAGDTSGGLKGTGERDSA  12059110

Query  82        CTG  84
                 C G
Sbjct  12059111  CKG  12059119

 Score = 35.4 bits (80),  Expect(2) = 0.007, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  94        RSAWVNDVWAIMYAWYFPK  112
                 RSAW ++ WAIMYAWY P 
Sbjct  11756031  RSAWTHNAWAIMYAWYLPS  11756087

 Score = 25.8 bits (55),  Expect(2) = 0.007, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 2/23 (9%)
 Frame = +2

Query  118       VPPDFLRFFGHRHNWEYVVVWID  140
                 VPP+ + F  HRH+++ ++VW D
Sbjct  11756075  VPPECILF--HRHDYKGIIVWPD  11756137

 Score = 40.4 bits (93),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 10/56 (18%)
 Frame = -3

Query  98        VNDVWAIMYAWYFPKG--RAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLG  151
                 + D W IM AW+FPKG   A+T+    L+         + VVWI++P L+N+T+L 
Sbjct  12366894  LGDKWTIM*AWHFPKGWQGASTLSHHHLKL--------HAVVWIEHPVLDNSTILS  12366751

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 374 bits (960),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 202/230 (88%), Gaps = 0/230 (0%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGH+QVRPF +P+PVT SQK AVK+KPQLKI+ GCHPYPAVQKDGS+SGGLKWSGPQDGE
Sbjct  399034  IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  398855

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   P  LR FGHRHNWEY +VWIDN
Sbjct  398854  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  398675

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P LEN+T+LGVS+SASI Y+ + P +  +VDG SVK+ YYYNHL G+T+LQLTEDTGEFQ
Sbjct  398674  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  398495

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DL+ WDQL+ LARYSLN+TDWD+TLF LAGLKMPLKDG F+ELL+K WPF
Sbjct  398494  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  398345

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 372 bits (956),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              IGH+ VRPF QP+PVT+S+K A+KFKPQLKI  GCHPYPAVQKDG++SGGLKWSG QDGE
Sbjct  65783  IGHNLVRPFAQPEPVTISEKAAIKFKPQLKISDGCHPYPAVQKDGAVSGGLKWSGSQDGE  65604

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS LGSQ+Y+RSAWVNDVWAIMYAWYFPKGRAAT PP  LR FGHRHNWEY +VWIDN
Sbjct  65603  CGGSELGSQVYSRSAWVNDVWAIMYAWYFPKGRAATPPPLLLRLFGHRHNWEYAIVWIDN  65424

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P  ENATVLG+SMSAS+GY  Q P +  Y+  +SVK+ YYYN L+GNTAL+ TED GEFQ
Sbjct  65423  PNNENATVLGLSMSASVGYENQVPPEASYLSDSSVKIDYYYNLLVGNTALRSTEDAGEFQ  65244

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLIQWDQLS L R +LN+TDWD+TL   A +KMPLKDGVF + LD+ WPF
Sbjct  65243  DLIQWDQLSDLGRKALNNTDWDETLLNAANVKMPLKDGVFRKTLDRAWPF  65094

 Score = 303 bits (775),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 190/252 (75%), Gaps = 6/252 (2%)
 Frame = -3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MN RAV V+   SLAV+QA  I H +V+PF QPDPVTVS+K AVKFKPQLKI   CHPYP
Sbjct  64670  MNVRAVLVSTAISLAVSQADTIPH-EVQPFVQPDPVTVSEKAAVKFKPQLKISDSCHPYP  64494

Query  61     AVQKDGSMSGGLKWS-GPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
              AVQ DGS+SGGLKW+   Q   C GS LGSQIY+RSAW NDV AIMYAWYFPKGR  T  
Sbjct  64493  AVQADGSISGGLKWTLIGQSS*CEGSSLGSQIYSRSAWHNDV*AIMYAWYFPKGRKITGG  64314

Query  120    PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179
                     GHRHNWEY +VWIDNP L+N+T+LGVSMSAS GYSK +P   K+VDG+SVK+ 
Sbjct  64313  AGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSSPPKAKHVDGSSVKLD  64146

Query  180    YYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDG  239
              YYY+ + GNTAL+ TED GE QDLI WDQL  +A+ +LN+TDWD TL+ +  +KMPLKDG
Sbjct  64145  YYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDTTLWNMCDVKMPLKDG  63966

Query  240    VFEELLDKTWPF  251
               F +  +K WPF
Sbjct  63965  EFTKKCEKAWPF  63930

>PHKE:scaffold_28 scf_22126_28.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_28.1:1:184739:1 
REF
Length=184739

 Score = 317 bits (813),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 175/230 (76%), Gaps = 0/230 (0%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I H+ V+ F +PDPVTVS K AVKFKPQL +  GCHPYPAVQ+DGS+SGGLKW+G Q G+
Sbjct  132774  IRHNWVQSFAEPDPVTVSDKAAVKFKPQLHLKEGCHPYPAVQEDGSVSGGLKWAGKQGGD  132953

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS+LGSQ+YARS W  DVWAIMYAWYFPKGR A     + RFFGHRHNWEY +VWIDN
Sbjct  132954  CKGSKLGSQVYARSTWFGDVWAIMYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDN  133133

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P L++  +LGVSMSA+  YSK+AP   KY+DG S+KV YY N ++ +TAL+LT+  GEFQ
Sbjct  133134  PALDDPAILGVSMSAATSYSKRAPPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQ  133313

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DL+ WDQL   AR +L  TDWD TLF  AG K PLKDGVF E L K +P 
Sbjct  133314  DLVTWDQLPDAARNALIDTDWDTTLFNTAGAKFPLKDGVFNETLAKAYPL  133463

 Score = 55.5 bits (132),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = -2

Query  110    FPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS-MSASIGYSKQAPTDV  168
              FPK  A T  P    +FG  H+WE  +VW+D+   ENAT+  VS ++    Y    P + 
Sbjct  23299  FPKDPAYTYVP---FYFGRHHSWENTIVWLDSVS-ENATISAVSALTVLDRYLTYKPPEA  23132

Query  169    KYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
                VDGTSV++ Y    +  +  L  T   GEFQDL
Sbjct  23131  SIVDGTSVRLQYTDITIDTHRFLDTTRTPGEFQDL  23027

 Score = 50.1 bits (118),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGL  72
              + +D V PF Q  P T     A++FKPQL I  G HPYPAV  D + S GL
Sbjct  23558  LEYDVVVPFAQTKPTTNEYVVALEFKPQLYISNGYHPYPAVDADSNTSPGL  23406

 Score = 42.0 bits (97),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -3

Query  79     DGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPK  112
              D +C  S +GS +Y+RS     +WAIMYA YFPK
Sbjct  23391  DEKCARSSIGS*MYSRSTEYKGIWAIMYARYFPK  23290

>PHRA:scaffold_51
Length=360848

 Score = 308 bits (790),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 177/230 (77%), Gaps = 0/230 (0%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V PF QP P T ++K AVK+KP+L ++ GCHPY AVQ DG++SGGL+WSGPQDGE
Sbjct  201698  IPHDTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCHPYAAVQADGAISGGLEWSGPQDGE  201877

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+YAR   V DVWAIMYAWYFPKGRA    P  LRFFGHR+ WEY VVW+DN
Sbjct  201878  CRGSPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPLPVPLSLRFFGHRNGWEYAVVWLDN  202057

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                  +N+TVL  S+SA++G+SK+AP   KY DGTS+ V+YYYNH+ GNTA++ TED GEFQ
Sbjct  202058  LNAKNSTVLATSLSAAVGWSKEAPPKEKYFDGTSLMVSYYYNHIFGNTAVKYTEDAGEFQ  202237

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                LI WDQL  LAR +LN+TDWD T   +A +KMP+KDGVF E L+  +PF
Sbjct  202238  PLITWDQLPDLARKALNNTDWDATPSNVARVKMPMKDGVFLEKLEGAYPF  202387

>PHIF:NW_003303744.1 Phytophthora infestans T30-4 supercont1.15 
genomic scaffold, whole genome shotgun sequence
Length=3093265

 Score = 290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 174/230 (76%), Gaps = 3/230 (1%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +D ++PFPQP P T +QK  +K+KPQLK++ GCHPYPAVQ++G +S GL+WSGP+D  
Sbjct  2217922  IPYDTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGPEDIG  2218101

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQIYARS    D WA+MY WYFPKGRA   P   LR  GHRH WEY VVW+D 
Sbjct  2218102  CKGSSLGSQIYARSKLFKDKWAVMYTWYFPKGRA---PIPGLRSSGHRHGWEYAVVWLDR  2218272

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                    ++T+LG S+SA++G++K++PT  +Y+DG S+KVAYY+N    NTA++ T+D G FQ
Sbjct  2218273  LDANSSTILGTSLSAAVGWAKESPTPKEYLDGHSLKVAYYFNDDFSNTAVKYTQDGGAFQ  2218452

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLIQWDQLS  AR SL +TDWD+TLF +A +KMP+KDGVFEE L   +PF
Sbjct  2218453  DLIQWDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  2218602

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 172/230 (75%), Gaps = 3/230 (1%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I +D V+PFPQP P T +QK  +K+KPQLK++ GC PYPAVQ+DG++S GL+WSGP+D  
Sbjct  780369  IPYDTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGPEDIG  780190

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIYARS    D WA+MY WYFPKGRA    P   R  GHRH WEY VVW+D 
Sbjct  780189  CKGSLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGP---RSSGHRHGWEYAVVWLDK  780019

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                  +N+T+LG S+SA++G++K++PT  +Y+DG S+KVAYY+N    NTA++ T+  G FQ
Sbjct  780018  LTADNSTILGTSLSAAVGWAKESPTPKEYLDGNSLKVAYYFNDDFKNTAVKYTQAGGAFQ  779839

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQLS +AR SL++TDWD+T F +A +KMP+KDGVFEE L   +PF
Sbjct  779838  DLIIWDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  779689

 Score = 180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/268 (40%), Positives = 146/268 (54%), Gaps = 31/268 (12%)
 Frame = -2

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPY  59
              M  RA      A+L    +  + HD++ P PQP+PVT+SQK A+KFKPQL   +  C  +
Sbjct  43045  MKLRAFATTLFAALIACASATVDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSF  42866

Query  60     PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
              PAV   G ++GGLK +   D  C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG      
Sbjct  42865  PAVNAAGEVTGGLKGTNGNDA-CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKGF-----  42704

Query  120    PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS---------------IGYSKQA  164
                ++ F   RH+W+ VVVWIDNP LE   ++GVSMS S                GY  + 
Sbjct  42703  --WMDFPTRRHDWKNVVVWIDNPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEG  42530

Query  165    PTDVK-YVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWD  223
                  + Y+ G++  + + Y   LG+  +      GE+QDLI W+QL+ + R +LN    D
Sbjct  42529  RRYHRTYIYGSNTSLRFQYQTTLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALN----D  42362

Query  224    QTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 FG A  ++P  D  FE+ LDK WP 
Sbjct  42361  SKNFGKA--EVPFSDEHFEDHLDKAWPL  42284

 Score = 120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 117/229 (51%), Gaps = 38/229 (17%)
 Frame = -2

Query  40     QKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVN  99
              Q  AV+F+  L+        P V   G ++GGLKW+   D  C  +  GSQ+Y R+    
Sbjct  85381  QAPAVQFRTPLRA------VPVVNAVGEVTGGLKWTKGNDA-CKFAIKGSQVYGRAGCYK  85223

Query  100    DVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-I  158
              D+WAI+YAWYFPKG        ++ F   RH+W+ VVVWIDN  LE   ++GVSMS S  
Sbjct  85222  DLWAILYAWYFPKGF-------WMDFPTRRHDWKNVVVWIDNLDLETPKIVGVSMSKSDT  85064

Query  159    GYSKQAPTDVKYVDGTSVKVAYYYNHLL---GNTA-------------LQLTEDTGEFQD  202
               Y+K+         G  + V   +N       NT+             L+L E  GE+QD
Sbjct  85063  WYNKETKIWPSNFAGYGI-VGTRFNRTTVYGSNTSPRFDALPSSSFPFLKLAEWDGEYQD  84887

Query  203    LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              LI W+QL+  AR +LN    D   FG A  ++P  D  +E+ L+K WP 
Sbjct  84886  LIMWEQLTDAARAALN----DSANFGNA--EVPFSDERYEDHLEKAWPL  84758

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQL-KIDAGCHPY  59
              MN RA+       L V  +  + HD+++PFPQP PVT+S+KTAVK+KPQL   +  C PY
Sbjct  85518  MNPRALIATVFVVLVVCASATVDHDKIQPFPQPKPVTISEKTAVKYKPQLYNSERLCVPY  85339

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 4/78 (5%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
              + HD++ PFP+P+PVTVS K A++FKPQL   +  C PY A      +  G +    +  
Sbjct  49373  VDHDKI*PFPEPEPVTVSGKAAIEFKPQLYTPSNVCVPYAAEMLPVRLLVG*RNERKRRV  49194

Query  81     ECTGSRLGSQIYARSAWV  98
              +    RL      RS+WV
Sbjct  49193  QVCA*RLAG---LRSSWV  49149

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 27/44 (61%), Gaps = 2/44 (5%)
 Frame = -2

Query  71     GLKWSGPQDGE--CTGSRLGSQIYARSAWVNDVWAIMYAWYFPK  112
              G  W+   +G   C  +  GS +Y R+ W N +WAIMYAWYFPK
Sbjct  49234  GYWWAEGTNGNDACKYAPKGSPVYGRAGWYNYMWAIMYAWYFPK  49103

>PHPA:scaffold_59 NW_008649045.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.59, whole genome shotgun 
sequence
Length=367746

 Score = 280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 172/230 (75%), Gaps = 4/230 (2%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I +D V+PF Q  P T +QK  +K+KPQLKI+ GCHPYPAVQKDGS+S GLKWSGP +  
Sbjct  307248  IPYDSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGPDNIG  307069

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+YAR+ W+   WA+MYAWYFPKGRA    P   R +GHRH WEY VVW+D 
Sbjct  307068  CKGSPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAP---RSYGHRHGWEYAVVWLDK  306898

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                   N+T+LG SMSA+IG++K++PT  +Y+DG S+KVAYY+N    NTA++ T+D GEFQ
Sbjct  306897  -ASANSTLLGTSMSAAIGWAKESPTPKEYLDGNSLKVAYYFNDDSINTAVKYTQDAGEFQ  306721

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQL  +AR +L +TDWD+T   +A +KMP+KDGVF E L+  +PF
Sbjct  306720  DLIIWDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  306571

>PHSO:scaffold_4
Length=7609242

 Score = 279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 172/231 (74%), Gaps = 7/231 (3%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD-G  80
                I +D+V PF QP PVT   KT +K+KP LKI  GCHPYPAVQK+G +SGGL+WS P D  
Sbjct  4632979  IPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPYPAVQKNGDISGGLEWSSPTDNA  4633158

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                EC GS LGSQ+YARS+WV   +AIMYAWYFP GRA  +P      FGHR+ WEY +VW+D
Sbjct  4633159  ECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGRAPLLP------FGHRNGWEYAIVWLD  4633320

Query  141      NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                +    N+T+LG S+SA++G++K+ P + KY+DG ++KVAYY+N  +  TA++ TE+ GEF
Sbjct  4633321  SVSSTNSTILGTSLSAAVGWAKEVPRNRKYLDGNNLKVAYYFNRDVRCTAVEYTEEIGEF  4633500

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QD+I WDQL +  R SL++TDWD T F +A LKMP+KDGVF+E L+  +PF
Sbjct  4633501  QDVITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKDGVFQEKLNSAYPF  4633653

 Score = 182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 135/250 (54%), Gaps = 34/250 (14%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP+PVTVS+KTAVKFKP L+I  GCHPYPAV   G  S GLK  GP+DGE
Sbjct  5852680  IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGPKDGE  5852501

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +        +   G RH W   VVW+DN
Sbjct  5852500  CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGY----GSILAKGQRHKWVSAVVWLDN  5852333

Query  142      PGLENATVLGVSM-SASIGYS--KQAPTDV----------KYVDGTSVKVAY-------Y  181
                P LE   +L +S  +   GY   K  P             +Y++ T+  ++Y        
Sbjct  5852332  PALETPKILAISTWNVEGGYDILKNEPPQCYRYSCDAKFAEYINMTTPMLSYERCRPEPS  5852153

Query  182      YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
                Y+ L   TA      TGE QDL+ W+QLS  AR +L   D+ +         +P  D   
Sbjct  5852152  YHTLRPTTA----RGTGELQDLVMWEQLSEEARIALGEADFGEK------SPVPFIDTNL  5852003

Query  242      EELLDKTWPF  251
                   L+   PF
Sbjct  5852002  NATLEAARPF  5851973

 Score = 180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 130/221 (59%), Gaps = 27/221 (12%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP+PVTVS+KTAVKFKP L I  GCHPYPAV   G  S GLK SG  DG+
Sbjct  6046797  IDHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGLKGSGRIDGK  6046618

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +      DFL   G RH W   VVW+DN
Sbjct  6046617  CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKV-----DFLN-KGQRHKWVSAVVWLDN  6046456

Query  142      PGLENATVLGVSM-SASIGYS--KQAPTD----------VKYVDGTSVKVAYYYN-----  183
                P +E   +L +S  +   GY   K  P +          V+Y++ T+  ++Y  +     
Sbjct  6046455  PAVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRSLEEPV  6046276

Query  184      HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
                H L  T  +    TGE QDL+ W+QLS  AR +L   D+ +
Sbjct  6046275  HTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGE  6046162

>PHCA:scaffold_44 PHYCAscaffold_44
Length=536020

 Score = 278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 170/230 (74%), Gaps = 4/230 (2%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I +D V P P     T +QK AVK+ PQL I+ GCHPY AVQ DG++S GLKWSGPQDG 
Sbjct  333494  IPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPQDGA  333315

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+YARS WV   WAIMYAWYFP G+A  VPP  L   GHR+ WEY V+W+D 
Sbjct  333314  CKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAP-VPPVGL---GHRNGWEYAVIWLDR  333147

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P  +N+T+LGVS+SA++G+SK+AP   K++DG S+KV+YYYN++  NTA++ TE+ GEFQ
Sbjct  333146  PTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFRNTAVKYTEEKGEFQ  332967

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                LI WDQL   AR +L +TDWD+T F +A +KMP+KDGVF E L   +PF
Sbjct  332966  TLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  332817

 Score = 276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 169/230 (73%), Gaps = 4/230 (2%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I +D V P P     T +QK AVK+ PQL I+ GCHPY AVQ DG++S GLKWSGP DG 
Sbjct  339753  IPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPHDGA  339932

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+YARS WV   WAIMYAWYFP G+A  VPP  L   GHR+ WEY V+W+D 
Sbjct  339933  CKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAP-VPPVGL---GHRNGWEYAVIWLDR  340100

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P  +N+T+LGVS+SA++G+SK+AP   K++DG S+KV+YYYN++  NTA++ TE+ GEFQ
Sbjct  340101  PTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFHNTAVKYTEEKGEFQ  340280

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                LI WDQL   AR +L +TDWD+T F +A +KMP+KDGVF E L   +PF
Sbjct  340281  TLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  340430

>PHKE:scaffold_323 scf_22126_323.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_323.1_contig_1:1:42068:1 
REF
Length=42068

 Score = 274 bits (701),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 170/231 (74%), Gaps = 5/231 (2%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV+PF QP+PV+ ++K AVKFKPQL +  GC PYPAV  +GS+S GLKW+G  DG+
Sbjct  6393  ISHDQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKWAGKPDGD  6214

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             CTGS LGSQ+Y+R+ W  D WAIMYAWYFPK R          F+GHRH W++ VVWID+
Sbjct  6213  CTGSPLGSQVYSRADWYEDKWAIMYAWYFPKARQRLSK----YFYGHRHMWQWAVVWIDD  6046

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLL-GNTALQLTEDTGEF  200
             P  +N+TV GVSMSAS+GY K++P   KYVD +SVK+  Y +    G  +L+LTEDTGE 
Sbjct  6045  PASDNSTVQGVSMSASVGYQKRSPPKSKYVDDSSVKLDSYVDFWWSGKASLRLTEDTGET  5866

Query  201   QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLIQWDQL+  AR SL+  D+D++L+    +KMPLKDGVF + L +++PF
Sbjct  5865  QDLIQWDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  5713

 Score = 234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 157/243 (65%), Gaps = 18/243 (7%)
 Frame = -2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             IGHDQV+PF QP+PV+ ++K AVKFKP LK+  GC PYPAV  +G+++GGLKWSG  DG 
Sbjct  1249  IGHDQVQPFIQPEPVSAAEKAAVKFKPHLKVTYGCTPYPAVDAEGAINGGLKWSGAADGG  1070

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C+   LG+QIYARS    D WAIMYAWYFPK R   V  D     GHRH W + VVWI++
Sbjct  1069  CSSPPLGAQIYARSDQYRDKWAIMYAWYFPKARQPDVYID-----GHRHMWHWAVVWIED  905

Query  142   PGLENATVLGVSMSASIGYS-----------KQAPTDVKYVDGTSVKVAYYYNHLLGNTA  190
             P LE+ATVLG+S++  + Y            K+     KY D +SVK+  Y +      A
Sbjct  904   PALEDATVLGISITIGVNYRFVPAYSPLGIHKETSPKSKYFDSSSVKLESYGDSWGTRAA  725

Query  191   -LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFG-LAGLKMPLKDGVFEELLDKT  248
              LQLT D G   DLIQWDQL+  AR SLN  D+DQT  G  + ++MPLKDG F E L++ 
Sbjct  724   SLQLTTDKGGTHDLIQWDQLTDAARESLNMFDFDQTQEGTTSNIQMPLKDGAFIENLERA  545

Query  249   WPF  251
             +PF
Sbjct  544   FPF  536

 Score = 213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 146/233 (63%), Gaps = 9/233 (4%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I +DQV+PF QP+PV+ ++K AVKFKPQL I   C PYPAV   GS+SGGLKWS   + +
Sbjct  14093  INYDQVQPFAQPEPVSDAEKAAVKFKPQLTISGSCKPYPAVDSSGSISGGLKWSDSSNDD  14272

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG--HRHNWEYVVVWI  139
              C GS LGSQ+Y+RS W +  W IMY WYFPK +         R F    RH W + +VWI
Sbjct  14273  CAGSPLGSQVYSRSGWYSYKWGIMYTWYFPKAQQP------YREFSTDSRHMWLWAIVWI  14434

Query  140    DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA-LQLTEDTG  198
              D+P  +++TV G+SMSA IG+ + +P    Y++G+SVK+  Y   +   +  +Q T D G
Sbjct  14435  DDPADDDSTVQGLSMSAIIGHQRMSPVLDYYINGSSVKLESYVGDMSPTSEPIQETLDAG  14614

Query  199    EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              E QDLIQWDQL+  AR SL+  D+ +         MPL+D VF E L   +PF
Sbjct  14615  ETQDLIQWDQLTDAARESLSSFDFAEGEPSFRHHDMPLEDSVFNETLKNAYPF  14773

 Score = 126 bits (317),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 20/199 (10%)
 Frame = -1

Query  56    CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA  115
             C PYPA+  DGS++ GL+WS   D +C  + + +Q+Y+R+ W  D WAIMYAWYFPK + 
Sbjct  8168  CRPYPAINSDGSVTRGLRWSSKGDKDCLNATMDAQMYSRTDWYEDKWAIMYAWYFPKKQ-  7992

Query  116   ATVPPDFLRFFGHRHNWEYVVVWIDN-PGLENATVLGV-SMSASIGYSKQAPTDVKYVDG  173
                   F    G R         +D    LE     G   + AS   S   P + KY+  
Sbjct  7991  ------FQVGVGDR---------LDQ*RPLETQRCWGCRRLLASATRSACLPKE-KYLSE  7860

Query  174   TSVKVAYYYNH-LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGL  232
             +SVK+  Y +  L G + L+LTED GE QDLIQWDQL+   R  L+  D D++   + G+
Sbjct  7859  SSVKLGLYVHMWLTGVSTLRLTEDEGELQDLIQWDQLTDAVRGGLSAVDSDESF*NMEGI  7680

Query  233   KMPLKDGVFEELLDKTWPF  251
             +  LKD VF ++L K   F
Sbjct  7679  EFLLKDDVFAKILKKASSF  7623

 Score = 40.0 bits (92),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 2/36 (6%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCH  57
             I +DQV+PF QP+PV+ ++K AVKFKP   +   CH
Sbjct  8250  IDYDQVQPFAQPEPVSDAKKAAVKFKPMPSV--PCH  8149

 Score = 36.6 bits (83),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -3

Query  216   SLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             SL+  D++ ++  L  ++MPLKD VF   L+K++PF
Sbjct  2286  SLSEFDFENSIRNLDRIEMPLKDDVFTNKLEKSYPF  2179

>PHPA:scaffold_64 NW_008649050.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.64, whole genome shotgun 
sequence
Length=359882

 Score = 262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 162/234 (69%), Gaps = 9/234 (4%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               +GHD+V+PFPQP+P+T SQK AVKFKPQL I  GCHPYPAVQ DG++SGGLK+SG  DG+
Sbjct  233409  VGHDRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYSGKPDGD  233588

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  DVWAI YAWY PKG         +   GHRH W YV VWI+N
Sbjct  233589  CKGSALGSQVYSRSTWYRDVWAITYAWYLPKGYERFSGLSMVE--GHRHFWGYVTVWINN  233762

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLL----GNTALQLTEDT  197
               P +ENA +LGVSMS  +G+  QAP D K VDG+++K+  +  H++    G   L+  E  
Sbjct  233763  PAVENAYILGVSMSGQLGHDTQAPVDKKCVDGSTLKLE-FDGHVMDGAKGKQGLRCVEAV  233939

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               G+FQDLI WDQL+  AR SLN  ++D    G     +PLKDGVF  LL+ TWPF
Sbjct  233940  GKFQDLITWDQLTEAARDSLNTYNFDS--IGRDMGTVPLKDGVFTNLLNSTWPF  234095

 Score = 42.4 bits (98),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +3

Query  32      QPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGL  72
                P+PV +SQKTA  F+PQL     C   P V   G+++G L
Sbjct  254319  HPEPVAMSQKTATSFRPQLHTKPCCMSLPTVNATGTVTGRL  254441

>PHSO:scaffold_11
Length=2192408

 Score = 261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 162/230 (70%), Gaps = 9/230 (4%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+P  QP PVT +QK AVK+KPQL++  GCHPYPAVQ +GS+SGGL+WSGP DG+
Sbjct  1382766  INHDQVQPMAQPTPVTDAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPADGD  1382945

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+YARS W  D WA MY WYFPKGR           +GHRH WEY ++W D+
Sbjct  1382946  CEGSSLGSQVYARSDWFKDKWATMYTWYFPKGRQ--------DVWGHRHFWEYAIIWTDS  1383101

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P  +N+T LG+SMSA +G+ KQ P  +KY++G SVK+  +Y+ L    ALQLT+D+G+FQ
Sbjct  1383102  PSPDNSTFLGISMSAGVGHGKQTPVLLKYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQ  1383281

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W QL   AR +LN   +D T F     +MPLKD VF  +L+K +P+
Sbjct  1383282  DLITWGQLPVPARDALNGDAFDVTYF-FNKFEMPLKDRVFMSVLNKAYPW  1383428

 Score = 237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 150/230 (65%), Gaps = 4/230 (2%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV PF Q +PV  S K A+KFKP+L+I  GCHPYPAVQ DG++S GLKW+G  DG+
Sbjct  1457329  INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKADGK  1457150

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RSAW    +AIMYAWYFPKG       +    + HRH W Y+V+WIDN
Sbjct  1457149  CKGSGLGSQVYSRSAWFEGKFAIMYAWYFPKGFEQRGKIN----YSHRHLWLYLVLWIDN  1456982

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P  EN  +LGV +  + G  ++ P D K++DG+S+KV YY +   G T +QLTE+ GEFQ
Sbjct  1456981  PENENPAILGVWLRTAGGNERRTPPDAKFLDGSSLKVDYYKSSWHGKTGIQLTENPGEFQ  1456802

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W+Q++  AR +L   D+D        L +P  DG F   L K W F
Sbjct  1456801  DLITWEQMTEEARIALTEADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  1456652

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 150/231 (65%), Gaps = 6/231 (3%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV+ +GS+S GLKW+G  DG+
Sbjct  1381194  INHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGLKWTGWADGD  1381015

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y +VW D+
Sbjct  1381014  CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYASQ----YRSGHRHFWSYAIVWTDS  1380847

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                   +N+T+ GVSMSA +GY K  P   KY VDG +VK   Y++       ++ T  TGE 
Sbjct  1380846  DKPDNSTIQGVSMSAGVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTTTKTGET  1380667

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W+QL+  AR +L   D+D   +    + MPL D VF E L+K +PF
Sbjct  1380666  QDLITWEQLTDEARTALTDADFD-VDWSYKKVVMPLLDDVFTEKLEKAYPF  1380517

 Score = 231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 154/230 (67%), Gaps = 8/230 (3%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+ FPQP+PVT  +K AVK+KPQL I  GCHPYPAVQ DGS+  GLKWSGP+ G+
Sbjct  1378461  IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQADGSVGAGLKWSGPEKGK  1378282

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS L SQ+Y+RS W    W IMYAWYFPKGRA     DF    GHRH WE VVVW+DN
Sbjct  1378281  CRGSGL*SQVYSRSDWYRGKWTIMYAWYFPKGRACK--DDFKT--GHRHFWEDVVVWVDN  1378114

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                P  +N+T+LGV M A   + K  P D KY+ DG +VK   Y +  LG   + LTED GE 
Sbjct  1378113  PNPDNSTLLGVPMYAGHRHIKVVPVDEKYLKDGKTVKFGSYKS--LGAQVVGLTEDYGEI  1377940

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                QDLI W+QL+  AR +L+  ++     G+  + +P+KDG FE+ L+  +P
Sbjct  1377939  QDLITWEQLTVEARTALSEANF-HVDGGVREVVVPIKDGQFEKTLESAYP  1377793

 Score = 225 bits (574),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 149/233 (64%), Gaps = 10/233 (4%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD V+P  QP+P T S+KTAVK+KPQL I  GCHPYPAVQ DGS+S GLKWSG  +G+
Sbjct  1415854  INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWANGK  1416033

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWI  139
                C GS LGSQ+Y+RS W    WAIMYAWYFPKGR       ++  +  GHRH W Y +VW 
Sbjct  1416034  CKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGR------QYVSKYRKGHRHFWSYAIVWT  1416195

Query  140      DNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTG  198
                D+   +N+T+ GVSMSA +G+ K  P   KYV DG +VK   Y++       ++ T  TG
Sbjct  1416196  DSDKPDNSTIQGVSMSAGVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTTTKTG  1416375

Query  199      EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                E QDLI W+QL+  AR  L + D+D   +    + MPL D  F + L K +PF
Sbjct  1416376  ESQDLITWEQLTDEARTGLTNADFD-VDWSYRKVVMPLSDEDFTDKLKKAYPF  1416531

 Score = 214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 148/234 (63%), Gaps = 13/234 (6%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWS--GPQD  79
                IGHDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ DGS++GGLKW+     D
Sbjct  1375170  IGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHPYPAVQADGSVNGGLKWTFWSWAD  1374991

Query  80       GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVV  137
                 +C GS LGSQ+Y+RS W    WAI+YAWYFPKGR      DF   F  GHRH W Y ++
Sbjct  1374990  SDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGR------DFEHSFKRGHRHYWLYAIL  1374829

Query  138      WIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT  197
                W D+P  + +T+LGVS+         AP     +DG ++K   Y +   G   L LTE T
Sbjct  1374828  WTDSPNPDTSTILGVSVPNGFRDKSAAPDAQFVIDGKTIKFDSYRSFTTGRQDLGLTEKT  1374649

Query  198      GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                G+ QDLI W+QL+  AR +L++ ++D        + +P+KDG F E L +  PF
Sbjct  1374648  GDTQDLITWEQLTEEARTALSNMNFDGP---RQKIVVPMKDGDFAERLARA*PF  1374496

 Score = 175 bits (443),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 102/146 (70%), Gaps = 10/146 (7%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP+P T S+  AVKFKP L++  GC PYPAV  +GS+S  LKW+G  DG+
Sbjct  1450021  INHDQVQPFAQPEPATDSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKNDGD  1450200

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG--RAATVPPDFLRFFGHRHNWEYVVVWI  139
                C GS LGSQ+Y+RS W  D WA+MYAWYFPKG   A+TV         HRH W + VVWI
Sbjct  1450201  CEGSALGSQVYSRSDWYKDKWAMMYAWYFPKGWQGASTV--------SHRHLWLHAVVWI  1450356

Query  140      DNPGLENATVLGVSMSASIGYSKQAP  165
                DNP L+N+T+L VS   +IGY K +P
Sbjct  1450357  DNPALDNSTILAVSTPGTIGYKKYSP  1450434

 Score = 69.3 bits (168),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +3

Query  169      KYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFG  228
                K+V+G+ VK+            L+LT D GE QDLI WDQ++  AR +L+  ++D+ LF 
Sbjct  1450443  KFVNGSRVKLDASRGFWASKMLLKLTTDKGESQDLITWDQMTEEARTALSEANFDKHLFK  1450622

Query  229      LAGLKMPLKDGVFEELLDKTWPF  251
                    K+P KDGVF + L K  PF
Sbjct  1450623  RKNTKVPFKDGVFTDKLKKA*PF  1450691

 Score = 157 bits (396),  Expect(3) = 5e-56, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 90/128 (70%), Gaps = 8/128 (6%)
 Frame = +1

Query  28       RPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRL  87
                R  P   P T S++ AVK+KPQL +  GCHPYPAVQ +GS+S GLK SG  DGEC GS L
Sbjct  1455457  RAIPSTKPKTASERAAVKYKPQLHVSFGCHPYPAVQANGSVSAGLKGSGFSDGECKGSSL  1455636

Query  88       GSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENA  147
                GSQ+YARS W ND WAIMYAWY PKGR       F R F  RH WE  VVWID+P L+N+
Sbjct  1455637  GSQVYARSDWYNDKWAIMYAWYLPKGR-------FSR-FQRRHFWEVAVVWIDDPALKNS  1455792

Query  148      TVLGVSMS  155
                 +LGVS++
Sbjct  1455793  IMLGVSLN  1455816

 Score = 76.3 bits (186),  Expect(3) = 5e-56, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +2

Query  157      SIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYS  216
                + G S + P + KY+DG SV +  +         L+ TE  GEFQDLI W+QL+  AR +
Sbjct  1455818  TTGTSSRNPVEEKYMDGDSVMLDSFLGLAFHRPKLRFTEKRGEFQDLITWEQLTDEARDA  1455997

Query  217      LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                L + D+D  +F     +MPLKD VF   L   WPF
Sbjct  1455998  LTNADFDSKIFEGRVKRMPLKDDVFYARLKDAWPF  1456102

 Score = 28.5 bits (62),  Expect(3) = 5e-56, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = +2

Query  22       IGHDQVRPFPQPD  34
                I HDQV PFPQP 
Sbjct  1455440  INHDQVEPFPQPS  1455478

 Score = 191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 137/245 (56%), Gaps = 29/245 (12%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP P TVS+K AVKFKP L+I  GCHPYPAV   G  SGGLK +GP DG+
Sbjct  716517  IDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDGK  716696

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L + G RH W   VVW+DN
Sbjct  716697  CKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDK-------HLGYKGQRHKWVDAVVWLDN  716855

Query  142     PGLENATVLGVSM-SASIGY--SKQAPTDV----------KYVDGTSVKVAY---YYNHL  185
               P  E   VL VS  S   GY   K  P             ++++ T+  ++Y   Y    
Sbjct  716856  PAFETPKVLAVSTWSWGGGYVIKKNVPQRCEHGSCGKAFAEFMNNTTPMISYRPFYMETS  717035

Query  186     LGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                    +  T  TGE QDLI W+QLS  AR +L+ TD     FG A  K+P  D  FE  L
Sbjct  717036  FHTLEMTSTRGTGELQDLIMWEQLSPEARTALSETD-----FGEAA-KVPFIDANFETNL  717197

Query  246     DKTWP  250
               +   P
Sbjct  717198  ELARP  717212

 Score = 179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 112/176 (64%), Gaps = 9/176 (5%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PFP+ +PV  S+K AVKFKPQL+I  G H YPAV++DG++S GLKW G  DGE
Sbjct  1438960  INHDEVQPFPELEPVGASEKAAVKFKPQLQISYGFHTYPAVRRDGAVSNGLKWGGKPDGE  1439139

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W    WAIMYAWYFPK               HRH W Y+VVWIDN
Sbjct  1439140  CKGSAWGSQVYTRSDWYQGKWAIMYAWYFPKAWQEN------DLISHRHLWLYIVVWIDN  1439301

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT  197
                P   N  VLGV +  + G  ++AP D K+ +G+S+K  YY +   G T LQ T+  
Sbjct  1439302  PEAVNPAVLGVYVRTAGGSERRAPPDAKFFEGSSLKSEYYKS---GKTGLQRTDKA  1439460

 Score = 177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 129/236 (55%), Gaps = 21/236 (9%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV PF Q +    S+K A+KFKPQL+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  1461627  INHDQVHPFAQVEAANASEKAAIKFKPQLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  1461806

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHN--------WE  133
                  GS LGSQ+Y+             A    + R  +  P     +  R          W 
Sbjct  1461807  YQGSGLGSQVYS-------------ARPGTRVRERSCTPGTSLKYERREQVSAIATCGWL  1461947

Query  134      YVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQL  193
                Y+V+WIDNP   N  +LGV +    G  ++ P D K++DG+S+K+ YY       T LQL
Sbjct  1461948  YMVIWIDNPEAINPAILGVCVRTEGGNEQRVPPDAKFLDGSSLKLDYYKRTWHRKTGLQL  1462127

Query  194      TEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                T+D GEFQDL+ W+Q++  AR +L   D+D        L +P  DG F   L+K W
Sbjct  1462128  TKDKGEFQDLVTWEQMTEEARITLTEADFDDHWQERNDLDVPFIDGEFTVNLEKAW  1462295

 Score = 160 bits (405),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 89/132 (67%), Gaps = 7/132 (5%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP P TVS+K AVKFKP L+I  GCHPYPAV   G  SGGLK +GP DG+
Sbjct  710348  IDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDGK  710169

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L + G RH W   VVW+DN
Sbjct  710168  CKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDK-------HLGYKGQRHKWVDAVVWLDN  710010

Query  142     PGLENATVLGVS  153
               P  E   VL VS
Sbjct  710009  PAFETPKVLAVS  709974

 Score = 45.4 bits (106),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 43/86 (50%), Gaps = 9/86 (10%)
 Frame = -3

Query  168     VKYVDGTSVKVAY---YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
                ++++ T+  ++Y   Y         +  T  TGE QDLI W+QLS  AR +L+ TD   
Sbjct  709893  AEFMNNTTPMISYRPFYMETSFHTLEMTSTRGTGELQDLIMWEQLSPEARTALSETD---  709723

Query  225     TLFGLAGLKMPLKDGVFEELLDKTWP  250
                 FG A  K+P  D  FE  L+   P
Sbjct  709722  --FGEAA-KVPFIDANFETNLELARP  709654

 Score = 159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 116/205 (57%), Gaps = 13/205 (6%)
 Frame = +3

Query  25       DQVRPFPQPD--PVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGEC  82
                +QV PFPQP   P     +++         DA         K  ++S GLK SG  DGEC
Sbjct  1464477  NQVEPFPQPSRRPRLSELQSSTSLNSTFPSDAT---RTLRFKLTALSAGLKGSGFSDGEC  1464647

Query  83       TGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
                 GS LGSQ+YARS W ND W IMYA Y PKGR       F RF   RH WE  VVWID+P
Sbjct  1464648  EGSSLGSQVYARSDWYNDKWVIMYA*YLPKGR-------FSRF-QRRHFWEVAVVWIDDP  1464803

Query  143      GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                 L+N+T+LGVS++ +     Q P + KY+DG SV +  +         L+ TE  GEFQD
Sbjct  1464804  ALKNSTMLGVSLNYNRRLKPQTPVEEKYMDGDSVMLDSFLGLAFPRPKLRFTEKRGEFQD  1464983

Query  203      LIQWDQLSSLARYSLNHTDWDQTLF  227
                LI W+QL+  AR +L + D+D  +F
Sbjct  1464984  LITWEQLTDEARDALTNADFDSKIF  1465058

 Score = 139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD V+P  QP+P T S+KTAVK+KPQL I  GCHPYPAVQ DGS+S GLKWSG  +G+
Sbjct  1413197  INHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWANGK  1413018

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGR  114
                C GS LGSQ+Y+RS W    WAIMYAWYFPKGR
Sbjct  1413017  CKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGR  1412919

 Score = 135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV PF Q +PV  S K A+KFKP+L+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  1454254  INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  1454433

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG---RAATVPPDFL  123
                C GS LGSQ+Y+RS W    WAIMYAWYFPKG     ATV   F+
Sbjct  1454434  CKGSGLGSQVYSRSDWYQGKWAIMYAWYFPKGFLRLTATVTCGFI  1454568

 Score = 115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 87/144 (60%), Gaps = 10/144 (7%)
 Frame = -1

Query  111      PKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDV  168
                PKGR       ++R +  GH H W Y +VWIDNP  +N+T+LGVSMSA +GY K +P   
Sbjct  1409723  PKGR------QYIRKYNSGHHHYWSYAIVWIDNPNPDNSTILGVSMSAGVGYRKASPPKS  1409562

Query  169      KY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLF  227
                KY VDG +VK   Y +       ++LT  +G+ QDLI W+QL+  AR +L+  D+D   +
Sbjct  1409561  KYVVDGVTVKFDSYRSFWGSKQGVRLTTKSGDQQDLITWEQLTDEARTALSDADFDVN-W  1409385

Query  228      GLAGLKMPLKDGVFEELLDKTWPF  251
                 L  + MPLKD    E L+K +PF
Sbjct  1409384  SLKNVVMPLKDDALRERLEKAYPF  1409313

 Score = 112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 78/130 (60%), Gaps = 0/130 (0%)
 Frame = +3

Query  122      FLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY  181
                F   + HRH W Y+V+WIDNP   N  +LGV +  + G  ++ P D K++DG+S+KV YY
Sbjct  1454529  FFTSYSHRHLWLYLVLWIDNPEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYY  1454708

Query  182      YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
                 +   G T +QLTE+ GEFQDL+ W+Q++  AR +L   ++D        L +P  DG F
Sbjct  1454709  KSSWHGKTGIQLTENPGEFQDLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEF  1454888

Query  242      EELLDKTWPF  251
                   L+K W F
Sbjct  1454889  TVNLEKAWIF  1454918

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+ +PF Q  PVT ++K AV+FKP L++  GCHPY AV   G  S GLK +   DG+
Sbjct  1134270  IDHDKEQPFAQLAPVTATEKAAVRFKPSLEVVKGCHPYSAVNAAGETSAGLKGTDKPDGK  1134091

Query  82       CTGSRLGSQIYARSAWVNDVWAIMY--------------AWYFPKGRAATVPPDF  122
                C GS LGSQ+Y R+   ++                    A   P G +  +PPD 
Sbjct  1134090  CKGSILGSQVYGRAGRGSEAVTGTRCRVA*RPGAGEPADASRAPDGTSTVLPPDM  1133926

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 60/107 (56%), Gaps = 10/107 (9%)
 Frame = -2

Query  87      LGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLEN  146
               L   +Y RSAW  +VWA MYAWYFPK    +         GHRH+WE +VVW++NP  E 
Sbjct  354946  LSCSLYVRSAWQKNVWATMYAWYFPKDSPKSGK-------GHRHDWENIVVWLENPAPEC  354788

Query  147     ATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQ  192
                 +L VS S+  G Y K +P D K++ G +  V   Y  + GN+  Q
Sbjct  354787  TKLLAVSTSSDNGEYLKYSPPDKKFIAGNAPLVK--YESVDGNSEAQ  354653

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -3

Query  32      QPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQI  91
               Q + +++S+K AV+FKPQL I  GC+ YPAV   G  SGGLK +G       G    SQ+
Sbjct  356505  QSEAISLSEKAAVRFKPQLLIGNGCNTYPAVNAQGQTSGGLKPTGGSSSG*RGFFTTSQV  356326

Query  92      YARSA  96
               Y  S+
Sbjct  356325  YVGSS  356311

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 53/118 (45%), Gaps = 15/118 (13%)
 Frame = -2

Query  81       ECTGSRLGSQIY------ARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNW  132
                +C G  LGSQ+       +RS    D WAIMY   F K        DF+ +   G     
Sbjct  1432978  DCKGPSLGSQVL*SSQVISRSDSYKDNWAIMYR*CFLKA------ADFIMWAVSGR**Y*  1432817

Query  133      EYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA  190
                +Y VVW D+   +N T+ G   S   G +       KY++G+SVKV  YY  L    A
Sbjct  1432816  KYEVVWFDSSSTDN*TIFGTPTSTGKGLN-*CLQKAKYLEGSSVKVNSYYCLLRSTGA  1432646

 Score = 36.6 bits (83),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  191      LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDW  222
                L LT + G+FQDL+ W Q++  AR +L  TD+
Sbjct  1123940  LSLTGNKGKFQDLVMWQQMTGEARRALTETDF  1123845

 Score = 36.6 bits (83),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 16/78 (21%)
 Frame = +3

Query  35       PVTVSQKTAVKFKPQLKIDAGCHPYPAVQKD----GSMSGGLKWSGPQDGECTGSRLGSQ  90
                P T S++   K + Q  +  GCHPYPAVQ+      S  GG             SR   +
Sbjct  1462524  PRTASKQATAKSRAQRHVSFGCHPYPAVQEGTGLLSSFFGG------------SSRTQKK  1462667

Query  91       IYARSAWVNDVWAIMYAW  108
                   R + V   W++  +W
Sbjct  1462668  AERRFSKVKKHWSVKPSW  1462721

 Score = 34.3 bits (77),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = -1

Query  164     APTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQ  208
               +P  V Y + TS  +AY  N   G++    T   GE QDLI W+Q
Sbjct  939092  SPPFVDYSNDTSPMIAYGTNKFYGSSLDITTARGGELQDLIMWEQ  938958

>PHCA:scaffold_36 PHYCAscaffold_36
Length=679425

 Score = 256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 158/230 (69%), Gaps = 8/230 (3%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HDQV+PF QP+P+T SQK+AVK+KPQL I  GCHPY AVQ DGS SGGL+WSG  DG+
Sbjct  238345  VNHDQVQPFAQPEPITDSQKSAVKYKPQLHISYGCHPYAAVQADGSASGGLEWSGRVDGD  238524

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CTGS+LGSQ+Y+RS W +D WAIMYAWYFPKGR            GHRH WEY +VW D+
Sbjct  238525  CTGSQLGSQVYSRSDWYHDKWAIMYAWYFPKGR--------YHLGGHRHYWEYAIVWTDS  238680

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N+++ GVSMSA +GY K  P  +KY+DG S+K   +++ L    ALQLT++ GE Q
Sbjct  238681  PTSSNSSIQGVSMSAGVGYGKATPPMLKYIDGNSIKFDSHFSLLGNKAALQLTKEAGERQ  238860

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQL+  AR +LN    D   +     ++P KD +F + L K +PF
Sbjct  238861  DLITWDQLTVAARDTLNGDALDGKAWFTDKDEVPFKDDIFVKRLQKAFPF  239010

 Score = 249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 158/231 (68%), Gaps = 7/231 (3%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ +GS+SGGLKW+G  DG+
Sbjct  257602  INHDQVQPFTQPEPTTDSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSDGD  257423

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  S LGSQIY+RS W ND WAIMYAWYFPKG       D     GHRH W Y +VW  +
Sbjct  257422  CKRSALGSQIYSRSDWHNDKWAIMYAWYFPKGNEFQANFD----SGHRHYWSYAIVWTGS  257255

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               P  EN+TVLGVSMS+S GY K+AP   KYV DGT+VK   Y +      A++LT+  GE 
Sbjct  257254  PNPENSTVLGVSMSSS-GYGKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEA  257078

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI W+QL+  AR +L+  D+ +     + + MPLKD VF  +L K +PF
Sbjct  257077  QDLITWEQLTQEARTALSEADF-KAESTFSKVVMPLKDDVFSSILKKAYPF  256928

 Score = 246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 155/231 (67%), Gaps = 6/231 (3%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ DG++S GLKW+G   G+
Sbjct  258617  IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGTASGQ  258438

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  + WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  258437  CKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYISK----YRFGHRHFWSYAIVWMDS  258270

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                  +N+T+LGVSMSA +GYSK+ P   KY VDGT+VK   Y++      A+ LT   GE 
Sbjct  258269  DVPDNSTILGVSMSAGVGYSKETPPKSKYVVDGTTVKFKSYHSFWGSKLAVGLTTKEGES  258090

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI W+QL+  AR  L   D+D   +    + MP+ DGVF E L K +PF
Sbjct  258089  QDLIAWEQLTDEARSGLTDADFD-VDWSFRKVVMPMTDGVFTEKLKKNYPF  257940

 Score = 236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 148/230 (64%), Gaps = 8/230 (3%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PFPQP P T S+K AVK+KPQL +  GCHPYPAVQ DGS+S GLK +GP  GE
Sbjct  250437  IDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGPAAGE  250616

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMY+WY PKGR A         +  RH WE  VVWID+
Sbjct  250617  CGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAK--------YQRRHLWETAVVWIDD  250772

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P L N+T+LGVS++    +   AP + +++D + VK+  Y         L+ T   GE Q
Sbjct  250773  PSLANSTILGVSLNYGWRHKTMAPIESEFLDDSRVKLESYRGFSYPRPKLRFTTHVGETQ  250952

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QL+  AR +L++ ++D  L      +MPLKDGVFE+ L   WPF
Sbjct  250953  DLITWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  251102

 Score = 213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 135/211 (64%), Gaps = 13/211 (6%)
 Frame = +1

Query  41      KTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVND  100
               K AVKFKPQL I  GCHPYPAVQ DG +S GLK +GP DGEC GS LGSQIYARS W   
Sbjct  252388  KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTGPDDGECQGSSLGSQIYARSDWYKG  252567

Query  101     VWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGY  160
               V+AIMY WY PKG A+            RH WE VVVWID+P   N+T+LGVS++  +  
Sbjct  252568  VYAIMYTWYLPKGSAS------------RHFWESVVVWIDDPAASNSTILGVSLNYGLQL  252711

Query  161     SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                K+   D KY+ G+S+K+  +    + N  L+LTE  GEFQDL+ +DQL+  A  +L+H 
Sbjct  252712  KKETNIDPKYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHA  252891

Query  221     DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               ++ + L   A   MPL DGVF E L   WPF
Sbjct  252892  EFSKGLIK-AKTPMPLIDGVFNERLKDAWPF  252981

 Score = 212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 142/231 (61%), Gaps = 9/231 (4%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HD+V+PF QP P    ++ AVK+KP+L +  GCHPYPAVQ +GS+S GL+ SGP DGE
Sbjct  260984  MDHDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPDDGE  260805

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GSRLGSQ+Y+RS W ND WAIMY WY PKGR+  +          RH WE  V+WID+
Sbjct  260804  CKGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGKL--------QDRHFWETAVIWIDD  260649

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSV-KVAYYYNHLLGNTALQLTEDTGEF  200
               P LE++ +LGVS++       +     ++++ + V K   Y         L+ TE  G+ 
Sbjct  260648  PTLEDSKLLGVSLNYEDRRVSKIAIKGRHLNASKVLKFESYEAEKSPKPRLRFTEKAGKT  260469

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI WDQL + AR  L+ T +  + FG    +MPLKD VF + L   WPF
Sbjct  260468  QDLITWDQLPAKARKGLSTTKFYSSPFGSVKREMPLKDEVFLKRLKDAWPF  260316

 Score = 151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 125/227 (55%), Gaps = 24/227 (11%)
 Frame = +2

Query  36      VTVSQKTAVKFKPQLKIDAG---CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIY  92
               VTVS+K AVKFKPQL        C P+PAV   G ++GGLK +   D  C  +  G+Q+Y
Sbjct  197894  VTVSEKAAVKFKPQLYTPTKIPVCAPFPAVNAAGEVTGGLKGTNGNDA-CKYAPKGAQVY  198070

Query  93      ARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGV  152
                R+ W  DVWAIMY+WYFPKG       ++L F   RH W+ VVVWI+NP LE   ++GV
Sbjct  198071  GRAGWYKDVWAIMYSWYFPKGF------NWLGFPSKRHKWKNVVVWIENPDLETPKIVGV  198232

Query  153     SMS-ASIGYSKQAPTDVKYVDGTSVKVAYYY----NHLLGNTALQ---LTEDTGEFQDLI  204
               +MS A+  Y K+      Y  G+ V+   Y       L  + AL+        G++QDLI
Sbjct  198233  AMSKANTEYQKEREMYNSYFAGSEVRYRTYAPGSNTSLRFHNALRDQSFASRDGDYQDLI  198412

Query  205     QWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                W+QL+  AR +LN ++           ++P  D  +E+ L+K WP 
Sbjct  198413  MWEQLTDAARVALNDSE------PFEKTEVPFSDEHYEDNLEKAWPL  198535

 Score = 137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 96/159 (60%), Gaps = 6/159 (4%)
 Frame = +1

Query  94      RSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS  153
               RS W  D WAIMYAWYFPKGR       F    GHRH W Y +VW+D+   +N+T+LGVS
Sbjct  236632  RSDWYKDKWAIMYAWYFPKGRQYISKYRF----GHRHYWSYAIVWMDSDVPDNSTILGVS  236799

Query  154     MSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSL  212
               MSA +GYSK+ P   KY VDGT+VK   Y++      A+ LT   G+ QDLI W+QL+  
Sbjct  236800  MSAGVGYSKETPPKSKYVVDGTTVKFESYHSFWGSKLAVGLTTKEGKSQDLITWEQLTDE  236979

Query  213     ARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               AR  L   D+D   +    + MP+ DGVF + L   +PF
Sbjct  236980  ARTGLTDADFDVD-WSFRKVVMPMTDGVFTDKLKNNYPF  237093

 Score = 81.6 bits (200),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  40      QKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARS  95
               ++  +K+KPQL I  GCHPYPAVQ DG++S GLKW+G   G+C GS LGSQ+Y+RS
Sbjct  210407  KRRVLKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGSVSGQCKGSDLGSQVYSRS  210574

 Score = 78.6 bits (192),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 9/86 (10%)
 Frame = +1

Query  98      VNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS  157
               V D WAIMYAWYFPKGR       F    GHRH W Y +VW+D+   +N+T+LGVSMSA 
Sbjct  210580  VQDKWAIMYAWYFPKGRQYISKYRF----GHRHFWSYAIVWMDSDVPDNSTILGVSMSAG  210747

Query  158     IGYSKQAPTDVKYVDGTSVKVAYYYN  183
               +GY+K        VD T VK   Y++
Sbjct  210748  VGYNKTYV-----VDDTIVKFESYHS  210810

 Score = 101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPYPAVQ DG++S GLKW+G   G+
Sbjct  236045  IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGTASGQ  236224

Query  82      CTGSRLGS  89
               C GS LGS
Sbjct  236225  CKGSGLGS  236248

 Score = 62.8 bits (151),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  67      SMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPK-GRAATVPPDFL  123
               S+SGGLKW+G  +G C  S LGS +Y+RS W  D WAIMYAWY+P  G     PP  L
Sbjct  237309  SVSGGLKWAGWYNGGCKRSALGS*VYSRSDWYKDKWAIMYAWYYPI*GEFRFWPPSLL  237482

 Score = 40.0 bits (92),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 52/113 (46%), Gaps = 16/113 (14%)
 Frame = +2

Query  135     VVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNH----LLGNTA  190
                +V   +P  EN+TVLGVSMSA+ GY ++AP    Y          Y  H         A
Sbjct  237488  AIV*TGSPNPENSTVLGVSMSATSGYGEKAPPKSNY---------RY*RHNGEIRASKQA  237640

Query  191     LQLTEDTGEFQDLIQWDQL--SSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               ++LT+   E QD         S   + S   ++W  + F  + + +PLKD VF
Sbjct  237641  IRLTKKEEEAQDSSHGSYA*GSYCFK*SCFESEWMFSNF-ESKVMLPLKDDVF  237796

 Score = 39.3 bits (90),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKF  46
               I HDQV+PF QP+P T S+K+AVK 
Sbjct  210193  IDHDQVQPFAQPEPTTNSEKSAVKL  210119

>PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.12, whole genome shotgun 
sequence
Length=1504206

 Score = 253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 159/230 (69%), Gaps = 8/230 (3%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HD+V+PF Q  P+T SQK+AVK+KPQL I  GCHPYPAVQ +GS SGGL+WSGP DG+
Sbjct  1166648  VNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGLEWSGPVDGD  1166827

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                CTGS LGSQ+Y+RSAW  + WAIMYAWYFPKGR            GHRH WEY +VW D+
Sbjct  1166828  CTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGRYGIT--------GHRHYWEYAIVWTDS  1166983

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                    N+++ GVSMSA +G++K  P  +KYVDG+S+K+  Y++ +    ALQLT++ GE Q
Sbjct  1166984  ATSTNSSIQGVSMSAGVGHAKATPPMLKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQ  1167163

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQL+  AR +LN    D  ++     ++P KD +F + L   +PF
Sbjct  1167164  DLITWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  1167313

 Score = 236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 8/230 (3%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V PF QP P T S+K AVK+KPQ  +  GCHPYPAVQ DGS+S GLK SGP DGE
Sbjct  1187327  INHDEVEPFAQPKPTTDSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGPMDGE  1187506

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS W  D+WAIMYAWY PKGR+          +  RH WE  VVWID+
Sbjct  1187507  CEGSPLGSQVYSRSGWYEDMWAIMYAWYLPKGRSTK--------YQRRHYWEVAVVWIDD  1187662

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P L N+T+LGVS++    ++ Q P + +Y+ G+ VK+  +    +    L+ T+  GE Q
Sbjct  1187663  PALANSTILGVSLNYGRRHNSQVPVEEQYLHGSRVKLESFKGFGVPRPRLRFTDLEGETQ  1187842

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W+QL+  AR +L++  + + L       MPLKDGVFE+ L+  +PF
Sbjct  1187843  DLITWEQLTEEARDALSNAKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  1187992

 Score = 227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 155/231 (67%), Gaps = 6/231 (3%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF + +P T S+K+A+K+KPQL I  GCHPYPAVQ +GS+SGGLKWSG  +G+
Sbjct  1145015  INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSGKTNGD  1145194

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C    LGSQ+Y+RS W    WAIMYAWY PK     +  D     GHRH W Y +VW D+
Sbjct  1145195  CEQPNLGSQVYSRSDWYKGKWAIMYAWYLPKAAQFMLKFD----TGHRHFWLYSMVWTDS  1145362

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                P  +N+T+LGVSMS S GY K+     KY++ GT++K+  Y    +G  AL+LT+ +GE 
Sbjct  1145363  PNPDNSTILGVSMSGSRGYVKKPSPKTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGET  1145542

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDL+ W+QL+  AR +L+  D++     ++ + MPLKD VF  +L  ++PF
Sbjct  1145543  QDLVTWEQLTDEARDALSEFDFESDP-SISMVVMPLKDDVFRSILKDSYPF  1145692

 Score = 221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 158/237 (67%), Gaps = 11/237 (5%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF + +P T S+K+A+K+KPQL I  GC+PYPAVQ +G++SGGLKWSG  + +
Sbjct  1148330  INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSD  1148509

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C     GSQIY+RS W    WAIMYAWYFPKG  A     + R  GHRH W   +VW DN
Sbjct  1148510  CEKPVQGSQIYSRSDWYKGKWAIMYAWYFPKG--AFRASKYNR--GHRHFWSSAIVWTDN  1148677

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                   +N+T+LGVSMS S GY K+     KY++ GT++K+  Y    L N AL+LT+ +G  
Sbjct  1148678  TNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGT  1148857

Query  201      QDLIQWDQLSSLARYSLNHTDWD----QTLFGLAG--LKMPLKDGVFEELLDKTWPF  251
                QDL+ W+QL+  AR +L+  D+D      +F  +G  + MPL+DGVF  +L++++PF
Sbjct  1148858  QDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  1149028

 Score = 209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 148/231 (64%), Gaps = 6/231 (3%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF + +P T S+K+A+K+KPQL I  GCHPYP VQ DGS+S GLKWSG     
Sbjct  1141101  IDHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWSGRYRSG  1141280

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RSAW    WAIMYAWYFPKG      P  +   GHRH W + +VW D+
Sbjct  1141281  CKGSDLGSQVYSRSAWYKGKWAIMYAWYFPKG----ANPVSVFGSGHRHYWLHAIVWTDS  1141448

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                P  +N+T+LG SM+ +    K +    KY+ +GTS+K+  +     G  AL+LT+ +GE 
Sbjct  1141449  PNPDNSTILGASMAGTTNNEKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGET  1141628

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W+QL+  AR +L+     ++      + MPL+D  F+ LL  ++PF
Sbjct  1141629  QDLITWEQLTDEARDALSDFS-FESSESREWVVMPLRDSAFKVLLKNSYPF  1141778

 Score = 135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 98/151 (65%), Gaps = 10/151 (7%)
 Frame = -2

Query  104      IMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYS  161
                IMYAWYFPKGR       ++R +  GHRH W Y +VW DNP  +N+T+LGVSMS+ +GY 
Sbjct  1174580  IMYAWYFPKGR------QYIRKYRSGHRHYWSYAIVWTDNPNPDNSTILGVSMSSGVGYM  1174419

Query  162      KQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                K++P   +YV DGT+VK   Y +       ++LT+ +G+ QDLI W+QLS  AR +L+  
Sbjct  1174418  KRSPPKSEYVIDGTTVKFDSYNSFWGSKQGVRLTKKSGDTQDLITWEQLSKQARTALSEA  1174239

Query  221      DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                D+D   + L  + MPLKDG F + L K +PF
Sbjct  1174238  DFD-VQWTLKKVVMPLKDGAFTDRLQKAYPF  1174149

 Score = 95.9 bits (237),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 71/119 (60%), Gaps = 10/119 (8%)
 Frame = +3

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVW  138
                E  GS +G  I  +     D WAIMYAWYFPKGR       ++R +  GHRH W Y +VW
Sbjct  1180233  EFCGSGIGI*ITMKPN*YKDKWAIMYAWYFPKGR------QYIRKYRSGHRHYWSYAIVW  1180394

Query  139      IDNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTED  196
                 DNP  +N+T+LGVSMS+ +GY K++P   +YV DGT+VK    YN   G  A   T +
Sbjct  1180395  TDNPNPDNSTILGVSMSSGVGYMKRSPPKSEYVIDGTTVKFD-SYNSFWGQQAGSPTHE  1180568

 Score = 58.2 bits (139),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  191      LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                ++LT+ +G+ QDLI W+QLS  AR +L+  D+D   + L  + MPLKDG F E L+K +P
Sbjct  1180555  VRLTKKSGDTQDLITWEQLSEQARTALSEADFD-VQWTLKKVVMPLKDGAFTERLEKAYP  1180731

Query  251      F  251
                F
Sbjct  1180732  F  1180734

 Score = 106 bits (264),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -1

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
                H   R   +  P   S +  +++KP L +  GCHPYPAVQ DGS+S GLK SGP  GEC 
Sbjct  1283745  HSFGRNLRRKQPSDTSHQRTLRYKPSLYVPYGCHPYPAVQADGSVSAGLKGSGPDGGECG  1283566

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPK  112
                GS LGSQ+Y RS W  + WAIMYAWY PK
Sbjct  1283565  GSALGSQVYYRSDWCRNKWAIMYAWYLPK  1283479

 Score = 43.5 bits (101),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 38/76 (50%), Gaps = 0/76 (0%)
 Frame = -2

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P L N T+LG  ++       + P D +YV+G+SVK+  +         L+ T   G  +
Sbjct  1283417  PALTNWTILGALLNYGSHRKTEVPVDKEYVEGSSVKLESHRGFGAPRPKLRFTVLEGGAK  1283238

Query  202      DLIQWDQLSSLARYSL  217
                DLI W+QL+  A   L
Sbjct  1283237  DLITWEQLTDAACIEL  1283190

 Score = 39.3 bits (90),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 96/241 (40%), Gaps = 37/241 (15%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I H +V+PF +  P   ++K AV++KP          YP +Q   +++    W  P    
Sbjct  1283767  IDHGKVKPFVRAKP---TEKAAVRYKPST--------YPKIQ---AITLRTLWMSPVSC-  1283633

Query  82       CTGSRLGSQ----IYAR-------SAWVNDVWAIMYAWYFPKGRAATVPPD-FLRFFGHR  129
                C+G  LG      I+AR        +W + V +              VPP+     +  R
Sbjct  1283632  CSG*WLGQCWA*GIWARWWRVWRFGSWFSSVLSFRLV*EQVGHHVRLVPPEGRTTQYQQR  1283453

Query  130      HNWEYVVVWIDNP----GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHL  185
                H WE  V+ ID+P    G   A     +++A +       T       +++ V      +
Sbjct  1283452  HFWEAAVI*IDDPLSLIGQFWAHC*ITAVTARLKCLLTRNTLRAQA*SSNLTV------V  1283291

Query  186      LGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                L            + +        SSL +++L++T++D          MPLK G+FE+ L
Sbjct  1283290  LERPGRSYASQCSKVEPRTSSRGSSSLMQHALSYTEFDTGFIKWTKRAMPLKYGIFEKRL  1283111

Query  246      D  246
                +
Sbjct  1283110  E  1283108

>PHIF:NW_003307367.1 Phytophthora infestans T30-4 supercont1.1021 
genomic scaffold, whole genome shotgun sequence
Length=6852

 Score = 253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 159/230 (69%), Gaps = 8/230 (3%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             + HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  4402  VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  4581

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D 
Sbjct  4582  CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWTDT  4737

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P   N+++ GVSMSA +G++K  P  +KY+ G+S+K+  Y++ L    ALQLT++TGE Q
Sbjct  4738  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  4917

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI WDQ++  ARY+LN    D  ++     ++P KD +F + L+  +PF
Sbjct  4918  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  5067

>PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 
genomic scaffold, whole genome shotgun sequence
Length=4768765

 Score = 251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 158/230 (69%), Gaps = 8/230 (3%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  2233864  VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  2233685

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D 
Sbjct  2233684  CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWTDT  2233529

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P   N+++ GVSMSA +G++K  P  +KY+ G+S+K+  Y++ L    ALQLT++TGE Q
Sbjct  2233528  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  2233349

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQ++  ARY+LN    D  ++     ++P KD +F + L   +PF
Sbjct  2233348  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  2233199

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 8/230 (3%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP P T S+  AVK+KPQL +  GC PYPAVQ DGS+S GLK SGP DGE
Sbjct  2510747  INHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSGPMDGE  2510568

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS W  D WAIMYAWY PKGR           +  RH WE  VVWID+
Sbjct  2510567  CEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTK--------YQRRHFWEAAVVWIDD  2510412

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P L N+T+LGVS++    +  +AP + +Y++G++VK+  Y  +      L+ T+  GE Q
Sbjct  2510411  PALANSTILGVSLNYGRRHKSKAPLERRYLEGSNVKLESYKGYGKPRPRLRFTQLKGETQ  2510232

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 LI W+QL+  AR +L++  ++  LF     +MPLKDGVFE+ L   +PF
Sbjct  2510231  HLITWEQLTKEARDALSNAKFNTGLFKRTKREMPLKDGVFEKRLKDAYPF  2510082

 Score = 230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 151/231 (65%), Gaps = 9/231 (4%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP P T S+K AVK+KP+L +  GCHPYPAVQ +G +S GLK SGP DGE
Sbjct  2123413  INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPIDGE  2123592

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS W  D WAIMYAWY PKGR++         +  RH WE  VVWID+
Sbjct  2123593  CEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSK--------YQRRHFWEAAVVWIDD  2123748

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P L N+T+LGVS++       + P +++++DG++VK+  Y         LQ T+  GE Q
Sbjct  2123749  PALANSTILGVSLNYGRRQKSEVPLELQFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQ  2123928

Query  202      DLIQWDQLSSLARYSLNHTDWDQTL-FGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W+QL+  AR  L+  +++  L F     +MPLKDGVFE+ L   +PF
Sbjct  2123929  DLITWEQLTDEARDGLSDAEFNTGLFFKRTRREMPLKDGVFEKRLIDAYPF  2124081

 Score = 230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 154/232 (66%), Gaps = 8/232 (3%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF Q  P T S+K+A+K+KPQL I  GCHPYPAVQ +GS+SGGLKWSG  +G+
Sbjct  2638140  INHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKANGD  2637961

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
                C    LGSQ+Y+RSAW    WAIMYAWYFPKG     P   LRF  GHRH W Y ++W D
Sbjct  2637960  CKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKG-----PQFVLRFDTGHRHFWSYAILWTD  2637796

Query  141      NPGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
                +P  +N+T+LGVSMS S GY K++    KY V GT+VK+  Y +  +G  ALQLT+  GE
Sbjct  2637795  DPNHDNSTILGVSMSGSRGYVKESSPKAKYIVKGTTVKLDSYASFWMGVQALQLTKKLGE  2637616

Query  200      FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 QDLI W+QL+  A  +L   D++      A + MPL D  F  +L  ++PF
Sbjct  2637615  TQDLITWEQLTDEACDALTEFDFESDP-SRAMVVMPLGDDNFTPILKDSYPF  2637463

 Score = 220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 144/230 (63%), Gaps = 9/230 (4%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP P T + K AVK+KP L +  GC PYPAVQ DGS+S  L+ SGP DGE
Sbjct  2526550  INHDEVKPFAQPKPTTDAAKAAVKYKPDLYVSYGCRPYPAVQADGSVSTALRGSGPMDGE  2526371

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                  GS LGSQ+Y+R  W  D WAIMYAWY PKGR           F HRH+WE  VVWID 
Sbjct  2526370  YEGSPLGSQVYSRPTWYKDSWAIMYAWYLPKGRTVG--------FQHRHSWEAAVVWIDG  2526215

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P   N+T+LGVS++       + P + KY+DG+ VK+  Y         L+ T+  GE  
Sbjct  2526214  PA-ANSTLLGVSLNYGFHLEYRFPLEAKYIDGSHVKLESYKGFGGPRPRLRYTQLKGETH  2526038

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W+QL+  AR +L+  +++  LF     +MPLKDG+FE+ L+ ++PF
Sbjct  2526037  DLISWEQLTDEARDALSEAEYNTGLFKRLTREMPLKDGIFEKRLNASYPF  2525888

 Score = 195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 134/220 (61%), Gaps = 9/220 (4%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP P T + K AVK+ P++ +  GC PYPAV+ DGS+S GL+ SG  +GE
Sbjct  2531574  ISHDEVKPFAQPKPTTDAAKAAVKYNPEVYVSYGCRPYPAVKADGSVSAGLRGSGSINGE  2531753

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y++S W  D WAIMYAWY PKGR           F HRH+WE  V+WID 
Sbjct  2531754  CEGSPLGSQVYSQSTWYKDSWAIMYAWYLPKGRTVG--------FQHRHSWEAAVLWIDG  2531909

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P   N+T+LGVS++       + P + KY+DG+ VK   Y       + L+ T+  GE  
Sbjct  2531910  PA-ANSTLLGVSLNYGFHLEYRFPLEAKYIDGSHVKPESYQGLGGPRS*LRYTQL*GETH  2532086

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
                DLI W+QL+  AR +L+  +++  L      +MPLK   F
Sbjct  2532087  DLISWEQLTDEARDALSKVEYNTVLLKTLTREMPLKRRYF  2532206

 Score = 194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 113/153 (74%), Gaps = 8/153 (5%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+
Sbjct  2561252  VNHDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGD  2561431

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D+
Sbjct  2561432  CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYG--------LTGHRHYWEYVVVWADS  2561587

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGT  174
                    N+++ GVSMSA +G++K  P  +KY+ G+
Sbjct  2561588  STSTNSSIQGVSMSAGVGHAKATPPMLKYIHGS  2561686

 Score = 140 bits (352),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 82/122 (67%), Gaps = 8/122 (7%)
 Frame = -3

Query  41       KTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVND  100
                K+AVKFKPQ  +  GCHPYPAVQ +GS+SGGLKWSG  +G+C    LGSQ+Y+RS W   
Sbjct  2536910  KSAVKFKPQFHVSRGCHPYPAVQANGSISGGLKWSGRPNGDCKSPALGSQVYSRSDWFKG  2536731

Query  101      VWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNPGLENATVLGVSMSASI  158
                 WAIMYAWY PKG      P F   +  GHRH W   +VW  +P  E +T+LGVS+S S 
Sbjct  2536730  KWAIMYAWYLPKG------PQFQTRYDTGHRHFWLSAIVWTGSPNPEYSTILGVSLSGSA  2536569

Query  159      GY  160
                GY
Sbjct  2536568  GY  2536563

 Score = 62.8 bits (151),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -2

Query  169      KYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLF  227
                KY+ D T++K+    +  +G  AL+LT+ TGE QDLI W+QL+  AR +LN  D+ ++  
Sbjct  2536539  KYIADKTTIKIDSDVSFWVGQQALRLTKKTGETQDLISWEQLTEEAREALNVFDF-ESKE  2536363

Query  228      GLAGLKMPLKDGVFEELLDKTWPF  251
                 ++ + MPL D VF  +L  ++PF
Sbjct  2536362  SVSKIVMPLTDDVFVRILQDSYPF  2536291

 Score = 25.4 bits (54),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -1

Query  22       IGHDQVRPFPQP  33
                I HDQV+PF QP
Sbjct  2536957  INHDQVQPFEQP  2536922

 Score = 126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP P T S+K AVK+KP+L +  GCHPYPAVQ +G +S GLK SGP DGE
Sbjct  2124695  INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPIDGE  2124516

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYF  110
                C GS LGSQ+Y+RS W  D WAI+ AWY 
Sbjct  2124515  CEGSSLGSQVYSRSMWYEDKWAIINAWYL  2124429

>PHIF:NW_003303619.1 Phytophthora infestans T30-4 supercont1.140 
genomic scaffold, whole genome shotgun sequence
Length=293189

 Score = 251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 160/231 (69%), Gaps = 6/231 (3%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PF QP+P   SQK+AVK+KPQL I  GCHPYPAVQ+DGS+S GLKW+G  +G+
Sbjct  148203  IDHDAVQPFAQPEPTMESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKWAGWPNGD  148024

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W    WAIMYAWYFPK R      D  R FGHRH W Y +VW +N
Sbjct  148023  CKGSALGSQVYSRSDWYKGKWAIMYAWYFPKSRQYV---DKYR-FGHRHYWSYAIVWTNN  147856

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               P  +N+T+LGVSMS+ +GY K++P   KY VDGT+VK+ +Y++       LQLTE +GE 
Sbjct  147855  PNPDNSTILGVSMSSGVGYMKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGET  147676

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI W+QLS  AR +L+  D+D + +      MPLKD +F   L K +PF
Sbjct  147675  QDLITWEQLSEEARNALSEADFDVS-WAFTKAVMPLKDDIFTSRLKKAYPF  147526

 Score = 248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 160/228 (70%), Gaps = 8/228 (4%)
 Frame = -3

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HD+V+PF QP P+T SQK+AVK+KPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+CT
Sbjct  170487  HDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCT  170308

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
               GS LGSQ+Y+RS W  + WAIMYAWYFPKGR            GHRH WEYVVVW D+  
Sbjct  170307  GSPLGSQVYSRSDWYKNKWAIMYAWYFPKGRYGLT--------GHRHYWEYVVVWADSST  170152

Query  144     LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
                 ++++ GVSMSA +G++K  P  +KY+ G+SVK+  Y++ L    ALQLT++TGE QDL
Sbjct  170151  STSSSIQGVSMSAGVGHAKATPPMLKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDL  169972

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I WDQ++  AR +LN    D  ++     ++P KD +F + L+  +PF
Sbjct  169971  ITWDQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  169828

 Score = 195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 134/220 (61%), Gaps = 9/220 (4%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP P T + K AVK+ P++ +  GC PYPAV+ DGS+S GL+ SG  +GE
Sbjct  121968  ISHDEVKPFAQPKPTTDAAKAAVKYNPEVYVSYGCRPYPAVKADGSVSAGLRGSGSINGE  122147

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y++S W  D WAIMYAWY PKGR           F HRH+WE  V+WID 
Sbjct  122148  CEGSPLGSQVYSQSTWYKDSWAIMYAWYLPKGRTVG--------FQHRHSWEAAVLWIDG  122303

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N+T+LGVS++       + P + KY+DG+ VK   Y       + L+ T+  GE  
Sbjct  122304  PA-ANSTLLGVSLNYGFHLEYRFPLEAKYIDGSHVKPESYQGLGGPRS*LRYTQL*GETH  122480

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               DLI W+QL+  AR +L+  +++  L      +MPLK   F
Sbjct  122481  DLISWEQLTDEARDALSKVEYNTVLLKTLTREMPLKRRYF  122600

 Score = 142 bits (358),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 83/122 (68%), Gaps = 8/122 (7%)
 Frame = -1

Query  41      KTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVND  100
               K+AVKFKPQL +  GCHPYPAVQ +GS+SGGLKWSG  +G+C    LGSQIY+RS W   
Sbjct  127316  KSAVKFKPQLHVSRGCHPYPAVQANGSISGGLKWSGRPNGDCKSPALGSQIYSRSDWFKG  127137

Query  101     VWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNPGLENATVLGVSMSASI  158
                WAIMYAWY PKG      P F   +  GHRH W   +VW  +P  E +T+LGVS+S S 
Sbjct  127136  KWAIMYAWYLPKG------PQFQTRYDTGHRHFWLSAIVWTGSPNPEYSTILGVSLSGSA  126975

Query  159     GY  160
               GY
Sbjct  126974  GY  126969

 Score = 62.8 bits (151),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -3

Query  169     KYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLF  227
               KY+ D T++K+    +  +G  AL+LT+ TGE QDLI W+QL+  AR +LN  D+ ++  
Sbjct  126945  KYIADKTTIKIDSDVSFWVGQQALRLTKKTGETQDLISWEQLTEEAREALNVFDF-ESKE  126769

Query  228     GLAGLKMPLKDGVFEELLDKTWPF  251
                ++ + MPL D VF  +L  ++PF
Sbjct  126768  SVSKIVMPLTDDVFVRILQDSYPF  126697

 Score = 25.4 bits (54),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -2

Query  22      IGHDQVRPFPQP  33
               I HDQV+PF QP
Sbjct  127363  INHDQVQPFEQP  127328

>PHRA:scaffold_7
Length=787762

 Score = 249 bits (635),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 152/230 (66%), Gaps = 9/230 (4%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GLK SGP DGE
Sbjct  562817  IDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPADGE  562996

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CTGS LGSQ+Y+RS W  D WAIMYAWY PKG            +  RH WE  VVWID+
Sbjct  562997  CTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKGNYK---------YQRRHYWETAVVWIDD  563149

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P L N+T+LGVSM+       + P   +++DG+SVK+  Y  +      LQ T++ GEFQ
Sbjct  563150  PALSNSTILGVSMNYGRRSEFETPVQARFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQ  563329

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QL+  AR +L+  D+D  LF     KMPLKDG+FE  L   WPF
Sbjct  563330  DLITWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  563479

 Score = 247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 152/230 (66%), Gaps = 8/230 (3%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF +P+P+T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  274808  IDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLRGSGPADGE  274629

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMY WY PKGR+             RH WE  VVWID+
Sbjct  274628  CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTR--------HQRRHFWETAVVWIDD  274473

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P L N+T+LGVSM+      +Q P  VKY+DG+SVK+  Y  +      LQ T++ G+FQ
Sbjct  274472  PALANSTILGVSMNYGWRSKEQTPVKVKYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQ  274293

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QL+  AR +L+  D+D  L      +MPLKD +FE  L   WPF
Sbjct  274292  DLITWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  274143

 Score = 245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 158/229 (69%), Gaps = 8/229 (3%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HD V+PF QP PVT SQK+AVK+KPQL I  GCHPYPAV+ +G  SGGL+WSGP DG+
Sbjct  291020  VNHDLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHPYPAVEANGYASGGLEWSGPNDGD  290841

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W ++ WAIMYAWYFPKGR            GHR+ WEY +VW D+
Sbjct  290840  CKGSSLGSQVYSRSDWYHEKWAIMYAWYFPKGRYGVT--------GHRNYWEYAIVWTDS  290685

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                  +N+T+LGVSMSA +G+ K  P  +KY++G+SVK+  +++ L    AL+LT+  GEFQ
Sbjct  290684  TSPDNSTLLGVSMSAGVGHDKTTPPMLKYMNGSSVKLNSHFSLLGSKAALELTKKEGEFQ  290505

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
               DLI WDQL+  AR +LN    D  ++     ++P KD +F + L+  +P
Sbjct  290504  DLITWDQLTVAARETLNSDALDGNVWLSNKDEVPFKDDIFVDRLEDAYP  290358

 Score = 241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 150/230 (65%), Gaps = 8/230 (3%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  222960  IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  222781

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMY WY PKGR           +  RH WE  VVWID+
Sbjct  222780  CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRPTK--------YQRRHFWETAVVWIDD  222625

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P L N+T+LGVS++      ++ P   +++DG+SVK+  Y  +      LQ T+  GEFQ
Sbjct  222624  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQ  222445

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QL+  AR +L+  D+D  L      +MPLKDG+FE  L   WPF
Sbjct  222444  DLITWEQLTEEARDALSTADFDTNLIEKKKREMPLKDGIFEFRLQDAWPF  222295

 Score = 233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 157/233 (67%), Gaps = 10/233 (4%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV  +GS++ GLKW+G  DG+
Sbjct  281857  IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWADGD  282036

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWI  139
               C GS LGSQ+Y+RS    D WAIMYAWYFPKGR       ++  +  GHRH W Y +VW 
Sbjct  282037  CKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGR------QYIHKYHSGHRHYWSYGIVWT  282198

Query  140     DNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTG  198
               D+   +N+T+LGVSMSA +GY K +P   K+V DGT+VK   Y +       ++LT+ TG
Sbjct  282199  DSSSPDNSTILGVSMSAGVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTG  282378

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               + QDLI W+Q++  AR +L  TD+D   + L  + MPL D  F E L+K++PF
Sbjct  282379  DTQDLITWEQMTEEARTALVDTDFD-VEWSLKKVVMPLSDDAFTERLEKSYPF  282534

 Score = 232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 150/231 (65%), Gaps = 6/231 (3%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV  +GS++ GLKW+G  DG+
Sbjct  461500  IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWDDGD  461321

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR  T         GHRH W Y +VW D+
Sbjct  461320  CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTS----AYRTGHRHYWSYGIVWTDS  461153

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                  +N+T+LGVSMSA +G+ K  P   KY VDGT+VK   + +       ++LT   GE 
Sbjct  461152  SSPDNSTILGVSMSAGVGFGKATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEGEM  460973

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI W+Q++  AR +L   D+D   + +  + MP+ D VF   L K +PF
Sbjct  460972  QDLITWEQMTEEARTALTDADFD-VDWSVRKVVMPMSDDVFMTKLKKAYPF  460823

 Score = 226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 149/231 (65%), Gaps = 6/231 (3%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PF QP+P T S+KTAVKFKPQL I  GCHPYPAV  +GS++ GLKW+G  DG+
Sbjct  292798  IDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWADGD  292619

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS +GSQ+Y+RS W  D WAIMYAWYFPKGR  T         GHRH W Y +VW D+
Sbjct  292618  CKGSAMGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSK----YRAGHRHYWSYGIVWTDS  292451

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                  +N+T+LGVSMSA +G+ K  P   KYV DGT+VK   +++       ++LT   G  
Sbjct  292450  SSPDNSTILGVSMSAGVGFGKATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGAT  292271

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               Q LI W+Q++  AR +L   D+D   +    + MP+ D VF + L K +PF
Sbjct  292270  QALITWEQMTEEARTALTDADFD-VDWSFRKVVMPMSDDVFTKKLKKAYPF  292121

 Score = 186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 121/181 (67%), Gaps = 8/181 (4%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I +++++PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  234925  IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  235104

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMY WY PKG     P  + R    RH WE  VVWID+
Sbjct  235105  CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKG----CPTKYQR----RHFWETAVVWIDD  235260

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P L N+T+LGVS++      ++ P   +++DG+SVK+  Y  +      LQ T+  G+FQ
Sbjct  235261  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGDFQ  235440

Query  202     D  202
               D
Sbjct  235441  D  235443

 Score = 169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF +P+P T S+K AVKFKPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  266542  IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  266721

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMY WY PKGR+             RH WE  VVWID+
Sbjct  266722  CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRSTR--------HQRRHFWETAVVWIDD  266877

Query  142     PGLENATVLGVSMS  155
               P L N+T+LGVSM+
Sbjct  266878  PALANSTILGVSMN  266919

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +1

Query  134     YVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQ  192
               Y +VW D    +N+T+LGVS+SA IG+ K  P   KYV DGT+VK   +++       ++
Sbjct  352309  YRIVWTDVLSSDNSTILGVSISADIGFGKATPPKSKYVVDGTTVKFDSFWSFWGSKLGVK  352488

Query  193     LTEDTGEFQDLIQWDQLSSLARYSLNHTDWD  223
               LT   GE QDLI W+Q++  AR +L   D+D
Sbjct  352489  LTTKEGEMQDLITWEQMTEEARTALTDADFD  352581

 Score = 35.4 bits (80),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +3

Query  203     LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
               L +W+QL+  AR +L+  D+D  L      + PLKD VFE
Sbjct  235434  LSRWEQLTEEARDALSTADFDTNLIEKKKREKPLKDQVFE  235553

>PHPA:scaffold_111 NW_008649097.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.111, whole genome 
shotgun sequence
Length=101658

 Score = 245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 150/230 (65%), Gaps = 15/230 (7%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PFPQP+PVT+S+K AVKFKPQ+ I  GCHPYPAV + G  SGGLK  G    +
Sbjct  48344  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAK  48523

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS WV  +WAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  48524  CKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  48682

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +EN  +L V+ SA  GYSKQ P +   VDGTSVKV  Y +H   N AL+ T + G+FQ
Sbjct  48683  PDVENPKILAVTPSAHDGYSKQVPPNADCVDGTSVKVK-YESHWPINHALESTSEGGDFQ  48859

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI WDQLS  AR ++N   W +          P  DG F+  L+K WPF
Sbjct  48860  DLIMWDQLSEDARRAMNGVGWGKA-------NTPFNDGNFKPKLEKAWPF  48988

 Score = 221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 138/230 (60%), Gaps = 15/230 (7%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PFPQP PVT+S+K AVKFKPQL I  GCH YPAV + G  SGGLK  G     
Sbjct  43964  IDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLKTKGAPSAG  44143

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS+W   VWAIMY WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  44144  CKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPST-------GIGHRHDWEHVIVWIDN  44302

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P + N  +L V+ SA  GY K AP +   +DG + KVA Y +H   + AL  T + G+FQ
Sbjct  44303  PEIANPKILAVTPSAHSGYHKYAPPNPDTIDGATTKVA-YESHWPMDHALGSTSEAGDFQ  44479

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI W QLS  A  +LN   W            P+ DG F   L K WPF
Sbjct  44480  DLIMWGQLSENASRALNAVYW-------GNANTPMNDGNFLPKLAKAWPF  44608

>PHCA:scaffold_146 PHYCAscaffold_146
Length=47772

 Score = 238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 153/231 (66%), Gaps = 6/231 (3%)
 Frame = -2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PF QP+P T S+K+AVK+KPQL I  GCH YPAVQ DG++S GLKW+G   G+
Sbjct  46553  IDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVSGQ  46374

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  46373  CKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHFWSYAIVWMDS  46206

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                 +N+T+LGVSMSA +GY+K+ P   KY VDGT+VK   Y +   G  A+ LT   GE 
Sbjct  46205  DVPDNSTILGVSMSAGVGYNKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEGET  46026

Query  201    QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              QDLI W+QL+   R  L   D+D   + +  + MP+ D VF + L K +PF
Sbjct  46025  QDLITWEQLTDEGRTGLTDADFD-VDWSIRKVVMPMADDVFVKKLKKNYPF  45876

>PHIF:NW_003303731.1 Phytophthora infestans T30-4 supercont1.28 
genomic scaffold, whole genome shotgun sequence
Length=2122445

 Score = 212 bits (539),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -3

Query  74       WSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWE  133
                WS P +  C G  LG+QIYARS W+   WA+MYAWYFPKGRA    P   R +GHRH WE
Sbjct  1208475  WSQPNNIGCKGPSLGAQIYARSTWLKGKWAVMYAWYFPKGRAPIPAP---RSYGHRHGWE  1208305

Query  134      YVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQL  193
                Y VVW+      NAT+LG SMSA+IG++K++PT  +Y+DG S+ VAYY+N    NTA++ 
Sbjct  1208304  YAVVWLGEAS-ANATILGTSMSAAIGWAKESPTPKEYLDGNSLMVAYYFNDDSINTAVKY  1208128

Query  194      TEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                TED GEFQDLI WDQLS LAR +L  TDWD+TLF +A +KMP+KDGVF E L+  +PF
Sbjct  1208127  TEDAGEFQDLITWDQLSDLARDALVKTDWDETLFNVARVKMPMKDGVFVEKLNGAYPF  1207954

 Score = 75.9 bits (185),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGL  72
                I +D VRPFPQ  P T +QK  +K+KPQLKI+ GCHPYPAVQKDG++S GL
Sbjct  1208621  IPYDTVRPFPQQVPTTDAQKAILKYKPQLKIEEGCHPYPAVQKDGAISSGL  1208469

>PHSO:scaffold_5
Length=6830280

 Score = 237 bits (604),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 151/230 (66%), Gaps = 15/230 (7%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQVRPF QP+PVT+S++ AVKFKPQL +  GCHPYPAV   G  SGGLK SG     
Sbjct  6408111  ISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAPSAG  6407932

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWI+N
Sbjct  6407931  CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWINN  6407773

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P + +  +L V+ SA  GYSK +P +   +DGTS+KV Y  N+ + N A  +T + G+FQ
Sbjct  6407772  PDVPDPIILAVTPSAHSGYSKYSPPNADTLDGTSIKVNYESNYPM-NHATDVTTEGGDFQ  6407596

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQ+S LAR +LN     +  FG A   +P+ DG F   LD+ WPF
Sbjct  6407595  DLIMWDQMSDLARRALN-----EVSFGDA--NVPMNDGNFVGKLDRAWPF  6407467

 Score = 231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 155/249 (62%), Gaps = 15/249 (6%)
 Frame = +3

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN R + VAA+A L  + A VI HDQV PF QP P + SQ  AVKFKPQL I  GCHPYP
Sbjct  6417699  MNLRRLVVAAVAFLTASHASVIDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYP  6417878

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                AV  DG+ SGGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A+   
Sbjct  6417879  AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---  6418049

Query  121      DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                     FGHRH+WE++VVW++NP + +  +L VS SA  GY+   P    Y+DG S K+  
Sbjct  6418050  ----GFGHRHDWEHIVVWLNNPAVTSPELLAVSTSAHSGYTTYYPPSSSYLDGNSAKID-  6418214

Query  181      YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                YYN LL N A ++T D+GE QDLI WDQL+  AR +L +TD     FG A   +P KD  
Sbjct  6418215  YYNVLLINHAFRMTSDSGETQDLIMWDQLTDAARTALENTD-----FGDA--NVPFKDAN  6418373

Query  241      FEELLDKTW  249
                FE  L   W
Sbjct  6418374  FETKLANAW  6418400

 Score = 221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                IGHD+V PF QP+PVT+S++ AVKFKPQL I  GCH YPAV + G  SGGLK +G    +
Sbjct  3638262  IGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGAPSSK  3638083

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W N VWAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  3638082  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  3637924

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +    +L V+ SA  GYS Q P D   VDG SVKV Y     + N AL+ T   G++Q
Sbjct  3637923  PDMPEPKILAVTPSAHSGYSAQVPPDADKVDGPSVKVNYESKWPI-NHALESTTKGGDYQ  3637747

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W Q++  AR +L++T+     FG A +  P+  G F   L K WPF
Sbjct  3637746  DLIMWTQMTDAARQALDNTN-----FGSANV--PMNSGNFLGKLGKAWPF  3637618

 Score = 208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 145/251 (58%), Gaps = 14/251 (6%)
 Frame = +1

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN RA+    +ASLA     +IGHDQV PFPQ  P T+S K A+KFKPQL I+ GCHPYP
Sbjct  6403345  MNLRALAADTLASLASVSGGIIGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYP  6403524

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                 V   G   GGLK  G     C  S  GSQ+Y RS W N VWAIMY WYFPK      P 
Sbjct  6403525  VVNAAGDTGGGLKTHGSSAAGCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDE----PQ  6403692

Query  121      DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                D     GHRH+WE+V+VWIDNP +EN  ++ ++ SA  GYS  A      VDGTS KV Y
Sbjct  6403693  DGT---GHRHDWEHVIVWIDNPDVENPKIMAMTPSAHSGYSTYALPPADMVDGTSCKVEY  6403863

Query  181      YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                  + L  +  L+ T   GEFQDLI W  L+  AR +LN T      FG A    P+ DG 
Sbjct  6403864  TSSWLFIDHHLEGTSTAGEFQDLIMWSDLTDGARLALNTTS-----FGKA--NTPMNDGN  6404022

Query  241      FEELLDKTWPF  251
                F   + K +P+
Sbjct  6404023  FLPKIQKAYPW  6404055

 Score = 207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 150/250 (60%), Gaps = 14/250 (6%)
 Frame = +1

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN RA+     ASL   +A VIGHDQV PFPQ    + +   A+KFK Q+ I+ GCHPYP
Sbjct  6406585  MNLRAIAAVTAASLISVEAGVIGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYP  6406764

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                AV   G  SGGLK SG  +  C GS  GSQ+Y RS   N+  AIMY+WYFPK    T   
Sbjct  6406765  AVNAAGDTSGGLKPSGSVNAGCKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDNPVT---  6406935

Query  121      DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                      GHRH+WE+V+VWIDNP   NAT+L ++ SA  GYS  AP     VDGTSVKV Y
Sbjct  6406936  ----GLGHRHDWEHVIVWIDNPASSNATILAMTPSAHSGYSTYAPPPATMVDGTSVKVEY  6407103

Query  181      YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                  + ++ N  L+ T   GE Q+LI W+ ++  ARY+LN TD     FG A +  P+KDG 
Sbjct  6407104  TSSKVVINHHLEGTSTAGETQNLIMWEDMTDAARYALNTTD-----FGSANV--PMKDGN  6407262

Query  241      FEELLDKTWP  250
                F   L K +P
Sbjct  6407263  FISKLGKAYP  6407292

 Score = 204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 131/218 (60%), Gaps = 17/218 (8%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV PF QP+PVT+S+K AVKFKPQL I  GCHPYPAV + G   GGL  +G   G+
Sbjct  6421916  ISHDQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGAPSGK  6422095

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
                C GS LGSQ+Y RS W  DVW IMYAWYFPK        D   F  GHRH+WE+ V+WID
Sbjct  6422096  CKGSGLGSQVYGRSGWHKDVWTIMYAWYFPK--------DMASFDLGHRHDWEHAVIWID  6422251

Query  141      NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                NP +    +LGVS S+  GY K        ++GTSV + Y     + +  L+ T   GE+
Sbjct  6422252  NPDVAEPKILGVSASSHAGYEKVTTIPAGSLNGTSVLLNYESTWPV-DHELRFTTKGGEY  6422428

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
                Q LI W QL+  AR SL+ TD+   L       MP+ D
Sbjct  6422429  QPLIMWTQLTDAARVSLSTTDFGSAL-------MPMTD  6422521

 Score = 188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 139/249 (56%), Gaps = 14/249 (6%)
 Frame = +2

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN R   +A +AS A   A VI HDQV PF QP P T  Q+ AVK+KPQ+ I  GCHPYP
Sbjct  6419084  MNLRPALLATLASFAYVSASVINHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYP  6419263

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                AV  +G+ SGGL  +G +   C GS  G+QIY R+     V+A MY+WY PK        
Sbjct  6419264  AVDNNGNTSGGLNPTGSESAGCKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKD-------  6419422

Query  121      DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                + L   GHRH+WE  VVW+D+    +  ++ +S SA  GY+K  P    Y  G S K+ Y
Sbjct  6419423  ETLTGLGHRHDWEACVVWVDDIAASSPKIVALSASAHSGYNKYYPPSSSYFSGNSAKIDY  6419602

Query  181      YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                  ++++ N AL  T   GE Q LI WDQL+  AR +L  TD     FG A   +P KD  
Sbjct  6419603  SSSYVVINHALSATSTAGETQPLIMWDQLTDAARRALEDTD-----FGDA--NVPFKDAN  6419761

Query  241      FEELLDKTW  249
                F+  L   +
Sbjct  6419762  FQTKLGNAY  6419788

 Score = 169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 141/249 (57%), Gaps = 16/249 (6%)
 Frame = -1

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN RA+    + SLA+    VI HD V PF QP P T  Q  AVKFKPQ+ I  GCHPYP
Sbjct  6425619  MNLRAIVATTVGSLALVSGAVIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYP  6425440

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                AV +DG+ SGGLK +G +    TGS LGSQIY R+     V+A MY+WY PK        
Sbjct  6425439  AVDEDGNTSGGLKPTGSESSGYTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDET-----  6425275

Query  121      DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                  L   GHRH+WE  VVW+D+  L++ +++ +S S    Y    P D  Y+DG S K+ Y
Sbjct  6425274  --LPGLGHRHDWEACVVWLDS--LDDPSIVALSASYHSTYLTYYPPDSDYLDGNSAKIEY  6425107

Query  181      YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                  + ++ + +L  T   GE QDLI WDQL+  AR +L  TD     FG A   +P K+  
Sbjct  6425106  STSWVILDHSLSATSTAGETQDLIMWDQLTDAARTALEDTD-----FGSA--NVPFKEAN  6424948

Query  241      FEELLDKTW  249
                F   + K +
Sbjct  6424947  FATKVAKAY  6424921

 Score = 162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 116/195 (59%), Gaps = 14/195 (7%)
 Frame = -2

Query  55       GCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGR  114
                GCHPYPAV KDG+ SGGLK +G     C GS  GSQIY R    N V+A+MY+WYFPK  
Sbjct  6416834  GCHPYPAVDKDGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTFNGVYALMYSWYFPKDS  6416655

Query  115      AATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGT  174
                        +   GHRH+WE+VVVW+D+  L + +++ VS SA  GY+   P +   +DG 
Sbjct  6416654  P-------ISGLGHRHDWEHVVVWVDDITLASPSIIAVSPSAHNGYNIYYPPESGTIDGY  6416496

Query  175      SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKM  234
                S KV Y  + L+ N AL  T D GE QDLI WDQL+  AR +L +TD     FG A   +
Sbjct  6416495  SAKVDYSSSWLVVNHALDSTSDAGETQDLIMWDQLTDTARTALENTD-----FGDA--NV  6416337

Query  235      PLKDGVFEELLDKTW  249
                P+KD  F+  L   +
Sbjct  6416336  PMKDANFQMKLGNAY  6416292

 Score = 108 bits (270),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 87/161 (54%), Gaps = 16/161 (10%)
 Frame = +2

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  6420752  CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-------LDGQGHRHDWENCVVWLDS  6420910

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                  L+N +++ +S S    Y    P D  Y+DG S K+ Y  + ++ + +L  T   GE Q
Sbjct  6420911  --LDNPSIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTAGETQ  6421084

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
                DLI WDQL+  AR +L  TD     FG A   +P K+  FE
Sbjct  6421085  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKEANFE  6421186

 Score = 81.3 bits (199),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN RAV  A++A+L    A VI HD V PFPQP P T  Q  AVKFKPQ+ I+ GCHPYP
Sbjct  6420525  MNLRAVAAASLAALVGIDAAVIAHDAVVPFPQPTPNTTIQTVAVKFKPQIYINNGCHPYP  6420704

Query  61       AVQKDGSMSGGLKWSGPQD  79
                AV +DG+ SGGL+ +G +D
Sbjct  6420705  AVDEDGNTSGGLEPTGARD  6420761

 Score = 134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 111/210 (53%), Gaps = 23/210 (11%)
 Frame = +1

Query  42       TAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDV  101
                T    + QL I++GCHPYPAV  D + + GL         C GS LGSQ+Y       D 
Sbjct  3344323  TRADVQAQLNINSGCHPYPAVDADENTNLGLSLFS-----CKGSSLGSQVYGCVTAYEDS  3344487

Query  102      WAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG-Y  160
                +AIMYAWYFP+ R  T        FGH H WE+ +VW+   G E+A +  VS S S G Y
Sbjct  3344488  YAIMYAWYFPRDRKGT--------FGHCHGWEHAIVWLARRGAEDANISSVSASVSDGKY  3344643

Query  161      SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                    P D   V+ TSVK  + Y     +  + +T + G+FQDL+ W+ + + AR +LN  
Sbjct  3344644  FTITPPDAAMVEATSVK--FQYKAKTFSHYVNVTTEAGDFQDLVMWEDMPAAARTALNLN  3344817

Query  221      DWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                D     FG A   +P K+  F + +++ +P
Sbjct  3344818  D-----FGSA--TVPFKEDTFRDNVEEAYP  3344886

 Score = 121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 118/266 (44%), Gaps = 53/266 (20%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF         +K A+K+KP      GC  +PAV   G  SGGL+ +  +DG 
Sbjct  796942  INHDQVKPF---------EKAAIKYKP*----DGCESFPAVNAAGETSGGLQGTKGRDG-  797079

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  + LGSQ+Y RS W  D WAIMYAWYFPK     V     +    RH+W  +V+WIDN
Sbjct  797080  CGKAPLGSQVYGRSGWYQDKWAIMYAWYFPKNFHGNVLDYEAK---KRHDWASMVLWIDN  797250

Query  142     PGLENATVLGVSMS---ASIGYSKQAPTDVKYVDGTSVKV----------------AYYY  182
               P +E + +LG S+S       Y K A     +  G    V                 Y Y
Sbjct  797251  PAIETSKILGASLSQQNTEEPYQKMAELHPMFFVGAKQHVNGTEPPRYYRRRYQSPTYIY  797430

Query  183     NHLLG-NTALQLTEDTG----------------EFQDLIQWDQLSSLARYSLNHTDWDQT  225
                +  G N   ++T+  G                + QDLI W+QL+  AR  LN  D+   
Sbjct  797431  AYTAGSNVTTRVTQAFGYPEKGWNKLEVAYGDSQSQDLIMWEQLTDAAREGLNSADFGDC  797610

Query  226     LFGLAGLKMPLKDGVFEELLDKTWPF  251
                      K+P        +LD+   F
Sbjct  797611  EGSFQREKLPRIAETSVSVLDRRLMF  797688

 Score = 102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 73/140 (52%), Gaps = 14/140 (10%)
 Frame = +2

Query  42       TAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDV  101
                T    + QL I++GCHPYPAV  D + + GL         C GS LGSQ+Y       D 
Sbjct  6499172  TRADVQAQLNINSGCHPYPAVDADENTNAGLSLF-----SCKGSSLGSQVYGCVTAYEDS  6499336

Query  102      WAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI-GY  160
                +AIMYAWYFP+ R  T        FGH H WE+ +VW++  G ++A +  V  S S   Y
Sbjct  6499337  YAIMYAWYFPRDRKGT--------FGHCHGWEHAIVWLERKGAKDANISSVPASISNDKY  6499492

Query  161      SKQAPTDVKYVDGTSVKVAY  180
                    P D   V+ TSVK  Y
Sbjct  6499493  FSVTPPDTAMVEATSVKFQY  6499552

 Score = 101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PFPQP P+T S+K A+KFKP L+I  GCHPYP V   G  SGGLK +G  DGE
Sbjct  1316430  INHDKVQPFPQPVPITASEKAAIKFKPSLQIVKGCHPYPVVNAAGETSGGLKGTGKPDGE  1316609

Query  82       CTGSRLGSQIYA  93
                C GS LGSQ+ A
Sbjct  1316610  CKGSSLGSQVSA  1316645

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  169     KYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFG  228
               +Y+DG S KV YY+N +   TALQLT D GE+QDLI W+QLS  AR +L   DW  TLF 
Sbjct  455767  RYLDGNSGKVEYYHNFIFAATALQLTGDKGEYQDLITWEQLSDAARNALIEKDWGTTLFD  455946

Query  229     LAGLKMPLKDGVFEELLDKTWPF  251
               L G KMPLKD  F + L   +PF
Sbjct  455947  LIGAKMPLKDQNFNKTLKAAFPF  456015

 Score = 55.5 bits (132),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKF--KPQLKIDAGCHPYPAVQKDGSMS  69
                I H++V+PF QP+  TVS+K AVK+  KP L I +GCHP PAV   G  S
Sbjct  2866576  IDHNKVQPFAQPEATTVSEKAAVKY*YKPSLHIVSGCHPNPAVNVAGETS  2866427

 Score = 53.5 bits (127),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 4/50 (8%)
 Frame = -2

Query  75       SGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPK----GRAATVPP  120
                 G  D  C GS LGSQ++ R+ W ND+ AIMYAWYFPK    GR+    P
Sbjct  2866406  GGGLDSGCKGSGLGSQVHGRAVWHNDL*AIMYAWYFPKTTLLGRSQRFSP  2866257

 Score = 68.9 bits (167),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 16/91 (18%)
 Frame = +2

Query  76       GPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYV  135
                G +  +  GS+LGSQ+Y RSAW   VWAIMYAW FP      V PD          WE+V
Sbjct  3602117  GRRHAKSKGSKLGSQVYGRSAWFGRVWAIMYAWCFPD-----VTPD----------WEHV  3602251

Query  136      VVWIDNPGLENATVLGVSMSASI-GYSKQAP  165
                +V  +N  + +  +L V+ S+S  GY+ QAP
Sbjct  3602252  IV*TNNSNVTDQVILAVTTSSSNGGYTSQAP  3602344

 Score = 37.7 bits (86),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQL  50
                I + + +PF +P+P +V++K A KFKPQL
Sbjct  3601969  ISYQKAKPFEEPEPSSVTEKAATKFKPQL  3602055

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 95/209 (45%), Gaps = 49/209 (23%)
 Frame = +3

Query  70       GGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHR  129
                G  + +G  D  C GS LGSQ+Y R+ W ND+ AIMY W FPK R  T         G+R
Sbjct  2869395  GASRGTGGLDSGCKGSGLGSQVYGRAVWHNDL*AIMYVWNFPKERYDTA----FSVSGYR  2869562

Query  130      HN-----W--EYVVVW--------------IDNPGLEN---ATVLGVSMSASIGYSKQAP  165
                H      W     ++W              I++P       ++  G++ SA+    +   
Sbjct  2869563  HKKG*AQWCGSTTLLWRSQRFSPYRMQVQPINSPCERTQSPSSACGITFSATSALRE---  2869733

Query  166      TDVKYVDGTS-----VKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                    Y++GTS     + +     H+L    L  +++TGE QDLI W+QL+  A   L+  
Sbjct  2869734  ----YLNGTSPNLY*LAILTSDEHML---YLWASKETGELQDLIMWEQLTEEAPAGLSKA  2869892

Query  221      DWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                D     FG A  ++P  D  FE  L+K +
Sbjct  2869893  D-----FG-AKTEVPFIDANFEANLEKAF  2869961

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 60/136 (44%), Gaps = 9/136 (7%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP+  TVS+K AVK KP L++ +GCH        G  SGGLK  G     
Sbjct  2869268  IDHDKVQPFAQPEATTVSEKAAVKCKPNLRVVSGCHVA------GETSGGLKGHGGARLW  2869429

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                  G R G      S              FP+G    V     R           VVW+DN
Sbjct  2869430  MQGLRSGLPSVRPSRLAQ*SLGHHVRVEFPQGE---V*HGLQRVGLSTQKGLSAVVWLDN  2869600

Query  142      PGLENATVLGVSMSAS  157
                P +    VL VS +++
Sbjct  2869601  PAVAEPKVLAVSYASA  2869648

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 26/186 (14%)
 Frame = +3

Query  56       CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA  115
                CH YPA  + G +S  LK    +      +R+ S  +AR + V  + ++        G +
Sbjct  3602061  CHAYPAENEAGQISTWLK----KADATQKARVRS--WARKSTVAPLGSVGCGLSCTPGAS  3602222

Query  116      ATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTS  175
                 T PP      G+  + E   +         +  L      ++   K  P D   V GTS
Sbjct  3602223  QTSPP-----TGNTLSCERTTLMS---LTR*S*RLRRPAQMAVTPRKPPPPDASMVSGTS  3602378

Query  176      VKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMP  235
                VKV Y  N L   T     ED G+ QDLI W QL+++A+ +LN+   DQ+      +++P
Sbjct  3602379  VKVGYSDNTLASTT-----ED-GDTQDLIMWHQLTAVAQEALNN---DQS---FDNVQVP  3602522

Query  236      LKDGVF  241
                + D  F
Sbjct  3602523  VNDDYF  3602540

 Score = 41.2 bits (95),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 60/138 (43%), Gaps = 28/138 (20%)
 Frame = -1

Query  135      VVVWIDNPGLENATVLGVSMSASI--GYSKQA---PTDVK---------------YVDGT  174
                VV   DNP  E   +L  S ++S   GY  +A   PT ++               ++DGT
Sbjct  2866308  VVFSQDNPAGEEPKILAGSYASSTDSGYGVRANVEPTCLQNNLWHREMCTAAFSDFLDGT  2866129

Query  175      SVKVAYYYNHLLGNTALQL--TEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGL  232
                S K++Y    +     L L  +E+    QDLI W+QL+  AR  L   ++ +        
Sbjct  2866128  SAKLSYEAMQV*DERLLYLMVSEEILALQDLIMWEQLTEEARTGLREANFGEK------T  2865967

Query  233      KMPLKDGVFEELLDKTWP  250
                K+   D  FE  L+K  P
Sbjct  2865966  KVQFIDANFEANLEKALP  2865913

 Score = 34.7 bits (78),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI  52
                MN RA F AA ASLA+ QA VI HDQV PF QP   T      +KFKPQ+++
Sbjct  6416985  MNLRAFFTAAAASLALTQADVISHDQVVPFAQPTASTAE*AAGIKFKPQIRL  6416830

>PHRA:scaffold_378
Length=14951

 Score = 237 bits (604),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 149/230 (65%), Gaps = 15/230 (7%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQVRPF QP+PVT+S++ A+KFKPQL +  GCHPYPAV   G + GGLK +G     
Sbjct  13768  ISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTAG  13947

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQIY RS W  D+WAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  13948  CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  14106

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P + N  +L VS SA  GYSK AP     +DGTS K+ Y  ++ + N AL  T D GEFQ
Sbjct  14107  PDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQ  14283

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI W+Q+S LAR +LN  +     FG A   +P+ DG F   LDK WPF
Sbjct  14284  DLIMWEQMSDLARQALNTMN-----FGDA--NVPMNDGNFVGKLDKAWPF  14412

 Score = 185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 150/249 (60%), Gaps = 14/249 (6%)
 Frame = -1

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MN R  FVAA  SLA AQA VI HDQV PF QP P T  Q   +KFKPQ+ I  GCHPYP
Sbjct  1019  MNLRDFFVAAAVSLAFAQADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYP  840

Query  61    AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             AV + G+ SGGLK +G     C GS  GSQIY R      V+A+MY+WYFPK    T   
Sbjct  839   AVDEAGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVT---  669

Query  121   DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                   GHRH+WE+VVVW+D+  L++ +++ VS SA  GY+   P +   +DG S KV Y
Sbjct  668   ----GLGHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDY  501

Query  181   YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
               + ++ N AL  T D+GE QDLI WDQL+  AR +L +TD     FG A   +P+KDG 
Sbjct  500   SSSWVVVNHALDSTSDSGESQDLIMWDQLTDAARTALENTD-----FGDA--NVPMKDGN  342

Query  241   FEELLDKTW  249
             F   L   +
Sbjct  341   FLTKLGNAY  315

>PHRA:scaffold_196
Length=43483

 Score = 237 bits (604),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 149/230 (65%), Gaps = 15/230 (7%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQVRPF QP+PVT+S++ A+KFKPQL +  GCHPYPAV   G + GGLK +G     
Sbjct  1342  ISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTAG  1521

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQIY RS W  D+WAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  1522  CKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  1680

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P + N  +L VS SA  GYSK AP     +DGTS K+ Y  ++ + N AL  T D GEFQ
Sbjct  1681  PDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEFQ  1857

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI W+Q+S LAR +LN  +     FG A   +P+ DG F   LDK WPF
Sbjct  1858  DLIMWEQMSDLARQALNTMN-----FGDA--NVPMNDGNFVGKLDKAWPF  1986

 Score = 216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 151/251 (60%), Gaps = 14/251 (6%)
 Frame = -2

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MN RA+    +ASLA  Q  VIGHDQV PFPQ  P +++   A+ FKPQ+ I+ GCHPYP
Sbjct  3666  MNLRALTTVVLASLASVQGAVIGHDQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYP  3487

Query  61    AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              V  +G   GGLK +G     C GS  GSQ+Y RSAW N VWAIMY+WYFPK      P 
Sbjct  3486  VVNANGDTGGGLKTTGSSAAGCRGSGYGSQVYGRSAWYNGVWAIMYSWYFPKDE----PQ  3319

Query  121   DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
             DF    GHRH+WE+VVVWIDNP   N  +L ++ SA  GYS  AP D   VDGTS KV Y
Sbjct  3318  DFT---GHRHDWEHVVVWIDNPQNTNPKILAMTPSAHSGYSTYAPPDADMVDGTSCKVEY  3148

Query  181   YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
               + L  +  L+ T   GE QDLI W  ++  ARY+LN T+     FG A    P+ DG 
Sbjct  3147  TSSWLFIDHHLEGTSTAGETQDLIMWGDMTDAARYALNTTN-----FGKA--NTPMNDGN  2989

Query  241   FEELLDKTWPF  251
             F   L K +P+
Sbjct  2988  FLPKLGKAYPW  2956

>PHRA:scaffold_17
Length=600116

 Score = 236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 143/230 (62%), Gaps = 15/230 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PF QP+P+T+S+K  VKFKPQ+ +  GCHPYPAV + G   GGLK  G     
Sbjct  69567  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLKTKGAPSAG  69746

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  69747  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  69905

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +EN  +L V+ SA  GYSKQ P +   VDGTSVKV Y     + N AL+ T   G+FQ
Sbjct  69906  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSVKVEYKSKWPI-NHALESTSQGGDFQ  70082

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI WDQLS  AR +LN   W            P+ DG F+  L K WPF
Sbjct  70083  DLIMWDQLSENARRALNSVPW-------GDANTPMNDGNFQNKLGKAWPF  70211

 Score = 236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 148/230 (64%), Gaps = 15/230 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PFPQPDPVT+S+K  VKFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  52398  IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  52577

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  52578  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPST-------GIGHRHDWEHVIVWIDN  52736

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +EN  +L V+ SA  GY K AP +   +DGT+ KVA Y +H   + AL  + + G+FQ
Sbjct  52737  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDFQ  52913

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI WDQLS  AR +LN  +     FG A   +P+ DG F+  L + WPF
Sbjct  52914  DLIMWDQLSENARRALNSVN-----FGNA--NVPMNDGNFQAKLGRAWPF  53042

 Score = 234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 143/230 (62%), Gaps = 15/230 (7%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PF QP+P+T+S+K+ VKFKPQ+ +  GCHPYPAV   G   GGLK  G     
Sbjct  55522  IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLKTKGAPSAG  55701

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y R+AW  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  55702  CKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  55860

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +EN  +L V+ SA  GYSKQ P +   VDGTS KV Y     + N AL+ T   G+FQ
Sbjct  55861  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSAKVEYKSKWPI-NHALESTSQGGDFQ  56037

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI WDQLS  AR +LN   W            P+ DG F   LDK WPF
Sbjct  56038  DLIMWDQLSENARRALNSVPW-------GDANTPMNDGNFLPKLDKAWPF  56166

>PHRA:scaffold_780
Length=8633

 Score = 236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 148/230 (64%), Gaps = 15/230 (7%)
 Frame = -2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV+PFPQPDPVT+S+K  VKFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  7537  IDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSAG  7358

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  7357  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPST-------GIGHRHDWEHVIVWIDN  7199

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P +EN  +L V+ SA  GY K AP +   +DGT+ KVA Y +H   + AL  + + G+FQ
Sbjct  7198  PDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDFQ  7022

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI WDQLS  AR +LN  +     FG A   +P+ DG F+  L + WPF
Sbjct  7021  DLIMWDQLSENARRALNSVN-----FGNA--NVPMNDGNFQAKLGRAWPF  6893

>PHCA:scaffold_14 PHYCAscaffold_14
Length=1100894

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+PVT+S+K AVK+KPQ+ I  GCHPYPAV + G  SGGLK  G     
Sbjct  993076  IDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLKTKGAPSAG  992897

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS WV  VWAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  992896  CKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  992738

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +EN  +L V+ SA  GYSKQ P     VDGTSVKV Y     + N AL  T + G+FQ
Sbjct  992737  PDIENPKILAVTPSAHSGYSKQVPPKADCVDGTSVKVKYESKWPV-NHALDSTSEGGDFQ  992561

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQLS  AR ++N   W +          P  DG F   LDK WPF
Sbjct  992560  DLIMWDQLSENARRAMNGVGWGKA-------NTPFNDGNFLPKLDKAWPF  992432

 Score = 231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+PVT+S+KTAVKFKPQL I  GCH YPAV + G   GGLK  G     
Sbjct  998267  IDHDQVKPFAQPEPVTISEKTAVKFKPQLHITNGCHSYPAVDEAGETGGGLKTKGAPSAG  998088

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W  DVWAIMY WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  998087  CKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSS-------GIGHRHDWEHVIVWIDN  997929

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +EN  +L V+ SA  GY K AP +   +DG + KVAY     + + AL  T + G+FQ
Sbjct  997928  PAVENPKILAVTPSAHSGYHKYAPPNADTIDGVTTKVAYDSKWPMDH-ALDSTSEAGDFQ  997752

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQLS  AR +LN  +     FG A    P+ DG F+  L K WPF
Sbjct  997751  DLIMWDQLSENARRALNSVN-----FGKA--NTPMNDGNFQPKLAKAWPF  997623

 Score = 231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 142/230 (62%), Gaps = 15/230 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HDQV+PF QPDPVTVS+K AVKFKPQ+ I  GCHPYPAV   G  SGGLK  G     
Sbjct  996517  MDHDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLKTKGAPSAG  996338

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  996337  CKGSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  996179

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +EN  +L V+ SA  GYSKQ P     VDGTSVKV Y     + N AL+ T + GE Q
Sbjct  996178  PDIENPKILAVTPSAHSGYSKQVPPSADCVDGTSVKVKYESKWPI-NHALESTTEGGETQ  996002

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QLS  A  ++N   W            P  DG F+  LDK WPF
Sbjct  996001  DLIMWNQLSENALRAMNSVTW-------GDANCPFCDGNFQAKLDKAWPF  995873

>PHKE:scaffold_192 scf_22126_192.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_192.1:1:65168:1 
REF
Length=65168

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 160/251 (64%), Gaps = 15/251 (6%)
 Frame = -2

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MN R   V A+A++A  +A VI HDQV PF QP+  T+S+K AVKFKPQ+ +  GCHPYP
Sbjct  24421  MNLRTFVVTAVAAIAAVEADVISHDQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYP  24242

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              AV   G  SGGLK +G   G C GS  GSQ+Y RS W +  WAIMY+WYFPK   +T   
Sbjct  24241  AVNSAGDTSGGLKPTGAPSGSCKGSGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPST---  24071

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                    GHRH+WE+VVVWIDNP +EN T+LGVS SA  GYSK  P     VDGTSVKV  
Sbjct  24070  ----GLGHRHDWEHVVVWIDNPDVENPTILGVSPSAHSGYSKYVPPSSDTVDGTSVKVN-  23906

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              Y +H   N AL  T  +G+FQDLI WDQ++  AR +L +TD     FG A   +P+KDG 
Sbjct  23905  YESHWPINHALDSTSKSGDFQDLIMWDQMTDAARTALENTD-----FGSA--NVPMKDGN  23747

Query  241    FEELLDKTWPF  251
              F   L   WPF
Sbjct  23746  FLTKLGNAWPF  23714

 Score = 59.3 bits (142),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 58/115 (50%), Gaps = 11/115 (10%)
 Frame = -1

Query  89     SQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENAT  148
              SQ+Y ++   +D+WAI YA YFPKG     P         RH+    V+WIDNP LE   
Sbjct  32864  SQVYDQAGCHSDIWAITYA*YFPKGLKGEYP-------SRRHD*VRSVLWIDNPALEAPK  32706

Query  149    VLGVSMSASIG-YSKQAPT-DVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              +L V+ S S   Y K  PT D    D ++V +   +  L  NT  +L+  T  F+
Sbjct  32705  ILAVTTSKSNSKYGKVEPTPDYAITDSSTVHLT--WAMLQVNTR*KLSPLTSSFR  32547

 Score = 52.8 bits (125),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQ  63
              I HD+V+PF QP+P+T S+KTA+KFKP L+I      YPA+ 
Sbjct  33051  IDHDKVQPFAQPEPITDSEKTAIKFKPLLRIKRS*DSYPALN  32926

 Score = 46.6 bits (109),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 12/90 (13%)
 Frame = -3

Query  75     SGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEY  134
              +G   G+  GS  GSQ+Y RS W    WA MY+   P    +T          +RH+   
Sbjct  29769  AGDTSGK*KGSDYGSQMYGRSTWYRGRWA-MYS**VPNDDPST-------GTSNRHD---  29623

Query  135    VVVWIDNPGLENATVLGVSMSASIGYSKQA  164
                +WIDN  + N+T+LGV+ S   GY K A
Sbjct  29622  -SLWIDNADVTNSTILGVTPSVQSGYKKYA  29536

 Score = 33.5 bits (75),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (53%), Gaps = 0/51 (0%)
 Frame = -1

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAG  231
              Y +  L + AL +T   G++ DLI WDQL+  A   L  TD++     + G
Sbjct  29489  YESS*LTDHALDVTTKGGDYHDLIMWDQLTEAAWTVLQSTDFESVNVPMKG  29337

>PHCA:scaffold_46 PHYCAscaffold_46
Length=525601

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I H+QV PF QP+  T+SQK A+KFKPQ+ I  GCHPYPAV + G  SGGLK SG     
Sbjct  434630  IDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLKTSGAPSSS  434809

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W N  WAIMY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  434810  CKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWIDN  434968

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P + N T+L  S SA  GYS  AP     VDGTSVKV Y  N  + N AL +T  +GE Q
Sbjct  434969  PDVANPTILATSPSAHSGYSFYAPPSSDSVDGTSVKVNYESNWPI-NHALDMTSKSGETQ  435145

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQLS  ARY+LN TD     FG A   +P+ DG F   L K WPF
Sbjct  435146  DLIMWDQLSEAARYALNTTD-----FGKA--NVPMNDGNFVAKLGKAWPF  435274

>PHKE:scaffold_309 scf_22126_309.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_309.1:1:43521:1 
REF
Length=43521

 Score = 234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PF QP+PVT+S+K  VKFKPQ+ I  GCHPYPAV + G  SGGLK  G     
Sbjct  42303  IDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAG  42482

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W NDVWAIMY+WYFPK   +T         GHRH+WE+V++WIDN
Sbjct  42483  CKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWIDN  42641

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +EN  +L V+ SA  GYS   P +   +DGTS KV  Y +H   N AL  T + G+FQ
Sbjct  42642  PDVENPRILAVTPSAHSGYSTYRPPNADTLDGTSAKVN-YESHWPVNHALDSTSEGGDFQ  42818

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI WDQ++  AR +LN   W           +P+ DG F   LDK WPF
Sbjct  42819  DLIMWDQMTDNARRALNEVSW-------GDANVPMNDGNFGPKLDKAWPF  42947

 Score = 222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 140/230 (61%), Gaps = 14/230 (6%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV PF Q    +++   A+KFKPQ+ I+ GCHPYPAV  +G  SGGLK SG +   
Sbjct  1915  ISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSGSESAG  2094

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQ+Y RS W N+VWAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  2095  CKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDNPVT-------GMGHRHDWEHVVVWIDN  2253

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P +EN T+L V+ SA  GYS  AP D   VDG S KV Y  + ++ N  L  T   GEFQ
Sbjct  2254  PAMENPTILAVTPSAHSGYSTYAPPDPSTVDGASAKVQYTSSWIVINHHLDTTSTAGEFQ  2433

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI W  L+  AR +LN  D++          +P+KDG FE  L   +P+
Sbjct  2434  DLIMWGDLTDAARNALNTADFE-------AANVPMKDGNFESKLGNAYPW  2562

>PHCA:scaffold_87 PHYCAscaffold_87
Length=182599

 Score = 233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 146/230 (63%), Gaps = 15/230 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PFPQP PVT+S++ A+KFKPQL +  GCHPYPAV   G   GGLK +G     
Sbjct  164226  IDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSPTAG  164047

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWI N
Sbjct  164046  CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWISN  163888

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P + N T+L V+ SA  GYSK AP     VDGTS+KV Y   + + N A  +T + GEFQ
Sbjct  163887  PDVPNPTILAVTPSAHSGYSKYAPPSADTVDGTSIKVRYESTYPM-NHATDVTTEAGEFQ  163711

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ++  AR +LN        FG A   +P+ DG F   LDK WPF
Sbjct  163710  DLIMWDQMTDAARNALN-----TVSFGDA--NVPMNDGNFVPKLDKAWPF  163582

 Score = 228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 145/227 (64%), Gaps = 15/227 (7%)
 Frame = +3

Query  23      GHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGEC  82
               GHDQV PF QP P ++SQ TAV FKPQL I  GCHPYPAV  DG+ SGGL  +G     C
Sbjct  153135  GHDQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAGC  153314

Query  83      TGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
                GS  GSQIY RSAW N VWAIMY+WYFPK   ++        FGHRH+WE++VVW+DNP
Sbjct  153315  KGSGYGSQIYGRSAWYNGVWAIMYSWYFPKDSPSSG-------FGHRHDWEHIVVWLDNP  153473

Query  143     GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                + +  +L VS SA  GY+   P +  Y++G S K+  YY+ LL N A ++T D GE Q+
Sbjct  153474  AVASPKILAVSTSAHSGYTVYYPPNSNYLNGKSAKID-YYSILLINHAFRMTSDAGETQN  153650

Query  203     LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               LI WDQ++  AR +L +TD     FG A   +P KDG FE  L   W
Sbjct  153651  LIMWDQMTDAARTALQNTD-----FGDA--NVPFKDGNFESKLANAW  153770

 Score = 177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 129/228 (57%), Gaps = 16/228 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF QP P T  Q  A++FKPQ+ I+ GCHPYPAV  DG+ SGGLK +G Q   
Sbjct  156457  IDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPTGSQSAG  156636

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  156637  CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-------LDGQGHRHDWENCVVWLDS  156795

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 L+  +++ +S S    Y+   P    Y+DG S K+ Y  + ++ + +L  T   GE Q
Sbjct  156796  --LDRPSIVALSASYHSTYNYYYPPSSSYLDGNSAKIQYSTSWIVLDHSLSATSTAGEIQ  156969

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               DLI WDQL+  AR +L  TD     FG A   +P K+  F   L K +
Sbjct  156970  DLIMWDQLTDAARTALEDTD-----FGSA--NVPFKEDNFIAKLAKAY  157092

 Score = 172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 130/228 (57%), Gaps = 16/228 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF QP P T  Q  AV++KPQ+ I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  152172  IDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSQSAG  152351

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  152352  CKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-------LPGLGHRHDWEACVVWLDS  152510

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 LEN  V+ +S S    Y    P D  Y+DG S K+ Y  + ++ + +L  T  +GE Q
Sbjct  152511  --LENPNVVALSASYHSTYLTYYPPDSGYLDGNSAKIEYSTSWVILDHSLSATSTSGETQ  152684

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               DLI WDQL+  AR +L  TD     FG A   +P KD  FE  L   +
Sbjct  152685  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDANFETKLANAY  152807

>PHSO:scaffold_3
Length=10773376

 Score = 233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV PF QP+ VT+SQK AVKFKPQ+ I  GCHPYPA  + G  SGGLK +G     
Sbjct  8280295  IDHDQVVPFAQPEAVTISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGAPSSS  8280474

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W +  WAIMY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  8280475  CKGSGWGSQVYGRSTWYSGRWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWIDN  8280633

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +EN T+L  S SA  GYS   P     +DGTSVKV  Y +H   N AL +T ++GEFQ
Sbjct  8280634  PDVENPTILSTSPSAHSGYSYYVPPSADSIDGTSVKVN-YESHWPINHALDMTSESGEFQ  8280810

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQLS  AR +LN T      FG A   +P+ DG F   L K WPF
Sbjct  8280811  DLIMWDQLSDAARLALNTTS-----FGSA--NVPMNDGNFLTKLGKAWPF  8280939

 Score = 197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 138/246 (56%), Gaps = 30/246 (12%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP+P TVS+K AVKFKP ++I +GCHPYPAV   G  SGGLK SG  DG+
Sbjct  1279225  IDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPSGEPDGD  1279404

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C  S LGSQ+Y R+ W  D+WAIMY WYFPK    T    F R  G RH W   +VW+DN
Sbjct  1279405  CKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGT----FFR-SGQRHKWASFIVWLDN  1279569

Query  142      PGLENATVLGVSMS-------------ASIGYSKQAPTDVKYVDGTSVKVAY---YYNHL  185
                P LE   +L VS S              + G    +P    Y++GTS  +AY   +Y  +
Sbjct  1279570  PSLEKPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLAYLDTFYGSI  1279749

Query  186      LGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                L  T  +     GE QDLI W+QL+  A+ +LN TD+ +        ++P  D      L
Sbjct  1279750  LEMTTAR---TGGELQDLIMWEQLTEEAQIALNETDFGEK------ARVPFIDANLNANL  1279902

Query  246      DKTWPF  251
                ++T  F
Sbjct  1279903  EQTRSF  1279920

 Score = 196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 120/202 (59%), Gaps = 9/202 (4%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQVRPF QP P TVS+K AVKF PQ+ I  GCHPYPAV   G  SGGL+ +G     
Sbjct  5670331  INHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPYPAVNAAGETSGGLQTNGAPSAG  5670152

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W    WAIMY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  5670151  CKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPSTT-------LGHRHDWEHVVVWIDN  5669993

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P + N  +L V+ SA  GYSK AP     V G + KV  Y +H   N AL  T+  G+ Q
Sbjct  5669992  PAVANPKILAVTPSAHSGYSKYAPPKAGTVTGNTAKVN-YESHWPVNHALDSTDVGGDAQ  5669816

Query  202      DLIQWDQL-SSLARYSLNHTDW  222
                DLI W+Q    L R    H  W
Sbjct  5669815  DLIMWEQQHGKLRRRQCTHERW  5669750

 Score = 188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 140/232 (60%), Gaps = 16/232 (7%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV PFPQ  P T++ K A+K KP+L I+ GCH +PAV  +G  SGGLK  G  +G 
Sbjct  3147574  IDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLHPAVNANGDTSGGLKPKGSPEGG  3147753

Query  82       CTGSRLGSQIY--ARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                C GS  GSQ+Y   RS W N VWAIMYAWYFPK      P DF    GHRH+WE+V+V I
Sbjct  3147754  CRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPKDE----PTDF---DGHRHDWEHVIVRI  3147912

Query  140      DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
                +NP LEN T+L ++ SA  GYS  AP     V GTS KV Y  + +  +  L+ T   GE
Sbjct  3147913  NNPVLENPTILAMTPSAHSGYSTYAPPPADMVSGTSCKVEYTSSWIFIDHHLEGTSTAGE  3148092

Query  200      FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 QDLI W  L+  ARY+L+ T+     FG A    P+ +G F   L K WP+
Sbjct  3148093  TQDLIMWSDLTDAARYALSTTN-----FGKA--DTPMNNGTFNWKLSKAWPW  3148227

 Score = 184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 122/221 (55%), Gaps = 21/221 (10%)
 Frame = +2

Query  32       QPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQI  91
                QP+PVT S+K AVKFKPQLK+   CHPY AV   G +SGGL         C GS LG+QI
Sbjct  3321503  QPEPVTTSEKAAVKFKPQLKLSNTCHPYAAVDAHGYISGGLNSELHIRNNCGGSDLGAQI  3321682

Query  92       YARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLG  151
                YARSAW +DVWA +YAWYFPK       P        R  W Y ++W+  PG+    V+G
Sbjct  3321683  YARSAWHSDVWATVYAWYFPKNSNNGGGP--------RSLWMYAIIWVGGPGVGAPEVVG  3321838

Query  152      VSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSS  211
                 ++       K AP D  Y+DGTS +  + YN       L  T+ TG +QDLI W+QL  
Sbjct  3321839  ATLKTDDDTEKHAPVDADYIDGTSFECKFTYNFWTTKAKLTATKKTGGYQDLITWEQLPE  3322018

Query  212      LARYSLNHTDWDQTLFGLAGLK-MPLKDGVFEELLDKTWPF  251
                +AR             GLAG   MPL +G FEELL   WPF
Sbjct  3322019  VART------------GLAGYADMPLLNGTFEELLTNGWPF  3322105

 Score = 150 bits (378),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PFPQP PVTVS+K AVK+KP L I   CHPYPAV   G  SGGLK +G +DG 
Sbjct  8883665  IDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGTGKRDGA  8883844

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y R+ W +D+WAIMYAWYFPK              G RHNW   VVW+DN
Sbjct  8883845  CKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKD---VYYRGTFSDKGFRHNWVNAVVWLDN  8884015

Query  142      PGLEN  146
                P LE 
Sbjct  8884016  PALET  8884030

 Score = 49.7 bits (117),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 44/92 (48%), Gaps = 7/92 (8%)
 Frame = +1

Query  159      GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLN  218
                GY + +P    Y +GTS  + Y  N    +   Q T   GE QDLI W+QL+  AR +L+
Sbjct  8884129  GYQECSPPFTGYFNGTSAMLVYEANGEEPSALSQNTLGGGELQDLIMWEQLTVEARDALS  8884308

Query  219      HTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                 TD+ +T       K+P  D  F   L    P
Sbjct  8884309  TTDFGET-------KVPFIDANFNANLKAARP  8884383

 Score = 157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = -1

Query  25       DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
                D+V+PF +P+ VT+S    VKFKPQLK+   CHPYPAV  +G ++ G+K S      C G
Sbjct  3314416  DKVKPFAEPELVTISD*VVVKFKPQLKLSGTCHPYPAVDTNGDINAGMKPSWGIFDRCDG  3314237

Query  85       SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
                S LGSQ+YARSA  N++WAIMY WYFPKG        F    GH + WEY ++WIDNP L
Sbjct  3314236  SDLGSQVYARSA*YNNIWAIMYVWYFPKG--------FSYGMGHSNVWEYAIIWIDNPDL  3314081

Query  145      ENATVLGVSMSASIGYS-KQAPTDVKYVDGTSVKVAYYY-----NHLLGNTALQLTEDTG  198
                E+ T+  V++ +    + K AP D KY+DGTS +V + Y       L G+  L  T   G
Sbjct  3314080  ESPTIKSVTLQSDEDTTEKHAPVDSKYIDGTSFRVNFAYGDNETGRLPGSDYLGATPRRG  3313901

Query  199      E  199
                E
Sbjct  3313900  E  3313898

 Score = 146 bits (368),  Expect(3) = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 87/137 (64%), Gaps = 6/137 (4%)
 Frame = -1

Query  31       PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQ  90
                P P PVT+++K A+KFKPQL  + GC PYPAV   G  + GLK +G   G+C GS LGSQ
Sbjct  8509447  PSP*PVTIAEKAAIKFKPQLSSNDGCQPYPAVNAAGKTNDGLKGTGDASGDCEGSPLGSQ  8509268

Query  91       IYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVL  150
                +Y RS W  D+WAIMY WYFPK R+  +    +  + HRH+W  VVVWIDNP  E   VL
Sbjct  8509267  VYDRSGWYRDLWAIMYTWYFPKDRSENI----IFNYSHRHDWASVVVWIDNPAAETPKVL  8509100

Query  151      GVSMS--ASIGYSKQAP  165
                GVS      I YSK  P
Sbjct  8509099  GVSTGWLGQIYYSKNTP  8509049

 Score = 40.8 bits (94),  Expect(3) = 2e-41, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 6/63 (10%)
 Frame = -3

Query  190      ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLA-GLKMPLKDGVFEELLDKT  248
                +L +    G FQD+I W+QL+  AR + N      T FG++    +P  D  FE  L + 
Sbjct  8508998  SLTVVTTRGGFQDIIMWEQLTDAARIARN-----TTYFGVSYDTLVPFIDANFERNLARA  8508834

Query  249      WPF  251
                WP+
Sbjct  8508833  WPY  8508825

 Score = 26.2 bits (56),  Expect(3) = 2e-41, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  22       IGHDQVRPFPQPDP  35
                + HD+V+PFP PDP
Sbjct  8509473  LDHDKVQPFPHPDP  8509432

 Score = 155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 125/232 (54%), Gaps = 28/232 (12%)
 Frame = -3

Query  26       QVRPFPQPDPVTVSQKTAVKFKPQLKIDA-GCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
                Q    PQ DPVT+S+K AVKFKP L +    C  +PAV   G  SGGLK +    G CT 
Sbjct  1701254  QSAAIPQADPVTISEKAAVKFKPLLAVHKFSCVTFPAVNSAGETSGGLKGTNYNKG-CTS  1701078

Query  85       SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNP  142
                + LGSQ+Y R+ W  DVWAIMYAWYFPKG           F+    RHNW   VVWIDNP
Sbjct  1701077  APLGSQVYGRARWFKDVWAIMYAWYFPKG-----------FWDADRRHNWASAVVWIDNP  1700931

Query  143      GLENATVLGVSMSAS-IGYSKQAPTDVKYVDGTSVKV--AYYYNHLLGNTALQLTEDTGE  199
                 LE    LG+S+S S   Y+  AP  +       +++  A + +  + +    L    G 
Sbjct  1700930  ALETPKALGLSLSKSDTKYNHLAPVSLPNATTPYLQLDAASFSDFEMKSIEFAL----GS  1700763

Query  200      FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 QDLI W+QL+  AR +LN    D   FG + +  P+ D  F E L+K WPF
Sbjct  1700762  SQDLIMWEQLTGAARAALN----DPKSFGESFV--PMSDTNFPEWLEKAWPF  1700625

 Score = 150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 108/171 (63%), Gaps = 9/171 (5%)
 Frame = +1

Query  25       DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDG-SMSGGLKWSGPQDGECT  83
                D+V+P  QP+PVT S K AVKFKP LKI   CHPY  V  +G + SG    S      C 
Sbjct  3315040  DKVKPIDQPEPVTTSDKAAVKFKP*LKISGACHPYAVVSSNGYTSSGMKSSSSWSMSGCG  3315219

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                GS LGSQ+YARS W +DVWAIMYAWYFPKG          + +   H+W++V+VWIDNP 
Sbjct  3315220  GSELGSQVYARSTWHDDVWAIMYAWYFPKGSD--------KGWDFTHDWKFVIVWIDNPA  3315375

Query  144      LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLT  194
                LE+  +LG ++S +    K  P + KYVDGTSVKV + ++   GN  L++T
Sbjct  3315376  LESPAILGATVSTNKCLMKYVPLEEKYVDGTSVKVLHKFSFWSGNADLEIT  3315528

 Score = 94.7 bits (234),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI--DAGCHPYPAVQKDGSMSGGLKWSGPQD  79
                I +D+V PFPQP PVTVS+K AVKFKP+L I  +  C P+  V   G  +GG       +
Sbjct  1713775  IDYDKVEPFPQPSPVTVSEKAAVKFKPRLLIADEVSCVPFLVVNAAGE-TGGGLKGNGGN  1713599

Query  80       GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG  113
                  C  + LG+Q+Y RS+W NDVWAIMYAWYFP+ 
Sbjct  1713598  DGCEVAPLGAQVYGRSSWHNDVWAIMYAWYFPRA  1713497

 Score = 79.7 bits (195),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = -3

Query  129      RHNWEYVVVWIDNPGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLG  187
                RH+W   VVWIDNP LE   V+ +S+S S   Y  +AP    +V+GT+  +  Y   +  
Sbjct  1713473  RHDWASAVVWIDNPALEAPKVVRLSLSTSKDSYKNRAP--ASFVNGTAPFLLRYLPGMSS  1713300

Query  188      NTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
                   + + +  G+FQDLI W+QL+ +AR +LN+ +     FG A   +P  D  F   L+K
Sbjct  1713299  AALITIDKPGGDFQDLIMWEQLTDVAREALNNAE----NFGRA--DVPFSDNNFPTWLEK  1713138

Query  248      TWPF  251
                 WP 
Sbjct  1713137  AWPL  1713126

 Score = 140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 124/236 (53%), Gaps = 45/236 (19%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP+PVT+S+KTA+ FK  L+I  GCHPYPAV   G  SGGLK +G  D +
Sbjct  8085787  IDHDKVQPFAQPEPVTISEKTAI*FKLSLQIVTGCHPYPAVNAAGETSGGLKGTGENDED  8085608

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYA-WYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                CTGS LGSQ+Y R+ W  D+WAIMYA  Y+   +    PP    +   R + E       
Sbjct  8085607  CTGSTLGSQVYGRAVWYEDLWAIMYAVAYYDILKEG--PPKCYYYRWGRQSCEVPF----  8085446

Query  141      NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY--YYNHLLGNTAL---QLTE  195
                                           V++++GT+V ++Y  Y++  +G+  +      +
Sbjct  8085445  ---------------------------VEHINGTTVMLSYERYFDGTIGDFQILRPTTRK  8085347

Query  196      DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 TGEFQDLI W+QL+  A  +L++TD+ +         +P  D  F + LD   P 
Sbjct  8085346  VTGEFQDLIMWEQLTEEACTALSNTDFGEK------SPVPFIDANFNKTLDMARPI  8085197

 Score = 102 bits (255),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 8/131 (6%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I H+ V+P  QP+P TVS++   + +     D GC  +PAV   G  S GLK +   +G 
Sbjct  1712349  IDHNIVQPLAQPEPATVSEEEPRRLRSSSSPDCGCLSFPAVNAAGETSEGLKGNWGSEG-  1712525

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C  + LGS++Y R+ W NDVWAIMYAWYFPKG       D   ++    +W   VVWIDN
Sbjct  1712526  CESAPLGSRVYGRATWHNDVWAIMYAWYFPKGLW-----DGDTYW--SDDWGSTVVWIDN  1712684

Query  142      PGLENATVLGV  152
                P +++  ++G+
Sbjct  1712685  PAVDSPKIMGL  1712717

 Score = 40.0 bits (92),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 9/78 (12%)
 Frame = +1

Query  168      VKYVDGTSVKVAYYYNHLLGNTALQLTEDT--GEFQDLIQWDQLSSLARYSLNHTDWDQT  225
                V + +GT+  ++         T LQL ++   G+FQDLI W QL+  AR +LN+ +    
Sbjct  1712743  VSFANGTTPTLSRVLPGPT-RTRLQLNDEAPFGDFQDLITWTQLTDAAREALNNPEN---  1712910

Query  226      LFGLAGLKMPLKDGVFEE  243
                 FG A   +P+ D  F E
Sbjct  1712911  -FGRA--DVPISDANFPE  1712955

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = -3

Query  129      RHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
                RHNW  VVVW+DNPG+EN  +L V  SA +G         +     +++       +   
Sbjct  9929960  RHNWAAVVVWLDNPGVENPKILAV--SAMVGDDLYDLRFRRMALPRALRTCVMRGFVESE  9929787

Query  189      TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFG  228
                 +L    D GEFQDLI W QL+  AR +++  D+     G
Sbjct  9929786  LSLSTGRDNGEFQDLIMWGQLTEEARRAVSQVDFSAPFNG  9929667

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 65/129 (50%), Gaps = 12/129 (9%)
 Frame = +1

Query  127      GHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLL  186
                G R +W  VVVWIDN  +EN   +GV+ S+ +   +  PT  ++ +        Y     
Sbjct  8444005  GQRFDWVNVVVWIDN-AVENPKDIGVAPSSYVVVREVHPTSARWHERHKRHDQLYLADS-  8444178

Query  187      GNTALQLTEDT----GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
                 N+     + T    GEFQDLI W+QL+  AR +L++TD     FG    K+P  D  FE
Sbjct  8444179  KNSGFHTVDTTWMKGGEFQDLIMWEQLADAARDALSNTD-----FG-ENAKVPFIDVNFE  8444340

Query  243      ELLDKTWPF  251
                  L  TWP+
Sbjct  8444341  ANLQATWPY  8444367

 Score = 38.1 bits (87),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 31/64 (48%), Gaps = 10/64 (16%)
 Frame = -2

Query  188      NTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
                +T+L  T   G +QDLI W+QL   AR +LN T      F  +    PL D  F  +L  
Sbjct  3313977  STSLTATTKQGGYQDLITWEQLPEEARTALNST------FDFS----PLSDRYFTRILAD  3313828

Query  248      TWPF  251
                 WP 
Sbjct  3313827  GWPL  3313816

 Score = 37.7 bits (86),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -3

Query  39       SQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK  73
                ++K+ VKF P  +I  GC P+ AV   G   GGLK
Sbjct  8882522  TEKSVVKFAPSRQIIKGCRPHSAVNATGETGGGLK  8882418

 Score = 37.0 bits (84),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +1

Query  85       SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                S  G Q+YA+  W  D+WAIMY+WY  + R   V P
Sbjct  8882251  SPAGLQVYAQGGWHKDLWAIMYSWYGGQERTTKVCP  8882358

>PHIF:NW_003303739.1 Phytophthora infestans T30-4 supercont1.20 
genomic scaffold, whole genome shotgun sequence
Length=2401636

 Score = 233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP+P+T+S+K AVKFKPQ+ +  GCHPYPAV + G  S GLK  G     
Sbjct  1537375  IDHDQVKPFSQPEPLTISEKAAVKFKPQIHVTNGCHPYPAVNEAGETSSGLKTKGAPSAG  1537554

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS WV+ VWAIMY+WYFPK   ++         GHRH+WE+V+VWIDN
Sbjct  1537555  CKGSGWGSQVYGRSTWVDGVWAIMYSWYFPKDSPSS-------GLGHRHDWEHVIVWIDN  1537713

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                PG+E+  +L V+ SA  GYSKQ P     VDGTSVKV Y     + N AL+ T   G+FQ
Sbjct  1537714  PGIESPKILAVTPSAHDGYSKQVPPKSDCVDGTSVKVNYESTWPV-NHALESTSKGGDFQ  1537890

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQLS  AR ++N   W +          P  DG F+  L K WPF
Sbjct  1537891  DLIMWDQLSENARRAMNGVGWGKA-------NTPFNDGNFKSKLKKAWPF  1538019

 Score = 212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 136/231 (59%), Gaps = 21/231 (9%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PFPQP PVT+S+K AVKFKPQL I  GCH YPAV + G   GGLK  G     
Sbjct  1561567  IDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVNEAGETGGGLKIKGAPSAG  1561388

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
                C GS  GSQ+Y RS+W   VWAIMY WYFPK        D   F  GHRH+WE+V+VWID
Sbjct  1561387  CKGSGWGSQVYGRSSWYQGVWAIMYCWYFPK--------DEQSFKIGHRHDWEHVIVWID  1561232

Query  141      NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                NP      +L V+ SA  GY K AP     +DGT+ KVA Y +H   + AL  T + G+F
Sbjct  1561231  NP----EKILAVTPSAHSGYLKYAPPRPDTIDGTTAKVA-YESHWPMDHALDSTSEAGDF  1561067

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W QLS  A  +LN   W            P+ DG F+  L K WPF
Sbjct  1561066  QDLIMWSQLSENATRALNAVYW-------GNANTPMNDGNFQPKLAKAWPF  1560935

>PHPA:scaffold_48 NW_008649034.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.48, whole genome shotgun 
sequence
Length=510763

 Score = 232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 147/230 (64%), Gaps = 15/230 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHDQV+PF QP PVT+S++ A+KFKPQ+ I  GCHPYPAV   G   GGLK +G     
Sbjct  401975  IGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSPTAG  401796

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V+VWI+N
Sbjct  401795  CKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWINN  401637

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P + +  +L V+ SA  GYSK AP +   +DGTSVKV Y   + + N A  +T D GEFQ
Sbjct  401636  PDVPDPIILAVTPSAHSGYSKYAPPNADTLDGTSVKVNYESTYPM-NHATDVTTDPGEFQ  401460

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ++  AR +LN        FG A   +P+ DG F   LDK WPF
Sbjct  401459  DLIMWDQMTDAARLALNTVS-----FGDA--NVPMNDGNFIPKLDKAWPF  401331

 Score = 224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 147/230 (64%), Gaps = 8/230 (3%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF +  P T S+K AVK+KP++ +  GCHPYPAVQ DGS+S GLK +GP DGE
Sbjct  381416  INHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLKGTGPIDGE  381237

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS+W    WAIMYAWY PKG A   P         RH WE  VVWID+
Sbjct  381236  CGGSDLGSQVYSRSSWYKGKWAIMYAWYLPKGWAYRSP--------RRHFWETAVVWIDD  381081

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N+++LGV++++ +   K  P + +YVDG+SV++            L+ T  +GE Q
Sbjct  381080  PSPTNSSILGVTLNSGLRRKKYVPVERQYVDGSSVQLESCKGRGRPRPMLRFTTISGESQ  380901

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QL+  ARY+L + ++D   F      MPLKD  FE+ L+  WPF
Sbjct  380900  DLIMWEQLTDKARYALANAEFDTGFFKKKRRNMPLKDDRFEKGLEDAWPF  380751

 Score = 222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 140/228 (61%), Gaps = 15/228 (7%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF QP P +VSQ  A  FKPQL I  GCHPYPAV  DG+ SGGL  +G     
Sbjct  407687  IDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTGSSSAG  407866

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIY RS W N VWAIMY+WYFPK   A+        FGHRH+WE++VVW++N
Sbjct  407867  CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPASG-------FGHRHDWEHIVVWLNN  408025

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P + +  +L VS SA  GY+   P    Y+DG S K+  YY+ LL N + ++T D+GE Q
Sbjct  408026  PAVTSPEILAVSTSAHSGYTVYYPPSSDYLDGNSAKID-YYSVLLINHSFRMTSDSGETQ  408202

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               DLI WDQL+  AR +L  TD     FG A   +P KD  FE  L   W
Sbjct  408203  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDANFETKLANAW  408325

 Score = 199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 134/220 (61%), Gaps = 14/220 (6%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V PF QP   T  QK  VKFKPQ+ I  GCHPYPAV  +G+ SGGLK +G     
Sbjct  404158  ISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPTGSSSAG  404337

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y R A  N V+AIMY+WYFPK    T         GHRH+WE+VVVW+D+
Sbjct  404338  CKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDSPVT-------GLGHRHDWEHVVVWVDD  404496

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 L++ +++ VS SA  GY+   P +   +DG S KV Y  + ++ N AL  T D GE Q
Sbjct  404497  IKLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVINHALDSTTDAGETQ  404676

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               DLI WDQL+  AR +L +TD     FG A   +P+KDG F
Sbjct  404677  DLIMWDQLTDAARTALENTD-----FGDA--NVPMKDGNF  404775

 Score = 180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 129/220 (59%), Gaps = 16/220 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF QP P T  Q  AV+FKPQ+ I+ GCHPYPAV +DG+ SGGLK +G +   
Sbjct  409108  IDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSESAG  409287

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIY R+   + V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  409288  CKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDET-------LDGLGHRHDWENCVVWLDS  409446

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 L+N +++ +S S    Y    P D  Y+DG S K+ Y  + ++ + +L  T   GE Q
Sbjct  409447  --LDNPSIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVILDHSLSATSTVGETQ  409620

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               DLI WDQL+  AR +L  TD     FG A   +P K+  F
Sbjct  409621  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKETNF  409719

 Score = 165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 125/226 (55%), Gaps = 15/226 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + +D + PF QP PVT+++K AV+FKPQ+  + GC+PYP V  DG+    L  SGP    
Sbjct  508650  VRYDDIVPFAQPVPVTITEKRAVEFKPQVHTNGGCYPYPVVDTDGNTGDCLASSGPDSKS  508471

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C G  +GSQ+Y R+    D WAIMYAWY PK                RH W   +VW+D+
Sbjct  508470  CNGPSVGSQVYGRAKRFTDKWAIMYAWYLPKISNG-------WGIESRHLWLETIVWLDS  508312

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 LE+ T+L V+      Y K  P+    ++GTSVK+    N L     L +T   GE Q
Sbjct  508311  FVLESPTILAVTTWHQGKYQKYLPSLADTLNGTSVKLD-CTNTLEYGYMLDVTNRIGETQ  508135

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
               DLI W+QL+  AR +L  TD++       GL  P+ DG FEELL+K
Sbjct  508134  DLIMWNQLTDAARSALQWTDFN-------GLSAPISDGRFEELLEK  508018

 Score = 155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 127/232 (55%), Gaps = 19/232 (8%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + +D+V PFP+  P T   K A+KFKPQL I  GCHPYPAV  DG+ + GL  +      
Sbjct  365756  LEYDEVAPFPEVLPTTTESKVALKFKPQLHISNGCHPYPAVDADGNTNAGLGITEVLTS-  365580

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y R      V AIMYAWYFP  R   V P ++   GHRH+WE+ +VW+D+
Sbjct  365579  CKGSPLGSQVYGRVTEYEGVVAIMYAWYFP--RDYMVSPMWV---GHRHDWEHAIVWLDS  365415

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                   +A +L V+    +GY    P   K++DG+SVK+ Y +  +     L  T   G+FQ
Sbjct  365414  LD-TSAELLAVTAQHLLGYKTYKPPRAKHMDGSSVKLKYTWL-IQTQHYLSATTKAGKFQ  365241

Query  202     DLIQWDQLSSLARYSLNHTD--WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DL  W  ++  A+ +L  T   W Q          P+ D  F+  ++K +PF
Sbjct  365240  DLAMWSNMTDAAQDALGSTKFFWSQA---------PMNDAKFQSNIEKAYPF  365112

 Score = 153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 126/232 (54%), Gaps = 21/232 (9%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + +D V P P+ +  T     A++FKPQL +D GCHPYPAV  DG+ + GL     +   
Sbjct  361397  LAYDGVVPLPETEDSTNEYSLALQFKPQLLVDTGCHPYPAVDADGNTNAGLSLVSLK--S  361224

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C    LGSQIYAR++     +AIMYAWYFP+ R           FGHRH WE+ ++W+D 
Sbjct  361223  CQNPSLGSQIYARASVYEGSYAIMYAWYFPRDRRGA--------FGHRHAWEHAILWLDR  361068

Query  142     PGLENATVLGVSMSASIG--YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
                G ++AT+  VS     G  ++ + PT+    D TSVK  Y  +    +  + +T + GE
Sbjct  361067  TGGDDATIEAVSAEVDDGEYFTIEDPTEDMVDDETSVKFKYEEDAF--SHYVNVTTEAGE  360894

Query  200     FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               FQDL+ W+ +   AR +LN  D     FG A   +P  +  F + L+  +PF
Sbjct  360893  FQDLVVWEDMPKAARTALNLND-----FGEA--TVPFNEENFLDNLEGAYPF  360759

 Score = 152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 126/234 (54%), Gaps = 27/234 (12%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + ++ V P P+ +  T     A++FKPQL +D+GCHP+PAV +DG+ + GL     +  +
Sbjct  357215  LAYNSVVPLPETEGTTNEFSLALRFKPQLHVDSGCHPFPAVDEDGNTNSGLSIYSFK--K  357042

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  S LGSQIY R+    D +AIMYAWYFP+ R A         FGHRH WE V+VWI+ 
Sbjct  357041  CDSSALGSQIYGRAKTYKDSYAIMYAWYFPRDRKAA--------FGHRHAWENVIVWINR  356886

Query  142     P-GLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYY---YNHLLGNTALQLTED  196
                 G+  A +  VS S   G Y    P     VD  SVK+ Y    ++H +  T +     
Sbjct  356885  KGGVAKAKMTAVSSSIDDGVYFTIIPPTEDMVDEDSVKIQYRAKTFSHYVNVTTV-----  356721

Query  197     TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                G+FQDL+ W+ + S AR +LN       L+      +P  D  F++ L++ +P
Sbjct  356720  AGDFQDLVMWNDMPSAARTALN-------LYDFGSATVPFNDDTFQDNLEEAYP  356580

 Score = 113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 82/131 (63%), Gaps = 9/131 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V PF QP P T  Q  AV F P + I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  410399  IDHDTVVPFAQPTPTTTLQTLAV*FNP*IYIANGCHPYPAVDEDGNTSGGLKPTGSQSSG  410220

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CTGS LGSQIY R+     V+  MY+WY PK    T+P       GHRH+WE  VVWID+
Sbjct  410219  CTGSSLGSQIYGRAVEYEGVYGFMYSWYMPKDE--TLPG-----LGHRHDWEACVVWIDS  410061

Query  142     PGLENATVLGV  152
                 L+++T++ +
Sbjct  410060  --LDDSTIVAL  410034

>PHRA:scaffold_21
Length=583437

 Score = 232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 146/229 (64%), Gaps = 15/229 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V PFPQP+PVT+S+K AV+FKP++ I  GCHPYPAV + G  SGGL+ +G    +
Sbjct  510195  IGHDEVVPFPQPEPVTISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATGGPSSK  510374

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W + VWAIMY WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  510375  CKGSGWGSQMYGRSTWYSGVWAIMYTWYFPKDSPSTR-------LGHRHDWEHVVVWIDN  510533

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P + N  +L VS SA  GYSK  P     VDGTSVK+  Y +H   N AL  T  +GEFQ
Sbjct  510534  PDVSNPILLAVSPSAHSGYSKYVPPSADSVDGTSVKIN-YESHWPVNHALDTTSKSGEFQ  510710

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
               DLI W Q+S  AR +LN TD+ + +       MP+ DG F   L   WP
Sbjct  510711  DLIMWHQMSDAARLALNTTDFGKAI-------MPMNDGSFLGKLAGAWP  510836

 Score = 191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 141/233 (61%), Gaps = 16/233 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+PVT+S+K AV+FKP+L+I  GCHPYPAV   G  S GLK +G  DG+
Sbjct  314405  IDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGTHDGD  314226

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  SRLGSQ+Y RS W  D+W IMYAWYFPK +     P + +  GHRH W  VVVW+DN
Sbjct  314225  CMRSRLGSQVYGRSVWYGDLWGIMYAWYFPKDK-----PKYRK--GHRHEWANVVVWLDN  314067

Query  142     PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLG--NTALQLTEDTG  198
               P  E  T++G+S S  +  Y+K         DG +  + Y  + L    ++   + E  G
Sbjct  314066  PAHERPTMIGMSTSWFVTTYAKYKFVPTNGFDGKTYTINYKDDVLNDGFHSVDVIWEIGG  313887

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               EFQDLI W+QL+  AR +L+ TD+ +         +P  D  F+  L+K  P+
Sbjct  313886  EFQDLIMWEQLTDEARAALSDTDFGED------APVPFIDANFKANLEKAQPY  313746

>PHCA:scaffold_51 PHYCAscaffold_51
Length=529628

 Score = 231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 142/230 (62%), Gaps = 15/230 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V PF QP+PVT+S K A+KFKPQL I  GCHPYPAV   G  SGGLK SG     
Sbjct  306787  IDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPSAG  306966

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  306967  CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  307125

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +LGV+ SA  GYS Q P D   VDG+SVKV Y     + N AL+ T + G+FQ
Sbjct  307126  PEVPEPKILGVTPSAHSGYSSQVPPDADKVDGSSVKVKYLSKWPI-NHALESTGEGGDFQ  307302

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W Q++  AR  L+ T W +         +P+ DG FE  L K WPF
Sbjct  307303  DLIMWTQMTDAAREGLSKTGWGKA-------NVPMVDGNFEAKLGKAWPF  307431

 Score = 184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 135/233 (58%), Gaps = 30/233 (13%)
 Frame = +3

Query  22      IGHDQVRPFP--QPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
               I +D+V PFP  QP   TV++K A+KF+P+LK+  GCHPYPAV   G +S GL+ + P  
Sbjct  273810  IAYDKVVPFPMAQPSESTVTEKAAIKFRPKLKVVNGCHPYPAVNAAGQVSNGLEVADPTG  273989

Query  80      GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                 C GS+LG+Q+Y RSAW   VWAIMYAWYFP   A               +WE+V+VW 
Sbjct  273990  AACKGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVTA---------------DWEHVIVWT  274124

Query  140     DNPGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
               +NP + N  VL V+ S S  GY+ Q P D   + G SVKV+Y       N  L+ T + G
Sbjct  274125  NNPNVTNQVVLAVTTSNSKGGYTSQVPPDATMMSGKSVKVSY------NNNGLESTTEEG  274286

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 Q+LI W QL++ A+ +LN    DQ      G+++P+ D  F   L K WPF
Sbjct  274287  GAQNLILWHQLTAAAQEALND---DQ---NFDGVQVPVNDDYFLLNLGKAWPF  274427

 Score = 166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/275 (39%), Positives = 138/275 (50%), Gaps = 63/275 (23%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QPDPVTVS+K A+K+KPQL I  GC  +PAV   G ++GGLK +   DG 
Sbjct  384800  IDHDKVQPFKQPDPVTVSEKAALKYKPQLVIGGGCVSFPAVNAAGDITGGLKGTKSTDG-  384976

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG----HRHNWEYVVV  137
               CT + LGSQ Y RS W  D WA+M+AWYFPK            F+G     RH W  +VV
Sbjct  384977  CTEAPLGSQAYGRSTWYQDKWAMMFAWYFPK-----------NFWGGGADSRHLWSNMVV  385123

Query  138     WIDNPGLENATVLGVSMSAS------------IGYSKQAP----TDVKYVD---------  172
               WIDNP LE   +LGVS+S              +   ++ P    T +K +D         
Sbjct  385124  WIDNPSLETPKILGVSLSQQTIDVPKLFYMFPLVNRQKVPYKKVTAIKPMDFAGMQAIKT  385303

Query  173     GTSVKVAYYYNHLLGNT----------------ALQLTEDTGEFQDLIQWDQLSSLARYS  216
               G   +  Y YN+  G+T                 L      GE+QDLI W+QL+  AR +
Sbjct  385304  GRIGRHRYTYNYTGGSTTSTRVYNGYTDQSGWHGLDFVNADGEYQDLIMWNQLTDQARSA  385483

Query  217     LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               L   D+ +        K+P  D  FE  L + WPF
Sbjct  385484  LESADFGEK------TKVPFDDKNFEAALTQAWPF  385570

 Score = 162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/275 (37%), Positives = 140/275 (51%), Gaps = 63/275 (23%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QPDPVTVS+K A+K+KPQL +   C  +PAV   G ++GGLK +   +G 
Sbjct  383309  IDHDKVQPFKQPDPVTVSEKAALKYKPQLAVYGTCVSFPAVNAAGEITGGLKGTKGTEG-  383485

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG----HRHNWEYVVV  137
               CT + LGSQ+Y RSAW  D WA+M+AWYFPK            F+G     RH W  +V+
Sbjct  383486  CTEAPLGSQVYGRSAWYQDKWAMMFAWYFPK-----------NFWGGGADSRHLWSNMVL  383632

Query  138     WIDNPGLENATVLGVSMSAS-------------IGYSKQAPTDVKYV------------D  172
               W+DNP LE   +LG S+S               +   K   T V  V             
Sbjct  383633  WLDNPALETPKILGASLSRQTLDVPKILFVLPLVDRQKDPYTKVTAVPPMGFVGMQAIQT  383812

Query  173     GTSVKVAYYYNHLLG-NTALQLTED---------------TGEFQDLIQWDQLSSLARYS  216
               G   +  Y YN+  G NT+ ++++                 GE+QDLI W+QL+  AR +
Sbjct  383813  GRISRFTYTYNYTGGSNTSTRVSQGYPDSSSWIGLTFATRDGEYQDLIMWNQLTDQARAA  383992

Query  217     LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               L   D+ +       +K+P  D  FE  L++ WPF
Sbjct  383993  LESADFGK------DMKVPFNDENFETALEQAWPF  384079

>PHPA:scaffold_15 NW_008649001.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.15, whole genome shotgun 
sequence
Length=1176021

 Score = 231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V PF QP+PVT+++K A+KFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  123586  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAG  123765

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  123766  CKGSGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  123924

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L V+ SA  GYS Q P D   VDG SVKV Y     + N AL+ T + G++Q
Sbjct  123925  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGNSVKVKYLSKWPI-NHALESTGEAGDYQ  124101

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+QL+  AR +L +T       G     +P+KDG F   LDK WPF
Sbjct  124102  DLIMWEQLTDAARLALQNT-------GFGKANVPMKDGNFVSKLDKAWPF  124230

 Score = 225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = -2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD V PF QP+PVT+S+K A+KFKPQL I  GCH YPAV   G  SGGLK SG     
Sbjct  62756  IDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPSAG  62577

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  62576  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  62418

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +    +L V+ SA  GYS Q P D   VDGTSVKV Y     + N AL+ T + G++Q
Sbjct  62417  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGTSVKVKYLSKWPI-NHALESTGEGGDYQ  62241

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI W Q++  AR +L+     +T FG A   +P+ DG FE  L K WPF
Sbjct  62240  DLIMWGQMTDAAREALS-----RTSFGDA--NVPMNDGNFEPKLGKAWPF  62112

 Score = 187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 136/233 (58%), Gaps = 30/233 (13%)
 Frame = +3

Query  22     IGHDQVRPF--PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
              I +DQV PF   QP   TV++K A+KF+P+L +  GCHPYPAV   G +S GL+ +   D
Sbjct  37254  IAYDQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKADATD  37433

Query  80     GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
               EC+GS+LG+Q+Y RSAW   VWAIMYAWYFP      V PD          WE+V+VW 
Sbjct  37434  AECSGSKLGTQVYGRSAWFGRVWAIMYAWYFPD-----VSPD----------WEHVIVWT  37568

Query  140    DNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
              +NP + N  +L V+ S S G YS Q P D   + G SVK+AY       N AL+ T   G
Sbjct  37569  NNPNVTNQVILAVTTSDSTGKYSSQVPPDASMISGKSVKIAY------NNNALESTTKEG  37730

Query  199    EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                Q+L+ W QL+  A+ +LN    D   FG  G+++P+ D  F   L K WPF
Sbjct  37731  GAQNLVLWHQLTPEAQEALN----DDQSFG--GVQVPVNDDYFLLNLGKAWPF  37871

>PHPA:scaffold_68 NW_008649054.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.68, whole genome shotgun 
sequence
Length=307006

 Score = 231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 146/230 (63%), Gaps = 15/230 (7%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PF QP+PVT+S+K AVKFKPQL I  GCHPYPAV   G   GGLK +G   G 
Sbjct  90380  IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGAPSGS  90559

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   ++         GHRH+WE VV+WI+N
Sbjct  90560  CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSSS-------LGHRHDWENVVIWINN  90718

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P + N  +L +  SA  GYS+ AP D   +DGTS KV  Y +H   N A   T + G+FQ
Sbjct  90719  PDVPNPVILAICPSAHGGYSRYAPPDADTIDGTSAKVN-YESHWPINHATDTTSEGGDFQ  90895

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI WDQL+  AR +L  TD     FG A   +P+K+G F   L+K WPF
Sbjct  90896  DLIMWDQLTDAARTALQDTD-----FGDA--NVPMKEGSFLSNLEKAWPF  91024

 Score = 184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 142/247 (57%), Gaps = 31/247 (13%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD++ PFPQP+P T+S+K AVKFKPQL   ++ C PYPAV   G ++GGLK +   D 
Sbjct  229050  VDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPYPAVNVAGEVAGGLKGTNGNDA  229229

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  +  GSQIY R+ W ND+WAIMYAWYFPKG     P         RH+W+ VVVWID
Sbjct  229230  -CKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKGFWMDSP-------SRRHDWKSVVVWID  229385

Query  141     NPGLENATVLGVSMSAS-IGYSKQAPT---------------DVKYVDGTSVKVAYYYNH  184
               NP  +   ++GVSMS S   Y+K+  T                  Y+ G++  + + Y  
Sbjct  229386  NPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEGRRYHRTYIYGSNTSLRFQYQS  229565

Query  185     LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                LG+  L   +  GE+QDLI W+QL+  AR +LN    D   FG A  ++P  D  +E+ 
Sbjct  229566  DLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALN----DGNNFGDA--EVPFSDEHYEKH  229727

Query  245     LDKTWPF  251
               LDK WPF
Sbjct  229728  LDKAWPF  229748

 Score = 125 bits (314),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 109/195 (56%), Gaps = 25/195 (13%)
 Frame = -2

Query  59      YPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATV  118
               +PAV   G ++GGLK +   D  C  +  GSQ+Y+ + W  DV AIMYAWYFPKG     
Sbjct  243285  FPAVNAAGEVTGGLKGTNVNDA-CKYAPKGSQVYSPAGWYKDV*AIMYAWYFPKGF----  243121

Query  119     PPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTS--V  176
                  ++ F   RH+W+ VVVWIDNP LE   ++GVS S S         D KY +     +
Sbjct  243120  ---WIDFPTRRHDWKSVVVWIDNPDLETPKIVGVSRSKS---------DTKYYNEARSIL  242977

Query  177     KVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPL  236
                + ++Y   L +  ++L  + GE+QDL+ W+QL+  AR +LN+ D     FG A  ++P 
Sbjct  242976  FLRFHYQITLASPYMRLAMENGEYQDLVMWEQLTDAARAALNNGD----SFGKA--EVPF  242815

Query  237     KDGVFEELLDKTWPF  251
                D  FE+ L + WP 
Sbjct  242814  SDEHFEDHLAEAWPL  242770

 Score = 51.6 bits (122),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQL  50
               M  RA      A+L    +  + HD++ P PQP+PVT+S+K A+KFKPQL
Sbjct  243460  MKLRAFATTLFAALIACASATVDHDKIEPIPQPEPVTISEKAAIKFKPQL  243311

>PHRA:scaffold_12
Length=689251

 Score = 228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 151/249 (61%), Gaps = 15/249 (6%)
 Frame = -2

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN R + V+A   L      VI HD V PF QP P +VSQ  AV FKPQL I  GCHPYP
Sbjct  608427  MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYP  608248

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV  DG+ SGGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A+   
Sbjct  608247  AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---  608077

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                    FGHRH+WE++VVW++NP + +  +L VS SA  GY+   P D+ Y+DG S K+  
Sbjct  608076  ----GFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDLDYLDGNSAKID-  607912

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
               YY+ LL N A ++T DTGE QDLI WDQL+  AR +L  TD     FG A   +P KD  
Sbjct  607911  YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDTN  607753

Query  241     FEELLDKTW  249
               FE  L   W
Sbjct  607752  FETKLANAW  607726

 Score = 211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 138/230 (60%), Gaps = 15/230 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF +P PVT+S+K  VKFKPQL I  GCH YPAV + G   GGLK SG    +
Sbjct  604197  ISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSSK  604376

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIY RS W +DVWAIMYAWYFPK  A+T         GHRH+WE+ V+WIDN
Sbjct  604377  CKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMASTT-------LGHRHDWEHAVIWIDN  604535

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +LGVS+S+  GY+K     V  + GT+V + Y     L +  L LT   G+ Q
Sbjct  604536  PDVAEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPL-DHELSLTTKGGDLQ  604712

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                LI W QL+  AR SL+ TD+   L       MP+ D  F   L+K WPF
Sbjct  604713  PLIMWSQLTDAARNSLSTTDFGSAL-------MPMTDFWFTSKLEKAWPF  604841

 Score = 184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 141/241 (59%), Gaps = 14/241 (6%)
 Frame = -1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN +A+   A+A+LA AQA VI HDQV PF QP P T  Q  AV FKPQ+ I+ GCHPYP
Sbjct  605620  MNLQAIAAVALATLAGAQAAVIDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYP  605441

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV +DG+ SGGLK +G Q   C GS  GSQIY R+     V+A MY+WY PK        
Sbjct  605440  AVDEDGNTSGGLKPTGSQSAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-----  605276

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                 L   GHRH+WE  VVW+D+  L+   ++ +S S    Y    P D  Y+DG S K+ Y
Sbjct  605275  --LPGLGHRHDWENCVVWLDDITLDEPNIVALSASYHSTYLYYYPPDSDYLDGNSAKIEY  605102

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                 + ++ + +L  T  +GE QDLI W QL+  AR +L  TD     FG A   +P K+G 
Sbjct  605101  STSWVILDHSLSATSTSGETQDLIMWGQLTDAARTALEDTD-----FGSA--NVPFKEGN  604943

Query  241     F  241
               F
Sbjct  604942  F  604940

 Score = 181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 149/249 (60%), Gaps = 14/249 (6%)
 Frame = -3

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN R  FVAA  SLA AQA VI HDQV PF QP P T  Q   +KFKPQ+ I  GCHPYP
Sbjct  612050  MNLRDFFVAAAVSLAFAQADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYP  611871

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV + G+ SGGLK +G     C GS  GSQIY R      V+A+MY+WYFPK    T   
Sbjct  611870  AVDEAGNTSGGLKPTGSSSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDSPVT---  611700

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                     GHRH+WE+VVVW+D+  L++ +++ VS SA  GY+   P +   +DG S KV Y
Sbjct  611699  ----GLGHRHDWEHVVVWVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDY  611532

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                 + ++ N AL  T D+GE QDLI W QL+  AR +L +TD     FG A   +P+KDG 
Sbjct  611531  SSSWVVVNHALDSTSDSGESQDLIMWGQLTDAARTALGNTD-----FGDA--HVPMKDGN  611373

Query  241     FEELLDKTW  249
               F   L   +
Sbjct  611372  FLTKLGNAY  611346

 Score = 177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 131/228 (57%), Gaps = 14/228 (6%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V PF QP P T  Q  AVKFKPQ+ I+ GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  602689  IDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSSG  602868

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CTGS LGSQIY R+     V+A MY+WY PK          L   GHRH+WE  VVW+D+
Sbjct  602869  CTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDET-------LDGVGHRHDWENCVVWLDD  603027

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 L+   ++ +S S    Y    P D  Y+DG S K+ Y  + +L + +L  T  +GE Q
Sbjct  603028  ITLDEPNIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVLLDHSLSATSTSGETQ  603207

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               DLI WDQL+  AR +L  TD     FG A   +P K+  FE  L   +
Sbjct  603208  DLIMWDQLTDAARTALEDTD-----FGDA--NVPFKEANFETKLANAY  603330

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -3

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN R +  A +ASLA  Q  VI HD V PF QP P T  Q  A+KFKPQ+ I+ GCHPYP
Sbjct  606929  MNLRHLAFAGLASLAGVQGAVIAHDAVVPFAQPTPTTTLQTVALKFKPQIYINNGCHPYP  606750

Query  61      AVQKDGSMSGGLKWSGPQ  78
                V +DG+ SGGL  +G +
Sbjct  606749  VVDEDGNTSGGLAPTGSE  606696

>PHSO:scaffold_6
Length=4785000

 Score = 227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 147/230 (64%), Gaps = 15/230 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFPQPDPVT+S+K AVKFKPQ+ I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  275565  IGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQTSGSPRGG  275386

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+N VWAIMY+WYFPK   ++         GHRH+WE+VVV+IDN
Sbjct  275385  CRGSGHGSQVYGRSTWINGVWAIMYSWYFPKDAPSSK-------MGHRHDWEHVVVFIDN  275227

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +LG S S   GY+K AP     +DGTSVKV Y ++  L N AL+ T   G FQ
Sbjct  275226  PDVPEPKILGCSPSWHNGYNKYAPCPANVIDGTSVKVKYEHSWPL-NHALETTTKPGAFQ  275050

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+Q++  AR +LN      T FG A    P+ D  F   ++K WPF
Sbjct  275049  DLIMWNQMTDFARRALN-----DTKFGKAN--TPMNDWNFLPKVEKAWPF  274921

 Score = 223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PFPQP+PVT+S+K A+KFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  288983  INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQTSGSPKGG  289162

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y R+ W NDVWAIMY+WYFPK   ++         GHRH+WE+VVVWI+N
Sbjct  289163  CRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDSPSSR-------MGHRHDWEHVVVWINN  289321

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +LG+S SA  GY K +    + +DG SVKV Y +   + N AL  T+  G FQ
Sbjct  289322  PDVPEPKILGISASAHSGYKKYSSPPPENLDGNSVKVNYEHAWPI-NHALDTTDKAGTFQ  289498

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+Q++  AR +LN        FG A    P+ DG F   L++ WPF
Sbjct  289499  DLIMWEQMTEDARRALN-----AVHFGKAN--TPMNDGNFRHKLERAWPF  289627

 Score = 171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 137/242 (57%), Gaps = 27/242 (11%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +D+V+PFP+ +P T+S+K A+K+KP L I  GC  Y AV   G  SGG+    P  G 
Sbjct  1920827  IDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAPDGGT  1920648

Query  82       ---------CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA---ATVPPDFLRFFGHR  129
                         C GS LGSQ+Y+RS W  DVWAIMYAWYFP+  +   A+ PP        R
Sbjct  1920647  VEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEASYPP-------VR  1920489

Query  130      HNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
                H+W   +VW++NP LEN ++LGVS S     Y    PT  ++++GT  K+ Y+    +G 
Sbjct  1920488  HDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVGG  1920309

Query  189      -TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
                   + ++ D G+FQDL+ W QL+  AR +L   D     FG+    +P  D  FE+ L++
Sbjct  1920308  YHTIDVSLDAGDFQDLVHWSQLTDQARKALETAD-----FGVV-TPVPFNDVNFEKNLER  1920147

Query  248      TW  249
                 W
Sbjct  1920146  GW  1920141

 Score = 169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 137/242 (57%), Gaps = 27/242 (11%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +D+V+PFP+ +P T+S+K A+K+KP L I  GC  Y AV   G  SGG+    P  G 
Sbjct  1954866  IDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAPDGGT  1955045

Query  82       ---------CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA---ATVPPDFLRFFGHR  129
                         C GS LGSQ+Y+RS W  DVWAIMYAWYFP+  +   A+ PP        R
Sbjct  1955046  VEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWDEASYPP-------VR  1955204

Query  130      HNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
                H+W   +VW++NP LEN ++LGVS S     Y    PT  ++++GT  K+ Y+    +G 
Sbjct  1955205  HDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVGG  1955384

Query  189      -TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
                   + ++ + G+FQDL+ W QL+  AR +L   D     FG+    +P  D  FE+ L++
Sbjct  1955385  YHTIDVSLEAGDFQDLVHWSQLTDQARKALETAD-----FGVV-TPVPFNDVNFEKNLER  1955546

Query  248      TW  249
                 W
Sbjct  1955547  GW  1955552

 Score = 147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 106/194 (55%), Gaps = 15/194 (8%)
 Frame = -3

Query  58      PYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAAT  117
               P P  ++      GL+ SG  +G C GS  GS +Y R+ W NDVWAIMY W+FPK   ++
Sbjct  321376  PVPRCEQYRRDQCGLQTSGSPEGGCRGSGHGSHVYGRAGWHNDVWAIMYCWFFPKDSPSS  321197

Query  118     VPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVK  177
                        GHR +WE+VVV IDNP +    +LG+S S   GY K AP   + +DG SVK
Sbjct  321196  R-------MGHRFHWEHVVV*IDNPDVPEPKILGISASTHDGYKKYAPLHPENLDGNSVK  321038

Query  178     VAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLK  237
               V Y  +  + N AL  T+  G FQDLI W+Q++  AR +LN           +    P+ 
Sbjct  321037  VNYEMDWPI-NHALDTTDKAGTFQDLIMWEQMTEDARRALN-------AVSFSKANTPMN  320882

Query  238     DGVFEELLDKTWPF  251
               DG F   LD+ WPF
Sbjct  320881  DGNFRPKLDRAWPF  320840

 Score = 107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 82/136 (60%), Gaps = 14/136 (10%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP PVT+S+K AVK+KPQL     C  +PAV   G ++GGLK +  + G 
Sbjct  2908765  IIHDQVKPFAQPVPVTISEKAAVKYKPQLFTYDRCESFPAVNAAGEVTGGLKGTKGKKGC  2908944

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFP---KGRAATVPPDFLRFFGHRHNWEYVVVW  138
                    R GSQ+Y RS W  D W +M+AWYF    KG A+            RH+W  +V+W
Sbjct  2908945  EKAPR-GSQVYGRSGWYQDKWPMMFAWYFQKNVKGHASK----------KRHDWANMVLW  2909091

Query  139      IDNPGLENATVLGVSM  154
                IDNP LE + +LG S+
Sbjct  2909092  IDNPALETSKILGASL  2909139

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKW-SGPQDG  80
               I HD+V+PFPQP+PVT+S+K A+KFKPQ++I +GC PYP V   G  S   +    P++G
Sbjct  321483  INHDEVKPFPQPEPVTISEKAAIKFKPQIRIGSGCVPYPVVSSIGETSAAFRLQEAPKEG  321304

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 29/128 (23%)
 Frame = +1

Query  31       PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQ  90
                P+P P + +  TA       KI   C  +PAV   G  SGGL+ +  +DG C  + LG+Q
Sbjct  2918962  PKP-PASATSSTAC-----AKIRMLCDSFPAVNAAGETSGGLEGTDGKDG-CEKAPLGTQ  2919120

Query  91       IYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH----RHNWEYVVVWIDNPGLEN  146
                +Y R  +  +        YF K            F GH    RH+W  +V+WIDNP LE 
Sbjct  2919121  VYDRDGFKTN-------GYFLKN-----------FKGHASKKRHDWANMVLWIDNPALET  2919246

Query  147      ATVLGVSM  154
                + +LG S+
Sbjct  2919247  SKILGASL  2919270

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 7/61 (11%)
 Frame = +3

Query  191      LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                L++    G+ QDLI W+QL+  AR  LN  D++ T       K+P  D  F+E L + +P
Sbjct  2909346  LEVAYADGKSQDLIMWEQLTDAARECLNSADFEDT-------KVPFNDKNFQESLKQAYP  2909504

Query  251      F  251
                F
Sbjct  2909505  F  2909507

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 7/61 (11%)
 Frame = +3

Query  191      LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                L++    G+ QDLI W+QL+  AR  LN  D++ T       K+P  D  F+E L + +P
Sbjct  2919477  LEVAYADGKSQDLIMWEQLTDAARECLNSADFEDT-------KVPFNDKNFQESLKQAYP  2919635

Query  251      F  251
                F
Sbjct  2919636  F  2919638

>PHRA:scaffold_846
Length=8447

 Score = 226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 150/249 (60%), Gaps = 15/249 (6%)
 Frame = -1

Query  1    MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
            MN R + V+A   L      VI HD V PF QP P +VSQ  AV FKPQL I  GCHPYP
Sbjct  716  MNLRGLLVSAAVGLTAIYGAVIDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYP  537

Query  61   AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
            AV  DG+ SGGL  +G     C GS  GSQIY RS W N VWAIMY+WYFPK   A+   
Sbjct  536  AVDADGNTSGGLNPTGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPAS---  366

Query  121  DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                 FGHRH+WE++VVW++NP + +  +L VS SA  GY+   P D  Y+DG S K+  
Sbjct  365  ----GFGHRHDWEHIVVWLNNPAVSSPEILAVSTSAHSGYTFYYPPDSDYLDGNSAKID-  201

Query  181  YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
            YY+ LL N A ++T DTGE QDLI WDQL+  AR +L  TD     FG A   +P KD  
Sbjct  200  YYSVLLINHAFRMTSDTGETQDLIMWDQLTDAARTALEDTD-----FGDA--NVPFKDTN  42

Query  241  FEELLDKTW  249
            FE  L   W
Sbjct  41   FETKLANAW  15

>PHIF:NW_003303758.1 Phytophthora infestans T30-4 supercont1.1 
genomic scaffold, whole genome shotgun sequence
Length=6928287

 Score = 226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD V PF Q +PVT+S+K AVKFKPQL I  GCHPYPAV   G  SGGLK SG     
Sbjct  4076530  IDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPSAG  4076351

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  4076350  CKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  4076192

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P L    +L VS SA  GYS Q P D   V+GTSVKV Y     + N AL+ T + G++Q
Sbjct  4076191  PELAEPKILAVSPSAHGGYSAQVPPDANKVEGTSVKVKYLSKWPI-NHALESTGEGGDYQ  4076015

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W Q++  AR  L+ T       G     +P+ DG FE  L + WPF
Sbjct  4076014  DLIMWGQMTDAAREGLSRT-------GFGKANVPMNDGNFESKLGRAWPF  4075886

 Score = 176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 130/229 (57%), Gaps = 18/229 (8%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QP P+T  +K AVKFKP L + +GCHPYPAV   G  S GLK +G  DG 
Sbjct  5656226  IDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGTGEPDGG  5656047

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS W    WAIMYAWYFPK     +    L   G RH+W  VVVW++N
Sbjct  5656046  CEGSELGSQVYSRSTWYEGRWAIMYAWYFPK----DIQNGGLAKKGIRHDWVNVVVWLNN  5655879

Query  142      PGLENATVLGVSMS--ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLG---NTALQLTED  196
                P +   T+L  S S   +     + P     +DG + K+   Y+   G   +T  Q   +
Sbjct  5655878  PAVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKL--RYDEEGGEEWHTIFQFYGE  5655705

Query  197      TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                 GEFQDLIQWDQL+  AR +L +TD+         + +P  D  FE  L
Sbjct  5655704  -GEFQDLIQWDQLTDAAREALQNTDFGDY------VNVPFNDAYFETNL  5655579

 Score = 174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 132/233 (57%), Gaps = 32/233 (14%)
 Frame = +2

Query  22       IGHDQVRPF--PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
                I +D+V PF   QP   T+++K A+KF+P+L +  GCHPYPAV   G +S GL+     D
Sbjct  4123229  IAYDKVEPFEMAQPSDSTITEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKD--DD  4123402

Query  80       GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                  C GS+LG+Q+Y RSAW   VWAIMYAWYFP      V PD          WE+V+VW 
Sbjct  4123403  AACRGSKLGTQVYGRSAWFGRVWAIMYAWYFPD-----VTPD----------WEHVIVWT  4123537

Query  140      DNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
                +NP + N  +L V+ S S G YS Q P D   V G SVK+ Y  N      AL+ T   G
Sbjct  4123538  NNPNVTNQVILAVTTSDSTGKYSSQVPPDASTVSGKSVKINYVDN------ALESTTKEG  4123699

Query  199      EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                  Q+L+ W QL+  A+ +LN    D   FG  G+++P+ D  F   L K WPF
Sbjct  4123700  GAQNLVLWHQLTPEAQEALN----DDQSFG--GVQVPINDDYFLLNLGKAWPF  4123840

>PHKE:scaffold_89 scf_22126_89.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_89.1:1:108404:1 
REF
Length=108404

 Score = 226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 143/234 (61%), Gaps = 23/234 (10%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I H +V+PFPQP+P+T+S++ AVKFKPQL I  GCH YPAV   G  SGGLK +G   G+
Sbjct  46026  ISHSEVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLKTTGAPSGK  46205

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +T         GHRH+WE+V++WI+N
Sbjct  46206  CKGSGYGSQVYGRSGWHKDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWINN  46364

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDT  197
              P + +  +L V+ SA  GYS  AP     +DG + KV Y      NH LG     +T   
Sbjct  46365  PEVADPKILAVTPSAHSGYSTYAPPPADSMDGVAAKVNYESFWPVNHALG-----MTTKG  46529

Query  198    GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              G+FQDLI WDQL+  AR +LN  +W           +P+ DG F   LDK WPF
Sbjct  46530  GDFQDLIMWDQLTDNARRALNEVNW-------GAANVPMNDGNFGGKLDKAWPF  46670

 Score = 148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 133/252 (53%), Gaps = 19/252 (8%)
 Frame = -3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MN R + VA    LA  QA+ + +D V PFP+    T     A+KFKPQL I +GC+PYP
Sbjct  48600  MNLRTLAVAVAGLLAFTQAKKLAYDSVIPFPETKATTTEYAIALKFKPQLYIASGCYPYP  48421

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              A+   G+ + GL  S     +C GS  G Q+Y RS    D WAIMYAWYFP+ R  T   
Sbjct  48420  AIDSAGNTNAGL--SVLSLKKCGGSLDGPQVYGRSVLYKDAWAIMYAWYFPRDRVVT---  48256

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVA  179
                    G RH WE+V+VW++  G     ++ VS S+    Y    P D   VDG S K+ 
Sbjct  48255  -----GGQRHAWEHVIVWVEKSGSGKTKLVSVSASSRANKYLSATPPDPDTVDGNSPKLV  48091

Query  180    YYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDG  239
              Y +  LL +  L  T ++G+FQ L+ WD ++  A  +L+  DW ++        +PL + 
Sbjct  48090  YDHKGLLKHY-LNATTESGDFQPLVMWDDMTDAACVALDTYDWGKS-------TVPLNEE  47935

Query  240    VFEELLDKTWPF  251
               F + +   +P+
Sbjct  47934  NFLDNIGNAYPW  47899

 Score = 107 bits (266),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 75/127 (59%), Gaps = 10/127 (8%)
 Frame = -3

Query  27     VRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWS----GPQDGEC  82
              + PFPQ +  T     A+K+KPQL +   C+P+PAV  DG+ + GL  S     P  G  
Sbjct  43098  IAPFPQTEETTKEYAAALKYKPQLYVCNDCYPHPAVDADGNTNAGLTASTWYWSPSCGSI  42919

Query  83     TGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
              +G+R GSQ+Y+R+   ND+W IM+ WYFPK     +P     +FGHRH W+  +VW+ N 
Sbjct  42918  SGTRQGSQVYSRATKYNDIWTIMHTWYFPKD-TERIP----FYFGHRHRWKNAIVWL-NK  42757

Query  143    GLENATV  149
                +N T+
Sbjct  42756  LFDNTTI  42736

 Score = 37.0 bits (84),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 29/56 (52%), Gaps = 3/56 (5%)
 Frame = -1

Query  160    YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA-LQLTEDTGEFQDLIQWDQLSSLAR  214
              Y    P  V  + G+SVK+ Y  N   G T  L+ T   G FQDL+ WD + +L +
Sbjct  42704  YPTYTPLGVNMISGSSVKILYMNNA--GTTHYLKATTSPGRFQDLVMWDGIPNLLQ  42543

>PHKE:scaffold_893 scf_22126_893.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_893.1_contig_1:1:6146:1 
REF
Length=6146

 Score = 221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 141/230 (61%), Gaps = 15/230 (7%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I H +V PFPQP+PVT+S+K AVKFKPQL I  GCH YPAV   G  SGGLK +G    +
Sbjct  1301  ISHSEV*PFPQPEPVTISEKAAVKFKPQLHISNGCHAYPAVNAAGETSGGLKPTGAPSSK  1122

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C G   GSQ+YARS W   VWAIMY+WYFPK   +T         GHRH+WE+V+VWIDN
Sbjct  1121  CKGHGYGSQVYARSGWQRSVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  963

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P + N  +L V+ SA  GYSK  P+    +DG + K+  Y +H   N AL +T   G+FQ
Sbjct  962   PDVANPKILAVTPSAHSGYSKHVPSPADSIDGVTAKIN-YESHWPINHALGMTTKGGDFQ  786

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI W Q++  AR +LN   W           +P+ D  +++ L+K WPF
Sbjct  785   DLIMWHQMTDNARRALNEVSW-------GAANVPMSDWNYQKKLEKAWPF  657

>PHPA:scaffold_65 NW_008649051.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.65, whole genome shotgun 
sequence
Length=321898

 Score = 221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 158/237 (67%), Gaps = 11/237 (5%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF + +P T S+K+A+K+KPQL I  GC+PYPAVQ +G++SGGLKWSG  + +
Sbjct  276092  INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSD  276271

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C     GSQIY+RS W    WAIMYAWYFPKG  A     + R  GHRH W   +VW DN
Sbjct  276272  CEKPVQGSQIYSRSDWYKGKWAIMYAWYFPKG--AFRASKYNR--GHRHFWSSAIVWTDN  276439

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                  +N+T+LGVSMS S GY K+     KY++ GT++K+  Y    L N AL+LT+ +G  
Sbjct  276440  TNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGT  276619

Query  201     QDLIQWDQLSSLARYSLNHTDWD----QTLFGLAG--LKMPLKDGVFEELLDKTWPF  251
               QDL+ W+QL+  AR +L+  D+D      +F  +G  + MPL+DGVF  +L++++PF
Sbjct  276620  QDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  276790

>PHPA:scaffold_11 NW_008648997.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.11, whole genome shotgun 
sequence
Length=1562868

 Score = 220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 148/230 (64%), Gaps = 15/230 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I H +V+PF +P PVT+S+K  VKFKPQ+ +  GC PYPAV +DG  SGGL+ SG   G 
Sbjct  231009  ISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQTSGSPQGG  230830

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W N +WAIMY+WYFPK   ++         GHRH+WE++VV+IDN
Sbjct  230829  CRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKDAPSSR-------MGHRHDWEHIVVFIDN  230671

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +LG S S   GY+K AP     +DG+SVKV Y ++  L N AL +T++ G+FQ
Sbjct  230670  PEVPEPKILGCSPSWHSGYNKYAPCPADVIDGSSVKVKYEHSWPL-NHALDITKEAGDFQ  230494

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ+S LAR +LN T      FG A    P+ D  F   ++K+WPF
Sbjct  230493  DLIMWDQMSDLARRALNDTK-----FGKAN--TPMNDWNFLGKVEKSWPF  230365

 Score = 213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 141/230 (61%), Gaps = 15/230 (7%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                IGHD+++PFPQPDPVT+S+K  VKFKPQ++I  GC PYP V + G  SGGL+ SG   G 
Sbjct  1024302  IGHDEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQTSGSPRGG  1024481

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RSAW+N  WAIMY+WYFPK   ++         GHRH+WE+ VV+IDN
Sbjct  1024482  CRGSVHGSQVYGRSAWINGFWAIMYSWYFPKDSPSSR-------MGHRHDWEFAVVFIDN  1024640

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                PG+    ++G S+S+  G  K  P     +DG S+KV Y +   + N  L +T D G FQ
Sbjct  1024641  PGIPEPKIIGCSVSSHDGRKKYNPCPSWVIDGNSLKVRYKHAWPM-NHDLDVTGDAGTFQ  1024817

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQ++  AR +LN        FG A    P  DG F   L+  W F
Sbjct  1024818  DLIMWDQMTDDARRALNSVS-----FGKA--NTPFNDGKFLPTLESAWAF  1024946

>PHKE:scaffold_527 scf_22126_527.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_527.1:1:20712:1 
REF
Length=20712

 Score = 219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 138/224 (62%), Gaps = 15/224 (7%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD V PF QP P +VSQ  AV FKPQL I  GCHPYPAV  DG+ SGGL  +G     
Sbjct  16519  ISHDAVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSSAG  16698

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQIY RS W N VWAIMY+WYFPK          L  FGHRH+WE++VVW++N
Sbjct  16699  CKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSP-------LTGFGHRHDWEHIVVWLNN  16857

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P + +  +L VS SA  GY+   P D  Y+DG S K+  YY+ LL N A ++T D GE Q
Sbjct  16858  PAITSPEILAVSTSAHSGYTVYYPPDSDYLDGNSAKID-YYSVLLINHAFRMTSDAGETQ  17034

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
              DLI WDQL+  A+ +L  TD     FG A   +P KD  FE  L
Sbjct  17035  DLIMWDQLTDAAQTALEDTD-----FGDA--NVPFKDANFETKL  17145

 Score = 216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 141/230 (61%), Gaps = 14/230 (6%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV+PFPQ    +++   A+K+KPQ+ I+ GCHPYPAV  +G  SGGLK  G     
Sbjct  6340  IDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGSGSAG  6519

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQ+Y RS W N VWAIMY+WYFPK          +   GHRH+WE+V+VWIDN
Sbjct  6520  CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDSP-------VSGMGHRHDWEHVIVWIDN  6678

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P   N T+L ++ SA  GYS  AP     VDG SVKV Y   +L+ N  L+ T   GE Q
Sbjct  6679  PENVNGTILAMTPSAHSGYSTYAPPPADMVDGASVKVEYTSTYLVINHHLEGTSTAGEMQ  6858

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI W  ++  ARY+LN TD     FG A   +P+KDG F   L+K +P+
Sbjct  6859  DLIMWGDMTDAARYALNTTD-----FGNA--NVPMKDGNFLPKLEKAYPW  6987

 Score = 214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 140/230 (61%), Gaps = 14/230 (6%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV+PFPQ   ++++   A+KFKPQ+ I+ GCHPYPAV  +G  SGGLK  G     
Sbjct  4744  INHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLKTHGSSSAG  4923

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQ+Y RS W N VWAIMY+WYFPK      P DF    GHRH+WE+VVVWIDN
Sbjct  4924  CRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDE----PQDFT---GHRHDWEHVVVWIDN  5082

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P   N  +L ++ SA  GYS  AP D   +DGTSVKV Y  + L  +  L+ T   GE Q
Sbjct  5083  PQNVNPRILAMTPSAHSGYSTYAPPDADMIDGTSVKVEYTSSWLFIDHHLEGTSTAGEMQ  5262

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI W  ++  AR SLN        FG A   +P+ DG F+  L K +P+
Sbjct  5263  DLIMWSDMTDAARNSLNTVS-----FGKA--NVPMNDGNFQSKLGKAYPW  5391

 Score = 211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 143/230 (62%), Gaps = 15/230 (7%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQ++PF QP+P T+S+K AVKFKPQL +  GCH YPAV + G  SG LK SG     
Sbjct  8608  ISHDQIKPFVQPEPATISEKAAVKFKPQLHVTNGCHLYPAVNEAGETSGRLKTSGAPSAG  8429

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               GS  GSQ+Y R AW +DVWAI+Y+WYFPK   +T          HRH+WE++VVWIDN
Sbjct  8428  YKGSGWGSQVYGRFAWHSDVWAIIYSWYFPKDSPST-------GLIHRHDWEHIVVWIDN  8270

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P + N  +L VS SA  GYSK AP +   +DG SVK+ Y  ++ + N AL +T   G+FQ
Sbjct  8269  PDVANPRILAVSPSAHSGYSKYAPPNANNLDGNSVKINYESSYPM-NHALGVTTKEGDFQ  8093

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI WDQ+S L R +LN T      FG A +  P+ D  F   L K W F
Sbjct  8092  DLIMWDQMSDLTRKALNDTS-----FGDANV--PMNDCNFLGKLQKAWSF  7964

 Score = 203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 151/249 (61%), Gaps = 14/249 (6%)
 Frame = +3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MN RA FVAA+ASLA AQA VI HDQV PF QP   T  Q   +KFKPQ+ I  GCHPYP
Sbjct  12948  MNLRAFFVAAVASLACAQADVISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHPYP  13127

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              AV KDG+ SGGLK +G     C GS  GSQIY R      V+AIMY+WYFPK    T   
Sbjct  13128  AVNKDGNTSGGLKPTGSASAGCKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDSPIT---  13298

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                    GHRH+WE+V+VW+D+  L N +++ VS SA  GY+   P     +DG S KV Y
Sbjct  13299  ----GLGHRHDWEHVIVWVDDITLTNPSIVAVSPSAHSGYNIYYPPKSGTIDGYSAKVDY  13466

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                ++L+ N AL  T D GE QDLI WDQL+  AR +L +TD     FG A   +P+KD  
Sbjct  13467  SSSYLVVNHALDSTSDAGETQDLIMWDQLTDAARTALENTD-----FGDA--NVPMKDAN  13625

Query  241    FEELLDKTW  249
              F+  L   +
Sbjct  13626  FQAKLGNAY  13652

 Score = 191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 144/249 (58%), Gaps = 14/249 (6%)
 Frame = +1

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              M+ R +   A+A+L   QA VI HDQV PF QP P T  Q+ A+KFKPQ+ I+ GCHPYP
Sbjct  17647  MHLRYIAPTALAALTFTQATVISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYP  17826

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              AV +DG+ SGGL  +G +   C GS  GSQIY R+     V+A MY+WY PK        
Sbjct  17827  AVDEDGNTSGGLAPTGSESAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDET-----  17991

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                L   GHRH+WE  VVW+D+  L+   ++ +S SA  GY+   P    Y+DG S K+ Y
Sbjct  17992  --LPGLGHRHDWEACVVWLDDITLDEPNIVALSASAHSGYNVYYPPSSSYLDGDSAKIEY  18165

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                ++++ + +L  T   GE QDLI WDQL+  AR +L  TD     FG A   +P K+  
Sbjct  18166  SSSYIVIDHSLSATSTAGETQDLIMWDQLTDAARAALEDTD-----FGSA--NVPFKEAN  18324

Query  241    FEELLDKTW  249
              F+  L   +
Sbjct  18325  FQTKLGNAY  18351

 Score = 108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MN  A+    +  L    A VI HD V PF QP P T  Q  AVKFKPQ+ I+ GCHPYP
Sbjct  20352  MNIHAIVTTVITLLTCVNAAVIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYP  20531

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPK  112
              AV +DG+ SGGLK +G Q   CTGS LGSQIY R+    DV+A MY+WY PK
Sbjct  20532  AVDEDGNTSGGLKPTGSQSSGCTGSSLGSQIYGRAVEYEDVYAFMYSWYMPK  20687

>PHPA:scaffold_34 NW_008649020.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.34, whole genome shotgun 
sequence
Length=723591

 Score = 219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  308529  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  308350

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  308349  CRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSS-------RMGHRHDWEHAIVFIDN  308191

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K +P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  308190  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  308014

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ+S+ AR +LN        FG A    P  DG F   L+K WPF
Sbjct  308013  DLIMWDQMSNDARRALNSVH-----FGKA--NTPFNDGNFRPKLEKAWPF  307885

 Score = 219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  332425  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  332604

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  332605  CRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSSR-------MGHRHDWEHAIVFIDN  332763

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K +P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  332764  PEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  332940

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ+S+ AR +LN        FG A    P  DG F   L+K WPF
Sbjct  332941  DLIMWDQMSNDARRALNSVH-----FGKA--NTPFNDGNFRPKLEKAWPF  333069

 Score = 216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 143/230 (62%), Gaps = 15/230 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGLK SG   G 
Sbjct  326296  IGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLKTSGKSRGN  326475

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WEYVVV+I+N
Sbjct  326476  CGGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPSP-------GMGHRHDWEYVVVFINN  326634

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P ++   +L  S+++  GY K  P     +DGTS+KV Y +   + N  L  T D G FQ
Sbjct  326635  PEVQEPKILACSVASHGGYKKFNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  326811

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ+++ AR +LN        FG A    P  DG F + L+  WPF
Sbjct  326812  DLIMWDQMTNDARRALNSVS-----FGKA--NTPFIDGRFRKKLEDAWPF  326940

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 141/228 (62%), Gaps = 15/228 (7%)
 Frame = +3

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HD+V PF QP PVTV++  AVKFKPQ+ I  GCHPYPAV   G +SGGLK SG  D  C 
Sbjct  322497  HDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNATGEISGGLKASGSSDAGCK  322676

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
               GS  GSQ+Y RS W   +WAIMY+WYFPK  A           GHRH+WE+++VWIDNP 
Sbjct  322677  GSEYGSQVYGRSTWHRGLWAIMYSWYFPKDTA-------FPLLGHRHDWEHIIVWIDNPS  322835

Query  144     LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
               L    +L V+ SA   Y+ Q+P     V+GTSVKV Y     L N AL  T  +GE+QDL
Sbjct  322836  LYKPRILAVASSAHSWYTVQSPPHTDRVNGTSVKVKYAGIWPL-NHALTSTTKSGEYQDL  323012

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I W+QL+  AR SL      Q  FG+A   +P++DG F + LD  W F
Sbjct  323013  IMWEQLTEAARQSL-----QQANFGMA--NVPMRDGNFLDKLDTAWSF  323135

>PHPA:scaffold_136 NW_008649122.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.136, whole genome 
shotgun sequence
Length=77800

 Score = 219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 158/237 (67%), Gaps = 11/237 (5%)
 Frame = -2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV+PF + +P T S+K+A+K+KPQL I  GC+PYPAVQ +G++SGGLKWSG  + +
Sbjct  1092  INHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSD  913

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C     GSQIY+RS W    WAIMYAWYFPKG  A     + R  GHRH W   +VW DN
Sbjct  912   CEKPVQGSQIYSRSDWYKGKWAIMYAWYFPKG--AFRASKYNR--GHRHFWSSAIVWTDN  745

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                +N+T+LGVSMS S GY K+     KY++ GT++K+  Y    L N AL+LT+ +G  
Sbjct  744   TNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGT  565

Query  201   QDLIQWDQLSSLARYSLNHTDWD----QTLFGLAG--LKMPLKDGVFEELLDKTWPF  251
             QDL+ W+QL+  AR +L+  D+D      +F  +G  + +PL+DGVF  +L++++PF
Sbjct  564   QDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  394

>PHKE:scaffold_562 scf_22126_562.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_562.1:1:18673:1 
REF
Length=18673

 Score = 219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 147/230 (64%), Gaps = 15/230 (7%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I H  V+PF QP+P+T+S+K AVKFKPQL I +GC  YPAV   G  SGGL+ SG   G 
Sbjct  3411  IPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQESGSPKGG  3590

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQ+Y RS W +DVWAIMY+WYFPK   ++         GHRH+WE+VVVWIDN
Sbjct  3591  CRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPSS-------RLGHRHDWEHVVVWIDN  3749

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P +    +L VS S   G+ K AP     +DGTSVKV Y ++  L N AL +T+  G+FQ
Sbjct  3750  PEVLEPKILAVSPSYHSGHKKYAPPSADVIDGTSVKVKYEHSWPL-NHALDVTDKAGDFQ  3926

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DLI WDQ++ LAR +LN     +T FG A +  P+ D  F   L++ WPF
Sbjct  3927  DLIMWDQMTDLARVALN-----ETKFGKANV--PMNDHNFLRKLEQAWPF  4055

>PHPA:scaffold_10 NW_008648996.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.10, whole genome shotgun 
sequence
Length=1634506

 Score = 219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = -1

Query  86       RLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLE  145
                RL SQ+YAR+ WV D WAIMYAW+FPK RA   P   LRF GHRH WEY +VW+D P  +
Sbjct  1455136  RLDSQVYARTTWVKDKWAIMYAWFFPKARA---PFPVLRFLGHRHGWEYAIVWLDKPNAD  1454966

Query  146      NATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQ  205
                N+T+LGVS+SA+ G++K+AP   KY+DG S+KVAYYYNH+ GNTA++ T++TGEFQDLI 
Sbjct  1454965  NSTILGVSVSAAAGWAKEAPPPEKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLIT  1454786

Query  206      WDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                W+QLS LAR  LN+TDWD+T    A LKMP+KDGVF + L   +PF
Sbjct  1454785  WNQLSDLARSYLNNTDWDETPLNAALLKMPMKDGVFMKKLKSAYPF  1454648

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I H +VRPFPQ  PVT +QK  + +KPQLKI+ GCHPYPAVQKDG+ SGGL WSG QDGE
Sbjct  1455321  ILHGEVRPFPQQIPVTDAQKAVLNYKPQLKIEDGCHPYPAVQKDGATSGGLSWSGSQDGE  1455142

Query  82       CTGSRLGSQIYARSA  96
                C G  L S +  R +
Sbjct  1455141  CKGWILKSTLGQRGS  1455097

>PHRA:scaffold_60
Length=327626

 Score = 218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 141/228 (62%), Gaps = 15/228 (7%)
 Frame = +2

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HDQV+PF QP+P T+S+K  VKFKPQ+ I  GCHPYPAV  +G   GGLK +G     C 
Sbjct  293663  HDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGAPSSSCK  293842

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
               GS  GSQ+Y RS W N VWAIMY+WYFPK   +T         GHRH+WE+VVVWI NP 
Sbjct  293843  GSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWITNPD  294001

Query  144     LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
               +EN  +L VS SA  GYS         +DGT+VKV  Y +H   N AL +T + G+ QDL
Sbjct  294002  VENPVILAVSPSAHSGYSYYVSPSADTIDGTAVKVN-YESHWPINHALDITTEGGDTQDL  294178

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I WDQ++  AR SLN        FG A   +P+ DG F+  L K WP+
Sbjct  294179  IMWDQMTDAARNSLN-----TVSFGDA--NVPMNDGNFQNKLGKAWPW  294301

>PHRA:scaffold_31
Length=507260

 Score = 218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 153/235 (65%), Gaps = 20/235 (9%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QPDPVTVS+K AV+FKP L+ID+GCHPYPAV   G  S GLK +GP  G+
Sbjct  467733  IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  467554

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+DN
Sbjct  467553  CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVWLDN  467395

Query  142     PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLTEDT  197
               P LE  T++GVS S+ +  YSK  P     ++GT+  + Y     NH  G  ++  T  T
Sbjct  467394  PALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTTWKT  467221

Query  198     -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                GEFQDLI W+QL+  AR +LN TD     FG   L +P  D  F+  L+K WP+
Sbjct  467220  GGEFQDLIMWEQLTDEARAALNDTD-----FGEHAL-VPFIDANFKANLEKAWPY  467074

 Score = 132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 106/212 (50%), Gaps = 15/212 (7%)
 Frame = +2

Query  40      QKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVN  99
               +K   + +   +   GC PYPA    G  S GL+ +G  D  C    LGSQ+Y R+ W N
Sbjct  260972  RKVWCQVQAATRYRIGCSPYPAANAAGETSEGLETNGAFD--CIIPSLGSQVYGRAEWYN  261145

Query  100     DVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG  159
               DVWAIMYAWYFPKG     P         RH+W   VVWIDNP  E   VLG+S+S S  
Sbjct  261146  DVWAIMYAWYFPKGFWDGTP-------WWRHDWSNAVVWIDNPAHEKPKVLGLSLSTSEN  261304

Query  160     YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
                        + ++  +          + + AL    + GEFQDL+ W QL+  AR +LN 
Sbjct  261305  KYGNTYVPAEGIENGTTPTLSRNVLPMRSAALGPAVNPGEFQDLVMWTQLTDAARAALN-  261481

Query  220     TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                  DQ  FG    ++P+ D  F + L K WPF
Sbjct  261482  ---DQDNFGRT--EVPISDDHFPKHLKKAWPF  261562

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG  55
               IGHD+V+PFPQP+ VT+++K+ VKFKPQL I++G
Sbjct  260919  IGHDKVQPFPQPEAVTITEKSGVKFKPQLDIESG  261020

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 6/53 (11%)
 Frame = -3

Query  199    EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              EFQDL+ WDQL+  AR +LN    DQ  FG    ++P+ D  F + L K WPF
Sbjct  36132  EFQDLVMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLKKAWPF  35992

>PYVX:scaffold_884 pve_scaffold_884 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_884:1:10722:1 
REF
Length=10722

 Score = 218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 150/249 (60%), Gaps = 15/249 (6%)
 Frame = +3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              MN R +  AA+A LA A A VI HDQV PF QP   + S K AVKFKPQL I  GCHPYP
Sbjct  9963   MNLRYLLAAAVALLAGACASVIDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYP  10142

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              AV   G+ SGGLK SG     C GS  GSQIY RS W N VWAIMY+WYFPK   +T   
Sbjct  10143  AVDSSGNTSGGLKPSGSSSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPST---  10313

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                    GHRH+WE+VVVWI NP +++ TV  VS SA  GYS   P    Y+DG S K+  
Sbjct  10314  ----GLGHRHDWEHVVVWISNPAVDSPTVYAVSTSAHSGYSIYYPPSSSYMDGNSAKID-  10478

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
              Y+  ++ N A ++T   GE QDLI WDQ++  AR +L +TD     FG A   +P KDG 
Sbjct  10479  YFKIVVINHAFRMTSSAGETQDLIMWDQMTDAARIALENTD-----FGDA--NVPFKDGN  10637

Query  241    FEELLDKTW  249
              F   L   W
Sbjct  10638  FMTKLASAW  10664

 Score = 183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 145/245 (59%), Gaps = 15/245 (6%)
 Frame = -2

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MN + V V+ +A L++AQA VI HD V  F QP P T S++ A+ +KPQL I  GCHPYP
Sbjct  9215  MNIKTVLVSLLAPLSIAQAAVINHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYP  9036

Query  61    AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             AV  DG+ SGGLK +G QD +C GS LG+QIY R+   N V+AIMY+WY PK        
Sbjct  9035  AVDADGNTSGGLKPTGAQDSDCKGSALGTQIYGRATEYNGVYAIMYSWYMPKDSP-----  8871

Query  121   DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
               L   GHRH WE VVVW+D+    + +++ VS SA   Y    P     V+GTS KV  
Sbjct  8870  --LSGLGHRHEWENVVVWLDSATASSPSIVAVSPSAHGNYHIYNPPSSSNVNGTSAKVK-  8700

Query  181   YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
             Y + ++ N +L +T  +GE Q LI ++QLS  AR +L  TD     FG A   +P K+  
Sbjct  8699  YESQVVINHSLDITTVSGETQPLILYEQLSEAARQALETTD-----FGSA--TVPFKNTT  8541

Query  241   FEELL  245
             F   L
Sbjct  8540  FTANL  8526

 Score = 169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 127/228 (56%), Gaps = 14/228 (6%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD V PF QP P T  Q  AVKFKP L ID GCHPYPAV +DG+ SGGLK +G   G 
Sbjct  8133  IDHDAVVPFAQPTPNTTEQSAAVKFKPTLYIDNGCHPYPAVDEDGNTSGGLKPTGSTTGG  7954

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             CTGS LGSQIY R    + VWAIMY+WY PK   +        + GHRH+WE  V+W+D+
Sbjct  7953  CTGSSLGSQIYGRVMEYDGVWAIMYSWYMPKDEPSP-------YIGHRHDWENAVIWVDD  7795

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 + +++ +S S   GY    P    Y  G + K+ Y     L +  L  T   GE Q
Sbjct  7794  ITSASPSIVAISASEHSGYKVYYPPSADYYSGYTAKIKYESVFFLVDHCLYATSTAGETQ  7615

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             DLI WDQL++ A+ +L  TD     FG A +  P K+  F   + K +
Sbjct  7614  DLIMWDQLTAAAQTALEDTD-----FGSANV--PFKEANFATKVAKAY  7492

>PHIF:NW_003303732.1 Phytophthora infestans T30-4 supercont1.27 
genomic scaffold, whole genome shotgun sequence
Length=2178769

 Score = 218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I H  V+PF QP+ VT+S+K  VKFKPQ+ +  GC  YPAV + G  SGGL+ SG   G 
Sbjct  1051885  IAHKDVKPFAQPEAVTISEKAGVKFKPQIAVKTGCVSYPAVNEAGETSGGLQTSGSPKGG  1051706

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQIY RS W N +WAIMY+WYFPK          +   GHRH+WE++VV+IDN
Sbjct  1051705  CRGSGHGSQIYGRSTWFNGLWAIMYSWYFPKDAP-------MSRMGHRHDWEHIVVFIDN  1051547

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +    +LG S S   GY+K AP     +DG+SVKV Y ++  L N AL +T+D GEFQ
Sbjct  1051546  PEVPEPKILGCSPSWHSGYTKYAPCPANVIDGSSVKVKYEHSWPL-NHALDITKDAGEFQ  1051370

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQ+S LAR +LN T      FG A    P+ D  F   ++K+WPF
Sbjct  1051369  DLIMWDQMSDLARRALNDTK-----FGKA--NTPMNDWNFRGKIEKSWPF  1051241

 Score = 179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 130/228 (57%), Gaps = 20/228 (9%)
 Frame = +3

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
                HD V+PF QP+P T ++KTAVKFKP L + AGCHPYP V   G    GLK +G  DGECT
Sbjct  1435281  HDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGECT  1435460

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                GS LGSQ+Y+RS    + WAIMYAWYFPK          L   G RH+W  +VVW+DNP 
Sbjct  1435461  GSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQDI----GLIKKGVRHDWVNLVVWLDNPT  1435628

Query  144      LENATVLGVSMSASIGYSKQ-----APTDVKYVDGTSVKVAYYYNHLLG-NTALQLTEDT  197
                L   T+L  S S    Y  Q      P     ++GT+ KV Y  +   G +T  Q  E+ 
Sbjct  1435629  LAKPTILATSAST---YGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEE-  1435796

Query  198      GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                GE+QDLIQW QL+  AR +L +TD     FG     +P  D  FE  L
Sbjct  1435797  GEYQDLIQWTQLTDAAREALENTD-----FGDFA-NVPFNDAYFETNL  1435922

 Score = 127 bits (319),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 99/195 (51%), Gaps = 18/195 (9%)
 Frame = -3

Query  60       PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
                P V + G  + GLK + P DG+C GS LGSQ+Y+RS W    WAIMYAWYFPK     VP
Sbjct  1405817  PPVPRPGDTNAGLKGTSPSDGDCEGSPLGSQVYSRSTWFEGKWAIMYAWYFPKDMQGEVP  1405638

Query  120      PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYS-KQAPTDVKY--------  170
                       G RH+W  +VVW+DNP L  + +L  S SAS G   K    DV Y        
Sbjct  1405637  IIGAVKIGVRHDWVNLVVWLDNPTLAKSKILATSASASYGRVLKTCDIDVGYEISKPPNG  1405458

Query  171      ---VDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLF  227
                   ++G + KV Y      G   +    + GE+QDLIQ  QL+  AR +L +TD+     
Sbjct  1405457  SDIINGITPKVRYDEGDSDGGHTIFQFHEEGEYQDLIQ*TQLTDAAREALENTDFGDH--  1405284

Query  228      GLAGLKMPLKDGVFE  242
                      +P  D  FE
Sbjct  1405283  ----ANVPFSDAYFE  1405251

 Score = 59.7 bits (143),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                I HD V+PF QP+P+T ++K A+KFKP L +  GCHPYP
Sbjct  1405921  IDHDTVQPFAQPEPITDAEKAAIKFKPSLAVKDGCHPYP  1405805

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 58/102 (57%), Gaps = 1/102 (1%)
 Frame = +3

Query  58       PYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAAT  117
                P P     G  + GLK +GP DG+C GS LGSQ+Y+RS W    WAIMYAW FPK     
Sbjct  1392390  PVPRRNTAGDTNDGLKGTGPSDGDCEGSPLGSQVYSRSTWFEGKWAIMYAWNFPKDMHDI  1392569

Query  118      VPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG  159
                     ++  G RH W  +VVW+DNP L  A +L  S SA  G
Sbjct  1392570  SSIGLVK-KGVRHEWVNLVVWLDNPTLAKANILATSASAYYG  1392692

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/247 (28%), Positives = 105/247 (43%), Gaps = 44/247 (18%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDG-  80
                I HD V+PF QP+P+T ++K A+KFKP L +  GCHPYP V +  +     K   P    
Sbjct  1392283  IDHDTVQPFAQPEPITDAEKAAIKFKPSLAVKDGCHPYPVVIQPATRMMA*KVQAPLTAT  1392462

Query  81       --------ECTGSRLGSQ---------IYARSAWVNDVWAIMYAWYFPKG----RAATVP  119
                         CT  + G +         I  ++  +  + A+    +   G       T+ 
Sbjct  1392463  VKALRWARRCTVDQRGLRASGLSCTHGISLKTCMIYRLLALSRRVFVTNG*TWSCGLTIQ  1392642

Query  120      PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179
                    R +        +V +        A + G ++S       + P     ++GT+ KV 
Sbjct  1392643  L*LRRTY*QPPRRLTMVQY----*FHAALIKGYAIS-------RPPKRSDIINGTTPKVR  1392789

Query  180      YYY-NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
                Y   +   G+T  Q  E  G +QDLIQW QL+  AR +L +TD     FG     +P+ D
Sbjct  1392790  YDKGDRDRGHTIFQFHEKDG-YQDLIQWTQLTHAAREALENTD-----FG----DVPISD  1392939

Query  239      GVFEELL  245
                  FE  L
Sbjct  1392940  AYFETNL  1392960

 Score = 45.4 bits (106),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 29/55 (53%), Gaps = 3/55 (5%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
                I  D V+P  QP+P    +K AVKF P L + AG   YP V   G  S GLK + 
Sbjct  1464375  IDRDMVQPVAQPEPKPDVEKAAVKFNPSLAVKAG---YPVVNAAGDTSAGLKETA  1464220

 Score = 23.9 bits (50),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
 Frame = -3

Query  77       PQDGECTGSRLGSQI  91
                P DG+C GS L SQ+
Sbjct  1464221  PADGDCKGSALDSQV  1464177

>PHRA:scaffold_9
Length=727265

 Score = 217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = -3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              IGHD+V+PFPQP+PVT+S K  VKFKPQ++I  GC+PYPAV + G + GGLK SG   G 
Sbjct  69579  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKTSGKSRGN  69400

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ VV+IDN
Sbjct  69399  CAGSGHGSQVYGRSTWHNQVWAIMYSWYFPKDSPSP-------GMGHRHDWEHAVVFIDN  69241

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +    +LG S+S+  GY K  P     +DGTS+KV Y ++  + N  L  T D G FQ
Sbjct  69240  PDVPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGIFQ  69064

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI W Q++  AR +LN  +     FG A    P+ DG F   ++K+WPF
Sbjct  69063  DLIMWGQMTDNARRALNEAN-----FGSA--NTPMNDGNFYSKVEKSWPF  68935

 Score = 217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I H  V+PFPQP+P+T+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  32259  ISHKDVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPRGG  32438

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   A+         GHRH+WE+VVV+IDN
Sbjct  32439  CRGSGHGSQVYGRSTWYNQVWAIMYSWYFPKDSPAS-------GMGHRHDWEHVVVFIDN  32597

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P L    +LG S+S+  GY K  P     +DGTSVKV Y ++  L N  L  T D G FQ
Sbjct  32598  PDLPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSVKVRYKHSWPL-NHDLDTTGDGGTFQ  32774

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DLI W+Q++  AR +LN     +T FG A    P+ D  F   ++K+WPF
Sbjct  32775  DLIMWNQMTDNARRALN-----ETKFGKAN--TPMNDWNFHSKVEKSWPF  32903

 Score = 211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 141/230 (61%), Gaps = 15/230 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFPQP+PVT+S K  VKFKPQ++I  GC+PYPAV + G + GGLK +G   G+
Sbjct  119783  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPTGKSRGK  119604

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W N VW IMY+WYFPK   +          GHRH+WE+ VV+IDN
Sbjct  119603  CAGSGHGSQVYGRSTWHNSVWVIMYSWYFPKDSPSP-------GLGHRHDWEHAVVFIDN  119445

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+KV Y ++  + N  L  T D G FQ
Sbjct  119444  PDVPEPKILACSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGTFQ  119268

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W Q++  AR +LN  +     FG A    P+ DG F   +   WPF
Sbjct  119267  DLIMWGQMTDNARRALNEAN-----FGSA--NTPMNDGNFPNKVQAAWPF  119139

>PHCA:scaffold_25 PHYCAscaffold_25
Length=841216

 Score = 217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 144/230 (63%), Gaps = 15/230 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  253201  IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  253380

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  253381  CRGSGHGSQVYGRSTWIQGVWAIMYSWYFPKDSPSSR-------MGHRHDWEHAIVFIDN  253539

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+K+ Y ++  + N  L  T D+G FQ
Sbjct  253540  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKLRYKHSWPI-NHDLDTTGDSGTFQ  253716

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ++  AR +LN        FG A    P  DG F+  L+K WPF
Sbjct  253717  DLIMWDQMTEDARRALNSVS-----FGKA--NTPFNDGSFKPKLEKAWPF  253845

 Score = 214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 142/230 (62%), Gaps = 15/230 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PF QP+PVT+S+K  VKFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  277614  IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  277793

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  277794  CRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPSS-------RMGHRHDWEHAIVFIDN  277952

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+KV Y ++  + N  L  T D G FQ
Sbjct  277953  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDAGTFQ  278129

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ++  AR +LN   + + +        P  DG F+  L+K WPF
Sbjct  278130  DLIMWDQMTEDARRALNSVSFGKAM-------TPFNDGSFKPKLEKAWPF  278258

 Score = 213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 142/230 (62%), Gaps = 15/230 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PF QP+PVT+S+K  VKFKPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  240132  IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  239953

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  239952  CRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPSS-------RMGHRHDWEHAIVFIDN  239794

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+KV Y +   + N  L  T D+G FQ
Sbjct  239793  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDSGTFQ  239617

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ++  AR +LN        FG A    P  DG F+  L+K WPF
Sbjct  239616  DLIMWDQMTEDARRALNAVH-----FGSA--NTPFNDGNFKPKLEKAWPF  239488

 Score = 204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 137/230 (60%), Gaps = 15/230 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I H  ++PFPQP PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGLK +G   G 
Sbjct  234611  ISHHDIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPTGNPRGG  234432

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  234431  CRGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSP-------GLGHRHDWEHAIVFIDN  234273

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+KV Y +   + N  L  T D G FQ
Sbjct  234272  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  234096

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+Q++  AR +LN  +     FG A    P  DG F   L+  WPF
Sbjct  234095  DLIMWNQMTEDARRALNSVN-----FGSA--NTPFNDGRFMPKLENAWPF  233967

 Score = 197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PFPQP+PVT+S+K  VKFKPQ+++  GC PYPAV + G  SGGLK +G   G 
Sbjct  191260  INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPTGNPRGG  191081

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  191080  CGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDSPSP-------GLGHRHDWEHAIVFIDN  190922

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+KV Y ++    N  L  T D G FQ
Sbjct  190921  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHS-WPTNHDLDTTGDGGSFQ  190745

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W+Q++  AR +LN  +     FG A    P  DG F   L+  WPF
Sbjct  190744  DLIMWNQMTEDARRALNSVN-----FGSAN--TPFNDGKFMPKLENAWPF  190616

>PHPA:scaffold_36 NW_008649022.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.36, whole genome shotgun 
sequence
Length=670734

 Score = 216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 145/230 (63%), Gaps = 15/230 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I H  V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL  SG   G+
Sbjct  612439  IAHKDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLHTSGKSRGK  612260

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RSAW+  VW IMY+WYFPK   +          GHRH+WE  +V+IDN
Sbjct  612259  CGGSGHGSQVYGRSAWLKGVWVIMYSWYFPKDSPS-------HGLGHRHDWEEAIVFIDN  612101

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +LG S+S+  GY++ AP     +DGTS+KV Y ++    N  L +T D G+FQ
Sbjct  612100  PDVSEPKILGCSVSSHGGYARHAPCPPWVIDGTSLKVRYKHS-WPKNHDLAITGDGGKFQ  611924

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W Q+++ AR +LN        FG A    P KDG F++ ++K WPF
Sbjct  611923  DLIMWGQMTNDARRALNAVS-----FGSA--NTPFKDGTFQDKIEKAWPF  611795

 Score = 209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 146/251 (58%), Gaps = 15/251 (6%)
 Frame = +1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN RA  V+ +A+LA      + HDQVRPF QP PV+VS+K AVKFKPQL I  GCHPYP
Sbjct  425206  MNLRAFIVSIVAALAATDVIALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYP  425385

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV   G  SGGL  SG     C GS  GSQ+Y RS W    WAIMY+WYFPK   +T   
Sbjct  425386  AVNAAGETSGGLAKSGAPSAGCKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPST---  425556

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                     GHRH+WE+V+VWIDNP + N  +L V+ SA  GYSK AP     V G + K+  
Sbjct  425557  ----GLGHRHDWEHVIVWIDNPDVANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKI-N  425721

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
               Y +H   N AL  T+  GE Q LI WDQ++  AR SLN        FG A   +P+ DG 
Sbjct  425722  YESHWPVNHALDSTDKGGETQPLIMWDQMTDAARRSLN-----TVSFGDA--NVPMNDGN  425880

Query  241     FEELLDKTWPF  251
               F   +    P+
Sbjct  425881  FLRKIGNASPW  425913

>PHCA:scaffold_15 PHYCAscaffold_15
Length=1032281

 Score = 216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFP+P PVTVS+K  VKFKPQ++I  GC PYPAV + G  SGGLK +G   G 
Sbjct  424783  IGHDEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPTGNSKGG  424962

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y R  W+  VW IMY+WYFPK   +T         GHRH+WE+ +V+IDN
Sbjct  424963  CRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPST-------GMGHRHDWEHAIVFIDN  425121

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +    +L  S+S+  GY K  P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  425122  PDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVRYKHGWPL-NHDLDTTGDAGTFQ  425298

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQ++  AR +LN        FG A    P  DG F+  L+K WPF
Sbjct  425299  DLIMWDQMTEDARRALNSVH-----FGSA--NTPFNDGNFKPKLEKAWPF  425427

>PYUU:scaffold_1297 scf1117875581297 dna:supercontig supercontig:pug:scf1117875581297:1:515008:1 
REF
Length=515008

 Score = 215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 139/228 (61%), Gaps = 15/228 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF +P P ++S+K A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  421857  ISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  422036

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y RSAW N  WAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  422037  CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  422195

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N T+L VS SA  GY K AP     VDGTS KV  Y + ++ N AL  T   GE Q
Sbjct  422196  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  422372

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                LI W+Q++  AR +L +T       G     +P+KDG F + L K +
Sbjct  422373  PLIMWEQMTQAARTALENT-------GFGDANVPMKDGNFMDKLAKAY  422495

 Score = 213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 138/224 (62%), Gaps = 15/224 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF +P P ++S+K A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  400568  IDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  400389

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y RSAW N  WAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  400388  CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  400230

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N T+L VS SA  GY K AP     VDGTS KV Y    ++ N AL  T   GE Q
Sbjct  400229  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYSSTIVI-NHALDSTTTAGEKQ  400053

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                LI W+Q++  AR +L +TD     FG A   +P+KDG F   L
Sbjct  400052  PLIMWEQMTQAARTALENTD-----FGDA--NVPMKDGNFMTKL  399942

 Score = 207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 137/228 (60%), Gaps = 15/228 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF +P P + S+K AVKFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  405582  INHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  405761

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y R A   D WAIMY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  405762  CKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDSPIT-------GLGHRHDWEHVVVWIDN  405920

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N  +L +S SA  GY K AP     VDGTS KV  Y + ++ N AL  T   GE Q
Sbjct  405921  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  406097

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                LI W+Q++  AR +L +TD     FG A +  P+KDG F   L K +
Sbjct  406098  PLIMWEQMTDAARSALENTD-----FGKANV--PMKDGNFMNKLAKAY  406220

 Score = 206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 14/228 (6%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF +P P T+++K A+KFKPQ+ I+ GCHPYPAV   G++ GGLK  G Q   
Sbjct  416148  IDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLKPDGSQSAG  416327

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y R+A  NDV+AIMY+WY PK          +   GHRH+WE VVVWIDN
Sbjct  416328  CKGSGWGTQVYGRAAPYNDVYAIMYSWYMPKDTP-------IPGIGHRHDWENVVVWIDN  416486

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N  +L VS SA  GY K AP     VDGTS KV Y   +L+ + +L  T   GE Q
Sbjct  416487  PNAANPKILAVSPSAHSGYEKYAPPKAGTVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQQ  416666

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                LI W+QL+  AR +L   D+D   FG A   +P+KDG F + L K++
Sbjct  416667  PLIMWEQLTDAARSTLQ--DYD---FGNA--NVPMKDGNFMDKLGKSY  416789

 Score = 201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 134/228 (59%), Gaps = 15/228 (7%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF +P P +  +K AVKFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  423567  ISHDQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  423746

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y R A  N V+ +MY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  423747  CKGSGWGTQVYGRGAAYNGVYGLMYSWYFPKDSPIT-------GLGHRHDWEHVVVWIDN  423905

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   N  +L +S SA  GY K AP     VDGTS KV  Y + ++ N AL  T   GE Q
Sbjct  423906  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  424082

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                LI W+Q++  AR +L +T       G     +P+KDG F + L K +
Sbjct  424083  PLIMWEQMTQAARTALENT-------GFGDANVPMKDGNFMDKLAKAY  424205

 Score = 196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 133/228 (58%), Gaps = 15/228 (7%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V PF +P P T +QK  +KFKPQL I  GCHPYPAV   G+ SGGLK +G  D  
Sbjct  403213  IAHDAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGSSDAG  403392

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y R+A  N V+A+MY+WYFPK   +T         GHRH+WE+VVVWIDN
Sbjct  403393  CKGSGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST-------LLGHRHDWEHVVVWIDN  403551

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P   +  +L VS SA  GY+K  P     + G S K+ Y    +L N A  +T   GE Q
Sbjct  403552  PDAASPKILAVSASAHSGYNKYHPPATTTLAGNSAKIDYKSIVVL-NHAFDMTTAAGETQ  403728

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                LI WDQ++  AR +L  TD     FG A   +P+KDG F   L   +
Sbjct  403729  PLIMWDQMTVAARTALETTD-----FGDA--NVPMKDGNFMTKLANAY  403851

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
               I HDQV PF +P P ++S+K A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG
Sbjct  418739  ISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSG  418903

>PHIF:NW_003303713.1 Phytophthora infestans T30-4 supercont1.46 
genomic scaffold, whole genome shotgun sequence
Length=1163948

 Score = 215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 137/213 (64%), Gaps = 13/213 (6%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHDQV+PF QP PVT+S++ A+KFKPQ++I  GCHPYPAV   G   GGL+ +      
Sbjct  453707  IGHDQVKPFAQPQPVTISERAAIKFKPQIRISDGCHPYPAVSDAGETGGGLETTRSPTAG  453886

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W  DVWAIMY+WY PK    T         GHRH+WE+V+VWI+N
Sbjct  453887  CKGSGWGSQVYGRSTWHRDVWAIMYSWYLPKDSPMT-------GLGHRHDWEHVIVWINN  454045

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P + N T+L V+ SA  GYSK AP +   +DG+SVKV Y   + + N A  +T + GEFQ
Sbjct  454046  PDVPNPTILAVTPSAHSGYSKYAPPNADTLDGSSVKVNYESTYPM-NHATDITTEPGEFQ  454222

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKM  234
               DLI WDQ++  AR++LN        FG A + M
Sbjct  454223  DLIMWDQMTEAARHALN-----TVSFGDANVPM  454306

 Score = 190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 132/221 (60%), Gaps = 15/221 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTV-SQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
               I HD V PF QP   T   QK  +KFKPQ+ I  GCHPYPAV  DG+ SGGL  +G    
Sbjct  436158  ISHDAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSSSA  435979

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C GS  GSQIY R A  N V+AIMY+WYFPK          L   GHRH+WE+VVVW+D
Sbjct  435978  GCKGSGYGSQIYGRVATYNGVFAIMYSWYFPKDSP-------LTGLGHRHDWEHVVVWVD  435820

Query  141     NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +  L + +V+ VS SA  GY+   P +   +DG S KV Y  + L+ N AL  T D GE 
Sbjct  435819  DIKLNSPSVIAVSPSAHSGYNIYHPPESNTIDGYSTKVDYSSSWLVINHALDSTTDAGET  435640

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               Q+LI WDQL+  AR +L +TD     FG A   +P+KDG F
Sbjct  435639  QNLIMWDQLTDAARTALENTD-----FGDA--NVPMKDGNF  435538

 Score = 161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 131/228 (57%), Gaps = 15/228 (7%)
 Frame = -1

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               +D+V PFP+  P T   K A+KFKPQL I +GCHPYPAV  DG+ + GL  +      C 
Sbjct  419291  YDEVVPFPEVLPTTTENKVALKFKPQLHISSGCHPYPAVDADGNTNAGLGITKVFTS-CE  419115

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
               GS  GSQ+Y R      V AIMYAWYFP  R   V P ++   GHRH+WE+ +VW+D  G
Sbjct  419114  GSPQGSQVYGRMTEYEGVVAIMYAWYFP--REFMVSPVWV---GHRHDWEHAIVWLDGLG  418950

Query  144     LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
                  A VL V++   +GY    P   K++DG+S K+ Y +  +     L  T + GEFQDL
Sbjct  418949  T-RAEVLAVTVQQLLGYKTYKPPKAKHMDGSSAKIKYTW-LIQTQHYLSATTEAGEFQDL  418776

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I W+ +++ A+ +L  T +  +         P+ +G F++ ++K +PF
Sbjct  418775  IMWENMTAAAQEALEDTKFFWSW-------APINEGQFQDNIEKAYPF  418653

 Score = 135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 126/234 (54%), Gaps = 30/234 (13%)
 Frame = -3

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               ++ V P P+ +  T     A++FKPQL +D+GCHPYPAV +DG+++ GL     +  +C 
Sbjct  392697  YNSVVPMPETEATTNELSLALRFKPQLHVDSGCHPYPAVDEDGNINSGLALYSFK--KCG  392524

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKG-RAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
                  LGSQ+Y R+    D +AIMY+WYFP+  RAA         FGHRH+WE ++VW++  
Sbjct  392523  PPALGSQMYGRATTYKDSYAIMYSWYFPRELRAA---------FGHRHSWENIIVWVERK  392371

Query  143     --GLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYY---YNHLLGNTALQLTED  196
                 G   A +  VS S + G Y    P     +D  SVK+ Y    ++H +  T +     
Sbjct  392370  TGGASKAKMSAVSSSINDGQYFTIIPPTEDMMDDDSVKIQYRAKAFSHYVNVTTV-----  392206

Query  197     TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
               +G+FQDL+ W+ + S AR +L+       L+      +P K+  F + L   +P
Sbjct  392205  SGDFQDLVMWNDMPSAARTALD-------LYDFGKATVPFKEDTFVDNLKMAYP  392065

 Score = 101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HD VRPF +  PV++S+K  VKFK QL ID GC PYPAV + G  SGGLK +G + G CT
Sbjct  752346  HD*VRPFKELAPVSISEKAGVKFKVQLSIDMGCVPYPAVDEAGETSGGLKPTGGRSG-CT  752522

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKG  113
                +  G Q Y RS W    WAIMYAWY+ KG
Sbjct  752523  EAPWGVQTYGRSTWYRYTWAIMYAWYYLKG  752612

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 70/154 (45%), Gaps = 12/154 (8%)
 Frame = +2

Query  99      NDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-  157
               +D+W++             V P+ L+    RH+W   V WIDNP  +   ++G+S + S 
Sbjct  752540  SDLWSLNLVQIHLGNNVRMVLPEGLQA-ARRHDWSNAVAWIDNPAPQ---IVGLSTAISD  752707

Query  158     IGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSL  217
                 Y K +      + G  +        L G   L  T  TG    LI WDQL+  AR +L
Sbjct  752708  TEYKKNSHVPSIILTGVQLSN*NTTLKLSGPANLDHTRWTGPSYPLIMWDQLTEKAREAL  752887

Query  218     NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               N TD     FG   +++P  D VF   +++ WP+
Sbjct  752888  NGTD-----FG--EVQVPFSDAVFMTRIEQVWPY  752968

>PHPA:scaffold_88 NW_008649074.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.88, whole genome shotgun 
sequence
Length=212242

 Score = 214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 152/233 (65%), Gaps = 12/233 (5%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV+PF QP+P T S+K+AVK+KPQL I  GCHPY AVQ DGS+SGGL  SG  +G+
Sbjct  5262  INHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWANGD  5441

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA--ATVPPDFLRFFGHRHNWEYVVVWI  139
               GS LGSQ+Y+RS W    WAI+YAWY+PKG     T PP      G RH W Y+VVW 
Sbjct  5442  RKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKGPVFTETGPP------GQRHFWSYIVVWT  5603

Query  140   DNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTG  198
             D+P   ++T+ GV++   +GY  Q P    ++ +  +VKV  Y N    N A+QLT+++G
Sbjct  5604  DSPKPNHSTIQGVTIPTEVGYEMQVPPKEDFIFEQATVKVESYLNS--ENQAVQLTDESG  5777

Query  199   EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             E QDLI W+QL+  AR +L+  D++   +    + MPLKD VF  +L++ +PF
Sbjct  5778  EIQDLITWEQLTDQARATLSEFDFN-IKWAYVDMVMPLKDDVFSTILEEAFPF  5933

 Score = 170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 144/270 (53%), Gaps = 35/270 (13%)
 Frame = -2

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MNF A  V  + +L       I  D V+PF QP PVT+S+K A+KFKPQL I  GC  +P
Sbjct  3570  MNFFAAIVVCLVALQSVYCATINRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFP  3391

Query  61    AVQKDGSMSGGLKWSGPQDGE-CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
             AV   G  +GGL  +G Q GE C+ + LGSQ+Y RS W  D WA+M+AWY PK   A + 
Sbjct  3390  AVNAAGDTTGGL--NGTQGGEGCSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAAIT  3217

Query  120   PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI----------------GYSKQ  163
                      RH+W  +VVWI+NP LE   +LGVS+S S                 GY  +
Sbjct  3216  -------SRRHDWASMVVWIENPSLEIPEILGVSLSNSANGYLRYTGNIYDWNFSGYVAR  3058

Query  164   APTDVKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
             +    + + G  TS++V +       +  L L +  G++QDLI W QL+  AR +LN TD
Sbjct  3057  SRRRDRDIPGSSTSLRVEHTVRKDFRSAFLNLAQTDGDYQDLIMWGQLTEEARMALNTTD  2878

Query  222   WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             + ++       K+P  DG F   L + +PF
Sbjct  2877  FGRS-------KVPFNDGNFLIKLRQAYPF  2809

>PHSO:scaffold_7
Length=4006126

 Score = 214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 139/230 (60%), Gaps = 15/230 (7%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+PVT+S+K  VKFKPQ++I  GCHPYPAV + G  SGGLK +G  + +
Sbjct  426755  IPHDKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLKTTGGHNSK  426576

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                  S   SQ+Y RS W   VWAIMY+WYFPK   +          GHRH+WE+V+VWIDN
Sbjct  426575  SKRSGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPS-------HGLGHRHDWEHVIVWIDN  426417

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P      +L V+ SA   Y K AP +   VDGTS KV  Y +H   N  L +T D+GEFQ
Sbjct  426416  PDASEPKILAVTPSAHGDYQKYAPPNANTVDGTSAKVV-YESHWPMNHELSVTSDSGEFQ  426240

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI W Q+S  AR + N        FG A    P+ D  FE+ L K WPF
Sbjct  426239  DLIMWSQMSENARRAFNSVS-----FGKAN--TPMNDWGFEDRLGKAWPF  426111

 Score = 191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 139/253 (55%), Gaps = 17/253 (7%)
 Frame = -3

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN R   V   A+     A  I HD+V PFPQPDPVT+S+K AVKFKPQL I+ GC  +P
Sbjct  1821068  MNVRGFLVILAAAFIAVDAGKIDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFP  1820889

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                AV   G  SGGLK     +  C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG       
Sbjct  1820888  AVNAAGETSGGLK-GNSGNSACDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKGF------  1820730

Query  121      DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPT-DVKYVDGTSVKV  178
                 F+     R +W   VVWIDNP      +LG+S S S   Y  + P  D   +DGT+  +
Sbjct  1820729  -FVGVASRRFDWSSAVVWIDNPDFAAPKILGISTSTSDDDYETKTPAPDYAILDGTTTLL  1820553

Query  179      AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
                    +   G   L  +  TG+ Q LI W+QL   AR +LN TD     FGLA   +P+ D
Sbjct  1820552  FRSTSREAGQPKLYYSSRTGDSQPLIMWEQLPEAARLALNTTD-----FGLA--YVPIND  1820394

Query  239      GVFEELLDKTWPF  251
                  FE+ L K WPF
Sbjct  1820393  DTFEKKLKKAWPF  1820355

 Score = 176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 131/231 (57%), Gaps = 18/231 (8%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD V+PF QP+PVTVS+K AVKF+P L +++GC P+PAV   G  SGGLK +G   G 
Sbjct  1803986  IDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGTGGTSGC  1803807

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                      GSQ+Y R+ W  D WAIMYAWYFPKG        + R+    H+W  +VVWIDN
Sbjct  1803806  KEAGATGSQVYGRAVWYKDDWAIMYAWYFPKGF-------WSRWASRHHDWASIVVWIDN  1803648

Query  142      PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                P LE   ++G+S S     Y    P DV     T+ ++      + G     L +  G+ 
Sbjct  1803647  PALETPKMIGISTSEGDNDYRTAGPDDVYE---TTPRLRRVLAQVAGPPNF*LFKILGDT  1803477

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                Q LI W+QL+  AR +LN TD     FG A  K+P+ D  F+  L+K WPF
Sbjct  1803476  QPLIMWEQLTDEARITLNTTD-----FGKA--KVPMSDANFQGKLEKAWPF  1803345

 Score = 97.1 bits (240),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HD V PFPQP+PVT+S+K   KFKP +  D GC PYPAV   G ++GGLK S      
Sbjct  2462088  VNHDAVVPFPQPEPVTISEKVGAKFKPSIFFDGGCMPYPAVDAAGYITGGLKGSK-GSSA  2461912

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFP  111
                CT    GSQ+Y R+   N+ +AIM+A+YFP
Sbjct  2461911  CTDPPTGSQVYGRAT*HNNRYAIMFAFYFP  2461822

 Score = 54.3 bits (129),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 17/139 (12%)
 Frame = -1

Query  118      VPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS-ASIGYSKQAPTDVK-YVDGTS  175
                +P  F      RH+   V++WIDNP +E + +LG++ S  +  Y  +AP   + +++G +
Sbjct  2461828  LPEFFAGLASRRHDQASVILWIDNPEVETSLLLGIAASGGNSEYIGKAPAPAECFINGFT  2461649

Query  176      ---VKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGL  232
                   ++    + H+  +  L   E  G  Q LI WDQ++  AR +L+  D     FG A  
Sbjct  2461648  PNLIRTLDTFPHI--DCTL---EKVGSPQSLIIWDQMTDAARATLSTAD-----FGKA--  2461505

Query  233      KMPLKDGVFEELLDKTWPF  251
                ++P  +  F + LD+  PF
Sbjct  2461504  QVPFNEYNFIKRLDEAAPF  2461448

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 48/80 (60%), Gaps = 6/80 (8%)
 Frame = +2

Query  25       DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDG--EC  82
                D+V P  QP+PVTVS+KT V FKPQ++   GC  +PAV   G  S GL    P DG   C
Sbjct  1062608  DKVEPLAQPEPVTVSEKTGVMFKPQIEYKLGCTSFPAVNTAGETSKGL----PADGLELC  1062775

Query  83       TGSRLGSQIYARSAWVNDVW  102
                  + LGSQ+Y R+ W N V 
Sbjct  1062776  DKAHLGSQVYGRATWFNGVC  1062835

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 63/139 (45%), Gaps = 28/139 (20%)
 Frame = +1

Query  130      HNWEYVVVWIDNPGLENATVLGVSMS-----------------ASIGYSKQAPTDVKYVD  172
                H+W+  VVWI+NP L +  V G+S S                 +   Y K      K+ +
Sbjct  1069990  HDWQNAVVWINNPALASPKVTGLSTSKRSETDYMKPVTMETFTSEESYDKLTTGLEKFFN  1070169

Query  173      GTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGL  232
                GTS K+      +LG   L+   D G FQDL+ WD+L + A+ +LN  D  +  F     
Sbjct  1070170  GTSPKLTS--TRILGPVFLRPATDPGVFQDLVMWDRLPAPAQTALNGPDIGRVSFN----  1070331

Query  233      KMPLKDGVFEELLDKTWPF  251
                     D  F++ L + WPF
Sbjct  1070332  -----DDRFQKKLKEAWPF  1070373

>PYIR:scaffold_4 pir_scaffold_4 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4:1:128628:1 
REF
Length=128628

 Score = 213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 142/228 (62%), Gaps = 15/228 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD V PF QP PVT+ QK A+KFKPQ+ I  GCHPYPAV   G+ SGGLK SG Q   
Sbjct  32553  IAHDAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  32732

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  G+Q+Y R+A   DV+A+MY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  32733  CKGSGWGTQVYGRAAAYKDVYALMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  32891

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P + N T+L V+ SA  GY K AP     VDGTS KV  Y + ++ N AL  T D GE Q
Sbjct  32892  PAVANPTILAVTPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKVVINHALDSTTDAGEKQ  33068

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               LI WDQL++ AR +L +T+     FG A   +P+KDG F   L   +
Sbjct  33069  PLIMWDQLTAAARSALENTN-----FGDA--NVPMKDGNFMTKLGNAY  33191

 Score = 207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 148/249 (59%), Gaps = 15/249 (6%)
 Frame = +3

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
              M F+ +  +A+ +LA   A  I HD V+PF +P+P T + + A+KFKPQ+ I  GC PYP
Sbjct  35499  MMFKVIIASALVALATVNAASIAHDAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYP  35678

Query  61     AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
              AV   G+ SGGLK SG Q   C GS  G+Q+Y R+A   D + IMY+WYFPK        
Sbjct  35679  AVDSAGNTSGGLKPSGSQSAGCKGSGWGTQVYGRAAQYKDAYGIMYSWYFPKDSP-----  35843

Query  121    DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                L   GHRH+WE+VVVWIDNP   N  +L VS SA  GYSK AP     VDGTS KV Y
Sbjct  35844  --LTGLGHRHDWEHVVVWIDNPNAANPKILAVSPSAHSGYSKYAPPKAGTVDGTSAKVDY  36017

Query  181    YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                  ++ N AL  T D GE Q LI WDQL++ AR +L +T+     FG A   +P+KDG 
Sbjct  36018  TSKVVI-NHALDSTTDAGEQQPLIMWDQLTAAARSALENTN-----FGDA--NVPMKDGN  36173

Query  241    FEELLDKTW  249
              F   L   +
Sbjct  36174  FMNKLANAY  36200

 Score = 195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 130/220 (59%), Gaps = 15/220 (7%)
 Frame = -3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD V PF QP  VT  QK  VKFKPQ+ I  GCHPYPAV   G+ SGGL  +G  D  
Sbjct  30661  IAHDAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGSSDAG  30482

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  G+Q+Y R    N V+A+MY+WYFPK    T         GHRH+WE+VVVWIDN
Sbjct  30481  CKGSGYGTQVYGRGVAYNGVYALMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDN  30323

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P   +  +L +S SA  GY K AP     VDG S KV  Y + ++ N AL  T   GE Q
Sbjct  30322  PDAASPVILAISPSAHSGYEKYAPPKTDTVDGNSAKVD-YKSIVVINHALDSTTTAGEQQ  30146

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               LI WDQL++ AR +L +TD     FG A   +P+KDG F
Sbjct  30145  PLIMWDQLTAAARTALENTD-----FGDA--NVPMKDGNF  30047

>PHIF:NW_003303746.1 Phytophthora infestans T30-4 supercont1.13 
genomic scaffold, whole genome shotgun sequence
Length=3221495

 Score = 211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                IGHD V+ FPQP+PVT+S+K  VKFKPQ++I  GC PYP V + G  SGGL+ SG   G 
Sbjct  2501507  IGHDDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQTSGNSRGG  2501328

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDN
Sbjct  2501327  CRGSGHGSQVYGRSTWMEGVWAIMYSWYFPKDFPSSR-------MGHRHDWEHAIVFIDN  2501169

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +    +L  S+S+  GY K  P     +DGTS+KV Y +   L N  L  T D G FQ
Sbjct  2501168  PEVAEPKILACSVSSHDGYKKYNPCPSYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQ  2500992

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQ+S+ AR +LN        FG A    P  DG F   L+K WPF
Sbjct  2500991  DLIMWDQMSNDARRALNSVH-----FGKA--NTPFNDGNFRPKLEKAWPF  2500863

 Score = 115 bits (289),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                IGHD V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  2522276  IGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGNSRGG  2522097

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG  113
                C GS  GSQ++  S W+  VWAIMY+    +G
Sbjct  2522096  CRGSGHGSQVFGHSTWMEGVWAIMYSMVLSQG  2522001

 Score = 105 bits (263),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 79/144 (55%), Gaps = 15/144 (10%)
 Frame = -2

Query  108      WYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTD  167
                WYFPK   ++         GHRH+WE+ +V+IDNP +    +L  S+S+  GY K  P  
Sbjct  2522017  WYFPKDSPSSR-------MGHRHDWEHAIVFIDNPEVAEPKILACSVSSHGGYKKYNPCP  2521859

Query  168      VKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLF  227
                   +DGTS+KV Y +   L N  L  T D G FQDLI+WDQ+S+ AR +LN        F
Sbjct  2521858  SYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQDLIKWDQMSNDARRALN-----SVSF  2521697

Query  228      GLAGLKMPLKDGVFEELLDKTWPF  251
                G A    P  DG F   L++ WPF
Sbjct  2521696  GKAN--TPFNDGNFRPKLERAWPF  2521631

 Score = 125 bits (313),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 90/161 (56%), Gaps = 15/161 (9%)
 Frame = +1

Query  91       IYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVL  150
                +Y RS W+  VWAIMY+WYFPK   ++         GHRH+WE+ +V+IDNP +    +L
Sbjct  2492707  VYGRSTWMEGVWAIMYSWYFPKDSPSSR-------MGHRHDWEHAIVFIDNPEVAEPKIL  2492865

Query  151      GVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLS  210
                  S+S+  GY K  P     +DGTS+KV Y +   L N  L  T D G FQDLI WDQ+S
Sbjct  2492866  ACSVSSHGGYKKYNPCPSYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGTFQDLIMWDQMS  2493042

Query  211      SLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                +  R +LN        FG A    P  DG F   L++ WPF
Sbjct  2493043  NDTRRALN-----SVHFGKA--NTPFNDGNFRPKLERAWPF  2493144

 Score = 92.0 bits (227),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                IGHD V+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G  SGGL+ SG   G 
Sbjct  2492510  IGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNEMGETSGGLQTSGSSRGG  2492689

Query  82       CTGSRLGSQIYARSAW  97
                C GS  G    AR  W
Sbjct  2492690  CRGS--GQCTAARRGW  2492731

 Score = 149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 93/141 (66%), Gaps = 8/141 (6%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HD V+PF QP+PVT+S+K AVKFKPQ++I  GC PYPAV   G  SGGLK +G   G 
Sbjct  2408841  VDHDAVKPFSQPEPVTISEKAAVKFKPQVQIRTGCEPYPAVSYYGETSGGLKTTGKSRGN  2408662

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C G   GSQ+Y RS W+NDVWAIMY+WYFPK   ++         GHRH+WE+ VV+I+N
Sbjct  2408661  CGGYGHGSQVYGRSTWINDVWAIMYSWYFPKDSPSS-------GMGHRHDWEHAVVFINN  2408503

Query  142      PGLENATVLGVSMSASIGYSK  162
                P +     L V++    G ++
Sbjct  2408502  PDVPTRRFL-VALCQPTGATR  2408443

 Score = 146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 119/235 (51%), Gaps = 31/235 (13%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HDQVRPF QP PV++S+K AVKFKPQL I  GCHPYPAV   G  SGGL  SG     
Sbjct  1624058  LNHDQVRPFGQPSPVSISEKAAVKFKPQLHISNGCHPYPAVNAAGETSGGLATSGAPSAG  1623879

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRH--NWEYVVVWI  139
                C GS  GSQ+Y RS W    WAIMY WYFPK   +T         GHRH  + +      
Sbjct  1623878  CKGSG*GSQVYGRSTWHKGRWAIMY*WYFPKDSPST-------GLGHRHRVD*QS*CCQS  1623720

Query  140      DNP---GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTED  196
                ++P    + +  VL V                +   G + KV Y  N  + N AL  T+ 
Sbjct  1623719  EDPRRHAVRSQWVLQVRTPKG-----------RNRTGNTAKVNYESNWPV-NHALDSTDK  1623576

Query  197      TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 GE Q LI WDQ++  AR SLN        FG A +  P+ +G F + +    P+
Sbjct  1623575  GGETQPLIMWDQMTDAARRSLNTVS-----FGSANV--PMNEGNFMQKIGNASPW  1623432

 Score = 145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 103/255 (40%), Positives = 127/255 (50%), Gaps = 31/255 (12%)
 Frame = -1

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
                MN R  FV  +A+LA      + HDQVRPF QP PV++S+K AVKFKPQL I  GCHPYP
Sbjct  1624121  MNLRIFFVTIVAALAATDVGALNHDQVRPFGQPSPVSISEKAAVKFKPQLHISNGCHPYP  1623942

Query  61       AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
                AV   G  SGGL  SG     C GS  GSQ+Y RS W    WAIMY WYFPK   +T   
Sbjct  1623941  AVNAAGETSGGLATSGAPSAGCKGSG*GSQVYGRSTWHKGRWAIMY*WYFPKDSPST---  1623771

Query  121      DFLRFFGHRHNW--EYVVVWIDNP---GLENATVLGVSMSASIGYSKQAPTDVKYVDGTS  175
                      GHRH    +      ++P    + +  VL V                +   G +
Sbjct  1623770  ----GLGHRHRVD*QS*CCQSEDPRRHAVRSQWVLQVRTPKG-----------RNRTGNT  1623636

Query  176      VKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMP  235
                 KV Y  N  + N AL  T+  GE Q LI WDQ++  AR SLN        FG A   +P
Sbjct  1623635  AKVNYESNWPV-NHALDSTDKGGETQPLIMWDQMTDAARRSLN-----TVSFGSA--NVP  1623480

Query  236      LKDGVFEELLDKTWP  250
                + +G F + +    P
Sbjct  1623479  MNEGNFMQKIGNASP  1623435

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 58/110 (53%), Gaps = 8/110 (7%)
 Frame = -2

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P   +A +LG S+S   GY K  P     +DGTS+K+ Y ++    N    +T D G FQ
Sbjct  2408503  PRCPDAKILGCSVSTHGGYKKYNPCPPWVIDGTSLKIRYKHS-WPKNHDFDVTGDGGSFQ  2408327

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI WDQ+S+ AR +LN        FG A +  P KDG F   +   WPF
Sbjct  2408326  DLIMWDQMSTDARRALN-----SDSFGKANV--PFKDGSFHPTVKNAWPF  2408198

>PHCA:scaffold_39 PHYCAscaffold_39
Length=591971

 Score = 211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 139/234 (59%), Gaps = 23/234 (10%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHDQV+PFPQP+PVT+S+K  VKFKPQ++I  GC PYPAV + G   GGLK +G   G 
Sbjct  131946  IGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSRGN  131767

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W   VWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  131766  CGGSGYGSQVYGRSTWYQGVWAIMYSWYFPKDSPSPK-------MGHRHDWEHAIVFIDN  131608

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDT  197
               P +    +L  S+S+  GY+K  P     +DGTS+KV Y     YNH      L  T D 
Sbjct  131607  PEVSEPKILACSVSSHSGYTKYNPCPPWVIDGTSLKVRYKHAWPYNH-----DLDATGDG  131443

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               G+FQDLI W+QL+  AR +LN        FG A    P  D  F   ++  WPF
Sbjct  131442  GKFQDLIMWNQLTEDARRALNSVS-----FGKA--NTPFSDDKFMPKIENAWPF  131302

>PHCA:scaffold_162 PHYCAscaffold_162
Length=48736

 Score = 211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 145/231 (63%), Gaps = 12/231 (5%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP+P T S+K+AVK+KPQL+I        AVQ DGS+S GLKW+G  DG+
Sbjct  1264  INHDKVQPFTQPEPTTNSEKSAVKYKPQLRIST------AVQADGSVSAGLKWTGWSDGD  1103

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  1102  CKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHYWSYAIVWMDS  935

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                +N+T+LGVSMSA +GYSK+     KY VDGT+VK   Y +      A+ LT   G+ 
Sbjct  934   DVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESYNSF*GRKIAVGLTTKEGDI  755

Query  201   QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W+QL+  A  +    DW      +  L +P+ D VF   L K +PF
Sbjct  754   QDLITWEQLTDEATDAEIDVDWSIRKVVIV*L-IPIADEVFMNTLKKNYPF  605

>PHKE:scaffold_523 scf_22126_523.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_523.1:1:20374:1 
REF
Length=20374

 Score = 210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 158/253 (62%), Gaps = 24/253 (9%)
 Frame = +3

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MN R + VA +A+L V  A  I HD+V+PFPQP+PVTVS+K A+KFKPQL I+ GC  YP
Sbjct  3408  MNLRMITVATLATLTVIGAISIDHDKVQPFPQPEPVTVSEKAAIKFKPQLNINFGCGVYP  3587

Query  61    AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             AV   G  +GGLK +G   G C  S LG Q+Y R+AW ND+WAIMYAWYFPK        
Sbjct  3588  AVNAAGETNGGLKGTGGVSG-CKVSLLGPQVYGRAAWYNDIWAIMYAWYFPK--------  3740

Query  121   DF-LRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDV-KYVDGTSVKV  178
             DF + F   RH+W+ V+VWIDNP LE + +LG+S S S GY K AP    + ++GT+  +
Sbjct  3741  DFWVTFSIRRHDWKNVIVWIDNPALETSKILGLSTSQSSGYYKAAPVPAFELINGTTPMM  3920

Query  179   AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
             +      L ++ L  T   G+F DLI WDQL+  AR +LN TD     FG A  K+P  D
Sbjct  3921  S------LKDSYLYPTTGAGDFHDLIMWDQLTDAARAALNTTD-----FGSA--KVPFSD  4061

Query  239   GVFEELLDKTWPF  251
               F E L+  WPF
Sbjct  4062  DNFSEKLENAWPF  4100

>HYAP:scaffold_97 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_97:1:263320:1 
REF
Length=263320

 Score = 209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 140/229 (61%), Gaps = 15/229 (7%)
 Frame = +2

Query  23      GHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGEC  82
               GHD + PF +P PVT+S+K  VKFKP L ++ GC PY AV  +G  SGGL+ SG  +  C
Sbjct  185636  GHDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDPESGC  185815

Query  83      TGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNP  142
                GS+ GSQ+Y RS W NDVWAIMYAWYFPK          +   GHRH+WE VVV+I++P
Sbjct  185816  RGSKYGSQVYGRSTWYNDVWAIMYAWYFPKDSP-------MLLMGHRHDWENVVVFINDP  185974

Query  143     GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                    T+LG S S   GY K AP     ++G+SV + Y ++  L N AL +T+D G +QD
Sbjct  185975  DEVEPTILGCSTSWHSGYIKYAPCPTDSINGSSVMIKYEHSFPL-NHALNITKDAGAYQD  186151

Query  203     LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               LI W Q+  LAR +LN TD+ + +        P+ D  F E ++  WPF
Sbjct  186152  LIMWHQMPDLARRALNDTDFGKAI-------TPMNDLNFMEKIEAAWPF  186277

>PHRA:scaffold_98
Length=165592

 Score = 208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 145/234 (62%), Gaps = 22/234 (9%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+PVTVS+K AV+FKP L+ID GCHPYPAV   G  + GLK +GP  G+
Sbjct  140444  IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGPSSGD  140623

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F    G RH+W  VVVW+DN
Sbjct  140624  CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFGE--GGRHDWANVVVWLDN  140782

Query  142     PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT---  197
               P +E  T++GVS S+ +  Y K  P     + GT+  + Y  + +  N      + T   
Sbjct  140783  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLADDM--NNGFHTVDTTWLP  140956

Query  198     -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                GEFQDLI W+QL+  AR +L+ TD+        G  +P  D  F+  L+K WP
Sbjct  140957  GGEFQDLIMWEQLTDEARAALSDTDF--------GALVPFIDANFKANLEKAWP  141094

 Score = 181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 135/234 (58%), Gaps = 20/234 (9%)
 Frame = -2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD+V+PFPQPDPVT+S+K  VKFKPQL  + GC  YPAV   G  SGGLK +G   G 
Sbjct  46098  IAHDEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLKGNGDISG-  45922

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
              C  S LGSQ+Y RS W NDVWAIMYAWYFPKG        F     H RH+W   V+WID
Sbjct  45921  CEISLLGSQVYGRSEWYNDVWAIMYAWYFPKG--------FWDADPHWRHDWSNAVLWID  45766

Query  141    NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG--  198
              NP LEN  +LG+S+S S        T    ++ T+  +       + + AL  ++  G  
Sbjct  45765  NPALENPKILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPS-VASAALVSSDVCGRP  45589

Query  199    -EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               E QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L++ WP 
Sbjct  45588  LETQDLIMWGQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLEEAWPL  45445

>PHRA:scaffold_1409
Length=4922

 Score = 208 bits (529),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 149/235 (63%), Gaps = 20/235 (9%)
 Frame = +2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP+PVTVS+K AV+FKP L+ID GCHPYPAV   G  SGGLK +G   G+
Sbjct  3482  IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGMPSGD  3661

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+DN
Sbjct  3662  CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQ-----PTFSK--GKRHDWANVVVWLDN  3820

Query  142   PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLTEDT  197
             P LE  T++GVS S+ +  YSK  P     + GT+  + Y     NH  G  ++  T  T
Sbjct  3821  PALERPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNH--GFHSVDTTWKT  3994

Query  198   -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              GEFQDLI W+QL+  AR + N TD+ +         +P  D  F+  L+K WP+
Sbjct  3995  GGEFQDLIMWEQLTDEARGAFNDTDFGEH------APVPFIDPNFKANLEKAWPY  4141

>PHRA:scaffold_436
Length=12848

 Score = 206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 145/234 (62%), Gaps = 22/234 (9%)
 Frame = -2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP+PVTVS+K AV+FKP L+ID GCHPYPAV   G  + GLK +G   G+
Sbjct  3052  IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGMPSGD  2873

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +A       +   G RH+W  VVVW+DN
Sbjct  2872  CKGSGLGSQVYARAVWHSDLWAIMYAWYFPKDKA-------IFGKGERHDWANVVVWLDN  2714

Query  142   PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT---  197
             P +E  T++GVS S+ +  Y K  P     + GT+  + Y  N +  N      + T   
Sbjct  2713  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDM--NNGFHTVDTTWKT  2540

Query  198   -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              GEFQDLI W+QL+  AR +L++TD+        G  +P  D  F+  L+K WP
Sbjct  2539  GGEFQDLIMWEQLTDEARAALSNTDF--------GALVPFIDANFKANLEKAWP  2402

>PHRA:scaffold_29
Length=529199

 Score = 206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 144/233 (62%), Gaps = 16/233 (7%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PF QPDPVT+S+KTAV+FKP L+ID GCH YPAV   G  + GLK +G   G+
Sbjct  382630  IGHDKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSYPAVNAAGETNAGLKGTGRPSGD  382451

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y RS W  D+WAIMYAWYFPK          +   G RH+W  VVVW+DN
Sbjct  382450  CKGSSLGSQVYGRSVWHGDLWAIMYAWYFPKDMP-------ILGKGKRHDWANVVVWLDN  382292

Query  142     PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYYNHL-LGNTALQLT-EDTG  198
               P  E  T++GVS SA +  Y+K  P     + G +  ++Y  + L  G   L +  E  G
Sbjct  382291  PAHERPTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMISYLADDLNYGYHTLDMNWEAGG  382112

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               EFQDL+ W+QL+  AR +LN TD     FG   L +P  D  F+  L+K WP+
Sbjct  382111  EFQDLVMWEQLTDEARAALNDTD-----FGENAL-VPFIDANFKANLEKAWPY  381971

>PHKE:scaffold_444 scf_22126_444.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_444.1:1:28542:1 
REF
Length=28542

 Score = 206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 148/235 (63%), Gaps = 18/235 (8%)
 Frame = -2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              IGHD+V+PFPQPDPVTVS+KTAVKFKP L+ID+GCH YPAV     +SGGLK +G  DG+
Sbjct  13865  IGHDKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGTGSDDGD  13686

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              CTGS LGSQ+Y R+ W ND+WAIMY+WYFPK     +   F +  G RH+W  VVVW+++
Sbjct  13685  CTGSSLGSQVYGRAVWYNDLWAIMYSWYFPKDMPVAI---FKK--GRRHDWVNVVVWLND  13521

Query  142    PGLENATVLG-VSMSASIGYSKQAPTDVKYVDGTSVKVAYY---YNHLLGNTALQLTEDT  197
              P  E   +LG    S    YSK  P  V  ++G S  + Y    Y+H  G   +  T + 
Sbjct  13520  PAAEKPIMLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDH--GYHTVDTTRNR  13347

Query  198    -GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               GEFQDL+ W+QL+  AR SLN T + +T       ++P  D  F   L+K WP+
Sbjct  13346  GGEFQDLVMWEQLTDAARISLNETAFGET------AQVPFIDENFVANLEKAWPY  13200

>PHKE:scaffold_495 scf_22126_495.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_495.1_contig_1:1:23437:1 
REF
Length=23437

 Score = 202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 140/232 (60%), Gaps = 17/232 (7%)
 Frame = +3

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+P T S+K  +KFKPQL I  GC  YPAV   G ++GGL+ +G   G 
Sbjct  162  IDHDKVQPFAQPEPTTNSEKAGIKFKPQLNIVRGCDSYPAVNDAGEITGGLRGTGYTSG-  338

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C G RLGSQ+Y R+ W ND+WAIMYAWYFPKG           F   RH+W   VVWIDN
Sbjct  339  CEGPRLGSQVYGRATWHNDIWAIMYAWYFPKGFQGD-------FSSRRHDWASAVVWIDN  497

Query  142  PGLENATVLGVSMSASIG-YSKQAPT-DVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            P L+   +LGVS S S   YSK+    D    +G++V++ +  +   G+  L+ T   GE
Sbjct  498  PALDAPKLLGVSTSTSDSKYSKKVDVPDFVITNGSTVRLNHATSMAFGSAYLETTSSIGE  677

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            FQDLI W+QL+  AR +L+  D     FG A  K+P  D  F E L+K WPF
Sbjct  678  FQDLILWEQLTDAARTALDTVD-----FGDA--KVPFIDANFAEKLEKAWPF  812

 Score = 187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 136/232 (59%), Gaps = 18/232 (8%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD V+P PQP+PVTVS+K +VKFKPQL I  GC  YPAV  +G+ SGGLK +G Q G 
Sbjct  15185  IDHDTVKPIPQPEPVTVSEKASVKFKPQLTIKQGCASYPAVNVEGNTSGGLKPTGWQTG-  15361

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHR-HNWEYVVVWID  140
              C    L SQ+Y R+ W ND+WAIMYAW+FPKG        F +++  R H+W  VVVWID
Sbjct  15362  CKSPVLDSQVYGRATWHNDIWAIMYAWHFPKG--------FWQYYSARWHDWANVVVWID  15517

Query  141    NPGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
              NP LE   +LG+S S     Y K A      +DGTS K  +    L G   +  T  +  
Sbjct  15518  NPELETPKILGLSTSHGDNKYGKIALAPGFAIDGTSPKFYHTPEVLAGQPFMDYTYVSRL  15697

Query  200    FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI WDQL   A+ +LN TD     FG A  K+P  D  F E L K WPF
Sbjct  15698  SQDLIMWDQLPDAAQMALNTTD-----FGNA--KVPFIDEYFNEKLKKAWPF  15832

 Score = 115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 88/162 (54%), Gaps = 9/162 (6%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD+++PF QP  +  S+K  +KFKP+L I   C PYPA    G  +GGLK +G     
Sbjct  19979  IDHDKIQPFAQPVTIMDSEKADIKFKPELHIITRCVPYPAFNAAGEFTGGLKGTG-GISS  20155

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C G  LGSQI  R+ W NDVWAIM+AWYFPK     +  D        ++W  ++VWIDN
Sbjct  20156  CEGPHLGSQICGRAGWQNDVWAIMHAWYFPKPFDGGMLND-------HYDWGSLIVWIDN  20314

Query  142    PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYY  182
                LE+  +  +SMS +   Y    P      D   ++V + Y
Sbjct  20315  LALESPMIKRLSMSQNNSDYDNTTPVLTFSPDFGRIRVHWVY  20440

 Score = 55.5 bits (132),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +3

Query  97     WVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSA  156
              W ND+WAIMY WYF K   +        F   RH++  VVVWIDN  LE   ++GVS+S 
Sbjct  16401  WHNDMWAIMYIWYFLKNFWSA-------FTTRRHDFANVVVWIDNSALETPKIVGVSLST  16559

Query  157    S  157
              S
Sbjct  16560  S  16562

 Score = 38.5 bits (88),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 0/35 (0%)
 Frame = +2

Query  39     SQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK  73
              S+K   KFKP L I  GC   P V   G +SGG+K
Sbjct  16247  SKKRCFKFKPLLAIKEGCDSLPVVNAGGKISGGMK  16351

 Score = 33.1 bits (74),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 35/72 (49%), Gaps = 7/72 (10%)
 Frame = +3

Query  174    TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLK  233
              T ++ + +   L G+  +  T+  G  QDLI W+QL    R +LN  D     FG A  K
Sbjct  20379  TPLQFSRFLRTLAGSAYIGYTKKPGYTQDLIMWEQLPEAVRTALNTGD-----FGSA--K  20537

Query  234    MPLKDGVFEELL  245
              + + +  F E L
Sbjct  20538  ISISNANFAERL  20573

>PHKE:scaffold_1552 scf_22126_1552.1_contig_1 dna:supercontig 
supercontig:PhyKer238_432v1:scf_22126_1552.1_contig_1:1:1491:1 
REF
Length=1491

 Score = 192 bits (489),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 136/231 (59%), Gaps = 16/231 (7%)
 Frame = -1

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+ FPQP+PVT S+K AVKFKPQL I  GC PYPAV   G  SGGLK +    G 
Sbjct  969  IDHDKVQSFPQPEPVTDSEKAAVKFKPQLTIHIGCAPYPAVNAAGETSGGLKGTKGATG-  793

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C  S LGSQIY R+AW ND+WAIMYAWYFPK      P   +R    RH+W+ VV+WIDN
Sbjct  792  CKVSLLGSQIYGRAAWHNDIWAIMYAWYFPKRFWLDAP---IR----RHSWKNVVIWIDN  634

Query  142  PGLENATVLGVSMSASIGYSKQAP-TDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
            P LE   +LG+S     GY K AP +    ++GT+ K        + +  L  T + G+ 
Sbjct  633  PALETPKILGISTDQGSGYGKIAPVSKFDIINGTAPKFGVSTAPYVSDGYLYSTSEDGDS  454

Query  201  QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            QDLI W+QL+  AR +L   D     FG A   +P  D  F E L+  WPF
Sbjct  453  QDLIMWEQLTDAARAALETAD-----FGRA--DVPFIDDKFSEELEDAWPF  322

>PHKE:scaffold_364 scf_22126_364.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_364.1:1:35790:1 
REF
Length=35790

 Score = 197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 140/231 (61%), Gaps = 16/231 (7%)
 Frame = +2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PFPQP+P+T S+K AVKFKPQL ID GC PYPAV   G  SGGLK +    G 
Sbjct  1178  IDHDKVQPFPQPEPITDSEKAAVKFKPQLCIDVGCAPYPAVNAAGETSGGLKGTRGTSG-  1354

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C  S LGSQIY  +AW ND+WAIMYAWYFPK         +L     RH+W+ VV+WIDN
Sbjct  1355  CKVSFLGSQIYG*AAWYNDIWAIMYAWYFPKHF-------WLEDPTRRHDWKNVVIWIDN  1513

Query  142   PGLENATVLGVSMSASIGYSKQAP-TDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
             P LE    LG+S +   GY K AP +    ++GT+ K +   + +   T + LT   G+ 
Sbjct  1514  PTLETPKTLGISTAQGSGYGKIAPVSKADIINGTAPKFSAEISPIWTGTYIFLTTKDGDS  1693

Query  201   QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W+QL+  AR +L+ TD     FG A   +P  D  F E L+  WPF
Sbjct  1694  QDLIMWEQLTDAARAALDSTD-----FGRA--DVPFADDNFSEELEDAWPF  1825

>PHRA:scaffold_75
Length=257998

 Score = 197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 137/228 (60%), Gaps = 14/228 (6%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD V PF QP P T  QK AVK KPQ+ I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  145162  IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  144983

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GSRLGSQIY R A    V+A MY+WY PK +  T+P       G+RH+WE  VVWI N
Sbjct  144982  CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ--TLPG-----LGYRHDWEACVVWISN  144824

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 LE   ++ +S+S    Y    P D  Y++G S K+ Y  + ++ + +L  T   GE Q
Sbjct  144823  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  144644

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               DLI WDQL++ AR +L  TD     FG  G ++P KD  F+E L K +
Sbjct  144643  DLIMWDQLTAAARTALEDTD-----FG--GARVPFKDANFKEKLAKAY  144521

 Score = 197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 135/228 (59%), Gaps = 14/228 (6%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD V PF QP P T  QK AVK KPQ+ I  GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  136276  IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  136097

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GSRLGSQIY R A    V+A MY+WY PK +        L   G+RH+WE  VVWI N
Sbjct  136096  CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQT-------LPGLGYRHDWEACVVWISN  135938

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                 LE   ++ +S+S    Y    P D  Y++G S K+ Y  + ++ + +L  T   GE Q
Sbjct  135937  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  135758

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               DLI WDQL++ AR +L  TD     FG  G ++P KD  F+E L K +
Sbjct  135757  DLIMWDQLTAAARTALEDTD-----FG--GARVPFKDANFKEKLAKAY  135635

>PHRA:scaffold_1415
Length=4047

 Score = 197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 137/231 (59%), Gaps = 16/231 (7%)
 Frame = +2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             + HD+V+PFPQP PVT+S+K  VKFKPQL I AGC PYPAV   G  SGGLK +G  + +
Sbjct  2660  VDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  2836

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C  S LGSQ+Y R+ W N VWAIMYAWYFPKG   TVP         RH+W   VVWIDN
Sbjct  2837  CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVP-------YWRHDWSNAVVWIDN  2995

Query  142   PGLENATVLGVSMSASIGY--SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
             P LEN  +LG+S+S S     +   P   + ++  +    Y Y   L    L+L+   G 
Sbjct  2996  PALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRGP  3175

Query  200   FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              QDLI W QL+  AR +LN    DQ  FG     +P+ D  F +LL++ WP
Sbjct  3176  VQDLIMWGQLTDAARAALN----DQDNFGRT--DVPISDDHFPKLLEEAWP  3310

 Score = 193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 136/231 (59%), Gaps = 15/231 (6%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             + HD+V+PFPQP PVT+S+K  VKFKP L I  GC  YPAV   G  SGGLK SG     
Sbjct  1654  VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  1475

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  1474  CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  1316

Query  142   PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
             P LEN   LG+S+S S   Y      +  + +G +  ++ Y   +   T L    D+GEF
Sbjct  1315  PALENPKALGLSISRSENKYGSTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEF  1139

Query  201   QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  1138  QDLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKRLEEAWPF  1004

>PLHA:NW_020187213.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_292, whole genome shotgun sequence
Length=1316030

 Score = 197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 136/230 (59%), Gaps = 15/230 (7%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +DQVR F QP P T+SQ+ A+ FKPQL I  GC PYPAV + G  SGGL      + +
Sbjct  1300455  IPYDQVRGFRQPKPTTISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLPKDADTETK  1300634

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS+  SQ+Y RS W NDVW +M++WYFPK              GHRH+WE VV++ID+
Sbjct  1300635  CHGSQFNSQVYGRSTWFNDVWVMMFSWYFPKDSP-------FPLLGHRHDWENVVIFIDS  1300793

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +    +LG SMS    Y K AP      +GTSVKV Y  +  L N AL +TE  G FQ
Sbjct  1300794  PKVPLPKILGCSMSYHSEYIKFAPCPTFATNGTSVKVKYEDSFPL-NHALNVTEKEGTFQ  1300970

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DLI W+QL  + R SLN TD     FG A +  P+ D  F + +++ WPF
Sbjct  1300971  DLIMWNQLPPIVRKSLNDTD-----FGSANV--PMNDWNFLKKVEEAWPF  1301099

>PYIW:scaffold_3359 piw_scaffold_3359 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3359:1:3265:1 
REF
Length=3265

 Score = 196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 127/215 (59%), Gaps = 15/215 (7%)
 Frame = +2

Query  27    VRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSR  86
             V PFP+P P ++S   A+KFKPQ+ I  GCHPYPAV   G+  GGLK SG Q   C GS 
Sbjct  1871  VVPFPEPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGGGLKPSGSQSAGCKGSG  2050

Query  87    LGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLEN  146
              G+Q+Y RS W N  WAIMY+WYFPK    T         GHRH+WE+VVVWIDNP   N
Sbjct  2051  WGTQVYGRSTWFNGKWAIMYSWYFPKDSPFT-------GLGHRHDWEHVVVWIDNPANAN  2209

Query  147   ATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQW  206
               +L V+ SA  GY K AP     VDG S KV Y    ++ N AL  T   GE Q LI W
Sbjct  2210  PAILAVTPSAHSGYKKYAPPKSGTVDGNSAKVEYKAIIVI-NHALDSTTTGGEQQPLIMW  2386

Query  207   DQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
             DQL+  AR  L +TD     FG A   +P+KDG F
Sbjct  2387  DQLTDAARSGLENTD-----FGSA--NVPMKDGNF  2470

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG  55
             I HD V PF QP PVT+ Q  A+KFKPQ+ I  G
Sbjct  1684  IAHDAVVPFAQPAPVTLEQTVALKFKPQIHIANG  1785

>PHKE:scaffold_242 scf_22126_242.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_242.1:1:53838:1 
REF
Length=53838

 Score = 196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              IGHD++ P+ Q  P ++S+K AV+FKP+L+I +GC PYPAV   G   GGLK +G   G+
Sbjct  25932  IGHDEITPWYQEVPDSISEKAAVRFKPRLRIASGCDPYPAVNSLGQTGGGLKPTGNPRGK  26111

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C G+  G+Q+Y RS W  D WAIMY+WYFPK   +          GHRH+WE+ +VWIDN
Sbjct  26112  CRGNGAGAQVYGRSRWHYDRWAIMYSWYFPKDSPSP-------GLGHRHDWEHAIVWIDN  26270

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P +EN  ++G + S+  GY K +      ++G ++KV Y+ +  + N  +QLT+  G FQ
Sbjct  26271  PDVENPKIIGAATSSHNGYEKYSSVPASCLEGDALKVEYFCDWPM-NHEMQLTDTVGGFQ  26447

Query  202    DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              DL+ WDQ++  AR +LN        FG A    P  DG F   LDK WP+
Sbjct  26448  DLVMWDQMTDEARQALNTVS-----FGKA--NCPFNDGNFGGKLDKAWPY  26576

>PHRA:scaffold_91
Length=158530

 Score = 196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 134/230 (58%), Gaps = 14/230 (6%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PFPQP PVT+S+K  VKFKP+L I  GC  YPAV   G  SGGLK +G  D  
Sbjct  149399  IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  149223

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W  VVVWIDN
Sbjct  149222  CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCP-------YWRHDWSNVVVWIDN  149064

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               P +E + VLG+S+S S           + +   +  + Y Y    G+  L    D G+FQ
Sbjct  149063  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  148884

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLI WDQL+  AR +LN    DQ  FG    ++P+ D  F E L+K WPF
Sbjct  148883  DLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPEHLEKAWPF  148752

>PHRA:scaffold_2433
Length=3296

 Score = 194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 123/197 (62%), Gaps = 8/197 (4%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HDQV PF +P PVT+S+K  VKFKPQL I  GCH YPAV + G   GGLK SG    +
Sbjct  2343  ISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSSK  2164

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQIY RS W +DVWAIMYAWYFPK  A+T         GHRH+WE+ V+WIDN
Sbjct  2163  CKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMASTT-------LGHRHDWEHAVIWIDN  2005

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P +    +LGVS+S+  GY+K     V  + GT+V + Y     L +  L LT   G+ Q
Sbjct  2004  PDVAEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPL-DHELSLTTKGGDLQ  1828

Query  202   DLIQWDQLSSLARYSLN  218
              LI W QL+  AR SL+
Sbjct  1827  PLIMWSQLTDAARNSLS  1777

 Score = 144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 110/195 (56%), Gaps = 16/195 (8%)
 Frame = +3

Query  55   GCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGR  114
            GCHPYP V +DG+ SGGL  +G +   C GS  GSQIY R+     V+A MY+WY PK  
Sbjct  3    GCHPYPVVDEDGNTSGGLAPTGSESAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE  182

Query  115  AATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGT  174
              T+P       GHRH+WE  VVW+D+  L++  ++ +S SA  GY+   P    Y DG 
Sbjct  183  --TLPG-----LGHRHDWEACVVWLDS--LDDQNIVALSASAHSGYNVYYPPSSSYFDGD  335

Query  175  SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKM  234
            S K+ Y  ++++ + +L  T   GE QDLI WDQL+  AR +L  TD     FG A   +
Sbjct  336  SAKIEYSSSYVVIDHSLSATSTAGETQDLIMWDQLTDAARTALEDTD-----FGSA--NV  494

Query  235  PLKDGVFEELLDKTW  249
            P K+  FE  L   +
Sbjct  495  PFKEANFETKLGNAY  539

>PHRA:scaffold_407
Length=13753

 Score = 193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 133/230 (58%), Gaps = 14/230 (6%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PFPQP PVT+S+K  VKFKP+L I  GC  YPAV   G  SGGLK +G  D  
Sbjct  8009  IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  7833

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W  VVVWIDN
Sbjct  7832  CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDKCP-------YWRHDWSNVVVWIDN  7674

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P +E + VLG+S+S S           + +   +  + Y Y    G+  L    D G+FQ
Sbjct  7673  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  7494

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              LI WDQL+  AR +LN    DQ  FG    ++P+ D  F E L+K WPF
Sbjct  7493  GLIMWDQLADAARAALN----DQDNFGRT--EVPISDDHFPEHLEKAWPF  7362

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 80/133 (60%), Gaps = 8/133 (6%)
 Frame = +3

Query  50    LKIDAGCHPYPAVQKDGSMSGGLKW-SGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAW  108
             L I  GC P+PAV KD + + GL   +     EC+ S LG Q+Y RS  ++D WA+MYA 
Sbjct  8148  LSITDGCMPFPAVYKDANTNEGLSAVTVGTSYECSSSPLGPQVYGRSTELSDKWAVMYA*  8327

Query  109   YFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS-ASIGYSKQAPTD  167
             YFP+ R   +P     +FGHR  WE+ +VW+DNP   ++TV+GV+++ AS  Y    P  
Sbjct  8328  YFPRDRTK-IP----SYFGHRRGWEHAIVWLDNPS-TSSTVVGVAITEASNRYRTCVPPA  8489

Query  168   VKYVDGTSVKVAY  180
              + ++GT  K+ Y
Sbjct  8490  PQVLNGTRFKLEY  8528

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 137/230 (60%), Gaps = 5/230 (2%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQVRPF QP+  T  +K AVK+KPQL I+ GCHPYPAV++DG++S GL+WSG  +G 
Sbjct  495118  IDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSGDHNGH  494939

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  S  GSQ+Y+R     D +AIMYAWYFPKG+  +          HRH+WE+ ++W D 
Sbjct  494938  CKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSRK----HHDEHRHDWEFGIIWFDR  494771

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                   ++++ GV+ +       + P    +V G+ +K+  Y         L+LT+  G+ Q
Sbjct  494770  DSDTDSSIAGVTTNIGRDLHDEVPLQPVHVVGSHIKLESYSTFWSAKQGLRLTKKKGDIQ  494591

Query  202     DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DLIQW+QL   A+ +LN  D+D T      + +P  D  F+E +  ++PF
Sbjct  494590  DLIQWEQLPKAAQTALNDADFD-TDKAKTPVVVPFNDNYFQEKVAASYPF  494444

 Score = 151 bits (382),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = +2

Query  25      DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
               DQV P  QP   T+ +KTAVK+KPQL+I+ GCH YPAV+ DG++S GLKWSG  DG C G
Sbjct  493244  DQVEPLMQPGATTIEEKTAVKYKPQLRIEDGCHSYPAVEDDGTVSAGLKWSGYHDGGCKG  493423

Query  85      SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
               S  GSQ+Y+RS    D  AIMYAWYFPKG+  +         GHRH+WE+ V+W+D    
Sbjct  493424  SS*GSQVYSRSGSYKDTNAIMYAWYFPKGKDRS----HKHHDGHRHDWEFAVIWLDGSSA  493591

Query  145     ENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                 + ++GVS +    +  + P    +V G+SVK+  Y         L+LT+  G F
Sbjct  493592  NESVIVGVSTTIGGKFRHEVPLQPTHVVGSSVKLESYSTCWGAKQGLRLTKKRGRF  493759

 Score = 42.7 bits (99),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +3

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               G+FQDLIQW QL+  AR +LN   +D        + +P  D  F+  L  ++PF
Sbjct  493752  GDFQDLIQWKQLTKAAREALNKASFDTGEVKTP-VVVPFNDNYFQARLAASYPF  493910

>PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.1, whole genome shotgun 
sequence
Length=4724858

 Score = 190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 136/225 (60%), Gaps = 14/225 (6%)
 Frame = +1

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
                HD+V+PF QP+P+T ++K AVKFKP L + AGCHPYPAV   G  S GLK +G  DGEC 
Sbjct  1825042  HDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPDGECE  1825221

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                GS LGSQ+Y+RS W  D WAIMYAWYFPK          L   G RH+W  +VVW+DNP 
Sbjct  1825222  GSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQNIG----LIKKGVRHDWVNLVVWLDNPA  1825389

Query  144      LENATVLGVSMSA-SIGYS-KQAPTDVKYVDGTSVKVAYYYNHLLG-NTALQLTEDTGEF  200
                L   T+L  S S    GY   + P     ++GT+ KV Y  ++  G +T  Q  E+ GE+
Sbjct  1825390  LAEPTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEE-GEY  1825566

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                QDLIQW+QL++  R +L +TD     FG     +P  D  FE  L
Sbjct  1825567  QDLIQWNQLTNATRKALENTD-----FGDFA-NVPFNDAYFETNL  1825683

 Score = 177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 129/224 (58%), Gaps = 13/224 (6%)
 Frame = -2

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
                HD+V+PF QP+P+T ++K A+K+KP L + AGCHPYPAV   G  S GLK +G  DGEC 
Sbjct  1864948  HDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPDGECE  1864769

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                GS LGSQ+Y+RS W    WAIMYAWYFPK     +    L   G RH+W  +VVW+DNP 
Sbjct  1864768  GSPLGSQVYSRSTWYEGKWAIMYAWYFPK----DIKDVGLIKKGLRHDWVNLVVWLDNPA  1864601

Query  144      LENATVLGVSMSASIGYSKQAP--TDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                L    +L  + S    Y K +      + ++G + KV Y  +   G   +    + GE+Q
Sbjct  1864600  LAKPKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQ  1864421

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
                DLIQW+QL+  AR +  + D     FG A +  P  D  FE  L
Sbjct  1864420  DLIQWNQLTDAAREAFENGD-----FGEANV--PFNDAYFETNL  1864310

 Score = 169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 145/255 (57%), Gaps = 21/255 (8%)
 Frame = -3

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPY  59
                MNFR   +    +L   +A  I HD+  P PQP+PVTVS+K AVKFKP+L I  G C  +
Sbjct  2078373  MNFRRFIITITVALLSVEAISINHDKAEPIPQPEPVTVSEKAAVKFKPELTIGKGTCASF  2078194

Query  60       PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
                PAV   G  SGGLK      G C  S LGSQ+Y R+ W NDVWAIMYAWYFPKG     P
Sbjct  2078193  PAVNTAGETSGGLK-GSGGTGGCKVSLLGSQVYGRAQWYNDVWAIMYAWYFPKGFWDASP  2078017

Query  120      PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKV  178
                     F+  RH+W   VVW+DNP  EN  VLG+S+S +S  Y+K+ P   +  +G +  V
Sbjct  2078016  -----FW--RHDWANAVVWVDNPAAENPKVLGISLSKSSDRYNKEVPA--RLANGNT-PV  2077867

Query  179      AYYYNHLLGNTALQLTEDTGEFQ--DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPL  236
                  YYN  L   AL  +  +      DLI W+QL+ +AR SLN    D+  FG + +  P 
Sbjct  2077866  VTYYNRGLNTAALMSSSTSSGESPLDLIMWEQLTDVARASLN----DKENFGRSDV--PF  2077705

Query  237      KDGVFEELLDKTWPF  251
                 D  F   L+K WPF
Sbjct  2077704  SDENFPGRLEKAWPF  2077660

>PHCA:scaffold_50 PHYCAscaffold_50
Length=475612

 Score = 190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 123/187 (66%), Gaps = 11/187 (6%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+P T S+ +AVK+KPQL+I        AVQ DGS+S GLKW+G  DG+
Sbjct  198616  INHDKVQPFTQPEPTTNSENSAVKYKPQLRIST------AVQADGSVSAGLKWAGWSDGD  198777

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR           FGHRH W Y +VW+D+
Sbjct  198778  CKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHYWSYAIVWMDS  198945

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                  +N+T+LGVSMSA +GYSK+     KY VDGT+VK   Y +      A+ LT   G+ 
Sbjct  198946  DVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESYNSF*GSKLAVGLTTKEGDI  199125

Query  201     QDLIQWD  207
                DLI WD
Sbjct  199126  *DLITWD  199146

>HYAP:scaffold_53 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_53:1:399428:1 
REF
Length=399428

 Score = 189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 132/231 (57%), Gaps = 15/231 (6%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I H +V+ F QP+PVT+S+K AV+  P L +  GC PYPAV + G  SGGLK +G  +G 
Sbjct  86476  IPHHEVKAFAQPEPVTISEKAAVRLNPTLLVTYGCQPYPAVNEFGQTSGGLKPTGDHNGH  86655

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS  GSQ+YARSAW  D WAIM+A+YFPK +         R    RH+WE+ VVWI N
Sbjct  86656  CKGSGHGSQVYARSAWFGDKWAIMFAYYFPKSQPR-------RSVSVRHSWEFAVVWIAN  86814

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE-DTGEF  200
              P     T+   + S + GY K    D   +DG  VK+  Y+ H   +  L+LT  D G  
Sbjct  86815  PEAPEKTLALTTRSFAYGYFKYTSFDASEMDGERVKLR-YWQHADSDLYLELTSLDGGVT  86991

Query  201    QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              + LI W+QL   AR +LN   W+       G K PL D  FE LL+ +WPF
Sbjct  86992  RPLIMWEQLPEKARCALNEATWN------GGFKCPLSDEAFEPLLNASWPF  87126

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 12/122 (10%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               +G + V  F Q  PV  ++K AV+  P + I   C P+P   K G +  GLK +G  DG+
Sbjct  366055  LGQEVVEAFAQQTPVAEAKKAAVRLNPTILIGDECLPFPVGNKLGQLGEGLKPTGANDGK  366234

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH--RHNWEYVVVWI  139
               C  S  GSQ Y R    N  W  +YA+Y PK          +   GH  RH+W   +++I
Sbjct  366235  CKRSGRGSQAYGRVTQ*NTKWVFLYAYYSPK----------IHADGHYARHDWNAAIIFI  366384

Query  140     DN  141
               ++
Sbjct  366385  NH  366390

>PHPA:scaffold_71 NW_008649057.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.71, whole genome shotgun 
sequence
Length=321883

 Score = 188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 147/253 (58%), Gaps = 17/253 (7%)
 Frame = -1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MNFR + +   A+LA   A+ + HD++ P PQPDPVT+S+K A+KFKPQL I  GC  +P
Sbjct  223291  MNFRGLVIIIAATLAAVTARRVDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFP  223112

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV   G  SGGLK S   +  C  + +GSQ+Y R+AW ND WAIMYAW+FPKG       
Sbjct  223111  AVNDGGDFSGGLKGSN-GNSACDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKGF------  222953

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPT-DVKYVDGTSVKV  178
                F+     R++W   VVWIDNP      VLG+S S S   Y +++P  D   ++G +  +
Sbjct  222952  -FMGVASRRYDWSSAVVWIDNPDFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLL  222776

Query  179     AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
                   + + G   L  +  TG+FQ LI W+QL+  AR +LN  D     FG A  ++P  D
Sbjct  222775  YRSISEVAGQPMLDYSSRTGDFQPLIMWEQLTDAARETLNTFD-----FGNA--QVPFND  222617

Query  239     GVFEELLDKTWPF  251
                 FEE L K +PF
Sbjct  222616  ANFEEKLKKAYPF  222578

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -1

Query  36      VTVSQKTAVKFKPQLKIDAG--CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYA  93
               V +S+K A KFKP L I  G  C  +P V     +SG LK     +  C  + LGSQ+Y 
Sbjct  250363  VHISEKAAAKFKPMLLIREGDGCVSFPVVNAAREISGRLK-EARGNSACDDAPLGSQVYD  250187

Query  94      RSAWVNDVWAIMYAWYFPKG  113
               R+ W ND WAIMYAWYFPKG
Sbjct  250186  RAGWHNDKWAIMYAWYFPKG  250127

>HYAP:scaffold_78 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_78:1:302119:1 
REF
Length=302119

 Score = 188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 132/232 (57%), Gaps = 17/232 (7%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               +GHD ++PFPQP PVT     A+K KP+L I  GCHPYPAV   G  S GLK SG  DG 
Sbjct  125969  VGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTSNGLKTSGDADGH  126148

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y R+ W    WAIMYAWYFPK       PD     G RH+WE+ +VWI+N
Sbjct  126149  CKGSGHGSQVYGRATWFRGKWAIMYAWYFPKD-----APD--EESGQRHDWEHAIVWINN  126307

Query  142     PGLENATVLGVSMSAS--IGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
               P ++   +L VS+S     GY K+        DGT +K++Y  +H   +  L LT + GE
Sbjct  126308  PKVKQPKILAVSVSCGKFFGYLKKVAPGPAVFDGTRLKLSYGADHKHEHR-LDLTAEKGE  126484

Query  200     FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W+QL+  AR + +   W   +       MPL D  ++  L + WPF
Sbjct  126485  DQDLIMWEQLTDEARCAFDTILWTNDM-------MPLNDAWYKHELTRAWPF  126619

 Score = 126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 11/160 (7%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I H QV+PFP+ DP T  +K AV+ KPQ++  +GCH Y AV   G  SGGLK +G  DG+
Sbjct  34691  IPHKQVQPFPELDPKTCPEKAAVR*KPQIEFVSGCHSYAAVDAAGHNSGGLKPTGRSDGQ  34870

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
              C GS  GS IY R     D+WAI+YA +FPK        D   F  G+ H +E+ +V I+
Sbjct  34871  CKGSGYGSHIYGRVTKYGDIWAIVYALHFPK--------DVANFRIGYSHVFEHFIV*IN  35026

Query  141    NPGL-ENATVLGVSM-SASIGYSKQAPTDVKYVDGTSVKV  178
              +P L EN+T+L V+  +   GY K+ P   +++DG SVK+
Sbjct  35027  DPALEENSTILTVTP*NRKDGYLKRVPPGPEFLDGDSVKL  35146

>PHIF:NW_003306740.1 Phytophthora infestans T30-4 supercont1.1923 
genomic scaffold, whole genome shotgun sequence
Length=3486

 Score = 187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 144/247 (58%), Gaps = 31/247 (13%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
             I HD+V+PF QP PVT+S+K A+ FKPQL    + C P+PA    G ++GGLK S   D 
Sbjct  1867  IDHDKVQPFSQPTPVTISEKAAITFKPQLYTPKSVCVPFPAANAYGEITGGLKGSNGNDA  1688

Query  81    ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
              C    LGSQ+Y R  W  DVWAIMYAWYFPKG        ++ F   RH+W+ VVVWID
Sbjct  1687  -CVFPPLGSQVYGRVGWFRDVWAIMYAWYFPKGF-------WMGFVSRRHDWKNVVVWID  1532

Query  141   NPGLENATVLGVSMSAS-IGYSKQA---PT------------DVKYVDGTSVKVAYYYNH  184
             NPGLE   +LGVSMS S   Y+K+    P+            D  Y+ G +  + +YY+ 
Sbjct  1531  NPGLEEPKILGVSMSKSETKYTKERRLWPSNFAGFYRMGRRYDRSYIYGFNTFLRFYYHF  1352

Query  185   LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
              +G   L L+E  GE+QDLI W+QL+ +AR +LN ++          +++P+ D  FE  
Sbjct  1351  DVGTPNLYLSEWEGEYQDLIMWEQLTDVARAALNGSN------NFEEVEVPISDEHFETR  1190

Query  245   LDKTWPF  251
             LD+ W F
Sbjct  1189  LDEAWLF  1169

>PHRA:scaffold_108
Length=150424

 Score = 187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 138/231 (60%), Gaps = 16/231 (7%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              + HD+V+PFPQP PVT+S+K  VKFKPQL I  GC  YPAV   G  SGGLK SG   G 
Sbjct  37174  VDHDKVQPFPQPAPVTISEKAGVKFKPQLHITTGCTSYPAVNAAGETSGGLKGSGGTSG-  37350

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C    LGSQ+Y R+ W NDV+AIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  37351  CMLPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  37509

Query  142    PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
              P  +   +LG+S+S S   Y K    +  + +G +  ++ Y   +   T L    D+GEF
Sbjct  37510  PAHKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEF  37686

Query  201    QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  37687  QDLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKRLEEAWPF  37821

 Score = 182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 133/232 (57%), Gaps = 17/232 (7%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              + HD+V+PFPQP PVT+S+K  VKFKP L I  GC  YPAV   G  SGGLK SG     
Sbjct  93605  VDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTSG  93784

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C    LGSQ+Y R+ W NDVWAIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  93785  CALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  93943

Query  142    PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE--DTG  198
              P LEN   LG+S+S S   Y      D  +  GT+  ++ Y   +    AL  +   +  
Sbjct  93944  PALENPKALGLSISRSENKYGSTYTDDSVFEYGTTPSLSRYLPPMQ-TAALSTSSFPNDF  94120

Query  199    EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              E QDLI WDQL+  AR +LN    DQ  FG     +P+ D  F +LL++ WP
Sbjct  94121  ELQDLIMWDQLTDAARAALN----DQDNFGRT--DVPISDDHFPKLLEEAWP  94258

 Score = 169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 122/213 (57%), Gaps = 16/213 (8%)
 Frame = -2

Query  40     QKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVN  99
              +K AVKFKPQL I AGC PYPAV   G  SGGLK +G  + +C  S LGSQ+Y R+ W N
Sbjct  92178  KKPAVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELDCILSLLGSQVYGRAGWYN  92002

Query  100    DVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG  159
               VWAIMYAWYFPKG   TVP         RH+W   VVWIDNP LEN  +LG+S+S S  
Sbjct  92001  GVWAIMYAWYFPKGFWDTVP-------YWRHDWSNAVVWIDNPALENPKILGLSLSTSEN  91843

Query  160    Y--SKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSL  217
                 +   P   + ++  +    Y Y   L    L+L+   G  QDLI W QL+  AR +L
Sbjct  91842  KYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRGPVQDLIMWGQLTDAARAAL  91663

Query  218    NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              N    DQ  FG     +P+ D  F +LL++ WP
Sbjct  91662  N----DQDNFGRT--DVPISDDHFPKLLEEAWP  91582

 Score = 117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 96/171 (56%), Gaps = 15/171 (9%)
 Frame = -3

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C    LGSQ+Y R+ W NDV+AIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  68555  CMVPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  68397

Query  142    PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
              P  +    LG+S+S S   Y K    +  + +G +  ++ Y   +   T L    D+GEF
Sbjct  68396  PAHKTPKALGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGEF  68220

Query  201    QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  68219  QDLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKRLEEAWPF  68085

 Score = 75.5 bits (184),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = -1

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C    LGSQ+Y R  W NDV+AIMYAWYFPKG     P     F+  RH+W   VVWIDN
Sbjct  46951  CMVPPLGSQVYGRVGWHNDVYAIMYAWYFPKGFWDASP-----FW--RHDWSNAVVWIDN  46793

Query  142    PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYY  181
              P  +   +LG+S+S S   Y K    +  + +G +  ++ Y
Sbjct  46792  PAHKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRY  46670

 Score = 52.0 bits (123),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 6/56 (11%)
 Frame = -2

Query  196    DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              D+GEFQDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  46629  DSGEFQDLIMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKRLEEAWPF  46480

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = +3

Query  81     ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
              +CT   L SQ+Y R+ W N VWAIMYAWYFP G   TVP         RHNW   VVWID
Sbjct  31269  DCTLPSLDSQVYGRAGWCNGVWAIMYAWYFPNGFWDTVP-------YWRHNWSNAVVWID  31427

Query  141    NPGLENATVLGV  152
              NP LEN  +L +
Sbjct  31428  NPALENPKILDI  31463

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGC  56
              + HD+V+PFPQP PVT+S+K  VKFKPQL I+ GC
Sbjct  29710  VDHDKVQPFPQPAPVTISEKAGVKFKPQLAIEYGC  29606

 Score = 36.6 bits (83),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFK  47
              + HD+V+PFPQP PVT+S+K   + +
Sbjct  92233  VDHDKVQPFPQPAPVTISEKACCQVQ  92156

>PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.42, whole genome shotgun 
sequence
Length=594358

 Score = 186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 136/229 (59%), Gaps = 14/229 (6%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+PF QP+P+T+++K AVKFKP L + +GCHPYP V   G  S GL+ +GP DG 
Sbjct  376634  INHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTGPPDGG  376813

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C G  LGSQ+Y+RS W  D WAIMYAWYFPK     +    L   G RH+W  +VVW+DN
Sbjct  376814  CEGPELGSQVYSRSTWCEDKWAIMYAWYFPKD----IQNRGLVKTGVRHDWVNLVVWLDN  376981

Query  142     PGLENATVLGVSMSA--SIGYSKQAPTDVKYVDGTSVKVAYYYNHLLG-NTALQLTEDTG  198
               P L    +L  S S   ++    + P     ++GT+ K+ Y  +     +T  Q  E+ G
Sbjct  376982  PALVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHEE-G  377158

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
               E+QDLIQW+QL+  AR +L +TD     FG+ G  +P  D  FE  L +
Sbjct  377159  EYQDLIQWNQLTDAAREALTNTD-----FGVFG-HVPFIDAFFETNLKE  377287

>PHRA:scaffold_67
Length=286994

 Score = 185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 143/251 (57%), Gaps = 15/251 (6%)
 Frame = -3

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN R +F+    + +  +A  + +D+V+PFPQPDPVT ++K+ VKFKPQL I+ GC  YP
Sbjct  265572  MNIRQIFIVVAVAFSSVEALSVDYDKVQPFPQPDPVTTTEKSGVKFKPQLDIEYGCSSYP  265393

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV   G ++GGL  SG  D  C  +  GSQ+Y R+ W NDVWAIMYAWYFPKG     P 
Sbjct  265392  AVNAAGDINGGLPTSGIAD--CQFALGGSQVYGRAEWYNDVWAIMYAWYFPKGFWDAAP-  265222

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
                       RH+W   VVWIDNP LEN  +LG+S+S S           + ++  +     
Sbjct  265221  ------YWRHDWSNAVVWIDNPALENPKILGLSLSTSENKYGNTYVPAEAIENGTTPTLN  265060

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                   +     L+ + + GEFQDLI W QL+  AR +LN    DQ  FG    ++P+ D  
Sbjct  265059  RNLPVFRAAELRPSTNRGEFQDLIMWGQLTDAARAALN----DQDTFGRT--EVPISDDH  264898

Query  241     FEELLDKTWPF  251
               F + L++ WPF
Sbjct  264897  FPKRLEEAWPF  264865

 Score = 150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 89/136 (65%), Gaps = 8/136 (6%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PFPQPDPVT+S+K  VKFK  L I  GC  YPAV   G  SGGLK SG   G 
Sbjct  113831  IAHDEVQPFPQPDPVTISEKAGVKFKIPLNIQEGCASYPAVNAAGETSGGLKGSGGISG-  114007

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  S LGSQ+Y R+ W NDVWAIMYAWYFPKG   + P         RH+W   ++WIDN
Sbjct  114008  CELSLLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDSTP-------WWRHDWSNAILWIDN  114166

Query  142     PGLENATVLGVSMSAS  157
               P  EN  +LG+S+S S
Sbjct  114167  PAHENPKILGLSLSTS  114214

 Score = 43.1 bits (100),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 44/102 (43%), Gaps = 16/102 (16%)
 Frame = +2

Query  105     MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQA  164
               MYAW FPKG     P         RH+W   V+WIDNP LEN   +G S+S S     + 
Sbjct  258722  MYAWCFPKGLWDGSP-------FRRHDWPSAVMWIDNPELENPKAMGPSLSTSTTSKSRV  258880

Query  165     PTDVK---------YVDGTSVKVAYYYNHLLGNTALQLTEDT  197
                 D +         +V  T+  VA    + LG   + +  D 
Sbjct  258881  DVD*RLC*RGPRSHHVGATARSVALNDKYNLGKADVPVINDN  259006

 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  44      VKFKPQLKIDAGCHPYPAVQKDGSMSG  70
               +K KP+L+IDAGC  +PA+   G  SG
Sbjct  258631  IKLKPRLRIDAGCACFPAINAAGETSG  258711

 Score = 40.8 bits (94),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 6/53 (11%)
 Frame = +1

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               E QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L++ WPF
Sbjct  114346  ENQDLIMWSQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLEEAWPF  114486

>PHKE:scaffold_211 scf_22126_211.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_211.1_contig_1:1:59949:1 
REF
Length=59949

 Score = 158 bits (399),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 107/171 (63%), Gaps = 18/171 (11%)
 Frame = -1

Query  81     ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
              +C GS  GSQ+Y RS W + VWAIMY+WYFPK   +T         GHRH+WE+VVVWID
Sbjct  11751  KCKGSGWGSQVYGRSTWYSGVWAIMYSWYFPKDSPSTK-------LGHRHDWEHVVVWID  11593

Query  141    NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
              NP +EN  +L VS SA  GYSK  P +    DGTSVKV  Y +H   N  L+ T  +GEF
Sbjct  11592  NPEIENPRILAVSPSAHSGYSKVVPPN---ADGTSVKVN-YESHWPINHTLESTSKSGEF  11425

Query  201    QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              QDLI WDQ++ +AR +LN  D+D+         +P+KDG F   LDK W F
Sbjct  11424  QDLIMWDQMTDVARTALNDADFDKA-------NVPMKDGSFVGKLDKAWSF  11293

 Score = 68.9 bits (167),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK  73
              +GHD+++PF   +P+T+S+K AVKFKPQ+ I  G HPYPAV   G  SGGLK
Sbjct  11917  LGHDELKPFA*LEPITISEKVAVKFKPQIHITNGYHPYPAVNDIGQTSGGLK  11762

>PHRA:scaffold_19
Length=590304

 Score = 185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 134/232 (58%), Gaps = 16/232 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
               I HD+V+PFPQPDPVT+++K+ VKFKP+LKID   GC  YPAV   G  SGGLK +    
Sbjct  331773  IDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  331594

Query  80      GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                 CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        + R    RH+W   VVWI
Sbjct  331593  A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGF-------WNRRAYWRHDWSNAVVWI  331438

Query  140     DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
               D+P LEN  VLG+S+S S           + +   +    Y         AL L   +G+
Sbjct  331437  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYKCAALALYYASGD  331258

Query  200     FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L+K WPF
Sbjct  331257  VQDLIMWGQLTDAARAALN----DQDNFGRT--EVPINDDHFLKHLEKAWPF  331120

 Score = 176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 130/232 (56%), Gaps = 16/232 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
               I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  149802  IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  149623

Query  80      GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                 CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        + R    RH+W   VVWI
Sbjct  149622  A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKGF-------WDRRAYWRHDWSNAVVWI  149467

Query  140     DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
               D+P LEN  VLG+S+S S           + +   +    Y          L     +GE
Sbjct  149466  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYKCAELVPYYASGE  149287

Query  200     FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L+K WP 
Sbjct  149286  VQDLIMWGQLTDAARAALN----DQGNFGRT--EVPINDDHFLKHLEKAWPL  149149

>PHCA:scaffold_178 PHYCAscaffold_178
Length=18388

 Score = 184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 138/235 (59%), Gaps = 27/235 (11%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              + + +++PF QP+P+TVS K AV+FKPQL+I  GCHPYPAV + G +S G   SG  D  
Sbjct  9764   VDYQEIKPFAQPEPITVSDKVAVRFKPQLRIKDGCHPYPAVNEAGDISSGAD-SGWGDSS  9940

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C+GS +GSQ+Y RSAW   VW +MYAWYFPK                 H WE VVVWID+
Sbjct  9941   CSGSDVGSQVYGRSAWCGGVWGMMYAWYFPKDETT-------------HRWENVVVWIDD  10081

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVK--YVDGTSVKVAYYYNHLLGNTALQLTEDT--  197
              P +EN T+LGVS S+  GY + AP D      DG +V++ Y  + ++  T +    DT  
Sbjct  10082  PAVENPTILGVSTSSDGGYIRYAPLDDNDWARDGDNVQIQYRLDDVMATTRVFHHLDTSW  10261

Query  198    --GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                G+ Q L+ W+QL+  AR +L + D+ ++       K+PLK+  F   LD   P
Sbjct  10262  RGGDIQGLVTWEQLTEEARNTLENGDFGES-------KVPLKNSTFTANLDFAIP  10405

>PHIF:NW_003303749.1 Phytophthora infestans T30-4 supercont1.10 
genomic scaffold, whole genome shotgun sequence
Length=3761764

 Score = 183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 140/237 (59%), Gaps = 22/237 (9%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA-GCHPYPAVQKDGSMSGGLKWSGPQDG  80
                + HD+V PFPQP+PVTVS+K+A+KFKPQL +    C PYPAV   G +SGGLK +   D 
Sbjct  2342315  VDHDKVTPFPQPEPVTVSEKSAIKFKPQLSLSPYVCAPYPAVNAAGEVSGGLKGTNENDA  2342494

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                 CT +   SQ+Y  + W  DVWAIMYAWYFPK     +P         RH+W+ V+VWID
Sbjct  2342495  -CTFAGKRSQVYGLTRWHKDVWAIMYAWYFPKTFWQDIPT-------RRHDWKSVIVWID  2342650

Query  141      NPGLENATVLGVSMSAS-IGYSKQAPTDVKYVD-----GTSVKVAYYYNHLLGNTALQLT  194
                NP  E   ++GVSMS S   YSK+      Y       GTS++  Y Y  +LG++ L  +
Sbjct  2342651  NPAFETPKIVGVSMSKSDTEYSKEVDMKSSYFVGGRGLGTSLRFKYDYK-MLGSSGLYFS  2342827

Query  195      EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 + G ++DLI W QL+  AR +LN    D+  FG A  ++P  D  + + L+  WPF
Sbjct  2342828  SEDGYYEDLIMWGQLTDAARVALN----DEDNFGEA--EVPFSDEHYADHLNNAWPF  2342980

>PHPA:scaffold_24 NW_008649010.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.24, whole genome shotgun 
sequence
Length=888348

 Score = 182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 137/247 (55%), Gaps = 31/247 (13%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD+++PFPQP+PVT+S+K A+KFKPQL I  G C  YPAV   G  +GGLK S   D 
Sbjct  766932  VDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGSNGNDA  767111

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG     P         RH+W+ VVVWID
Sbjct  767112  -CKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKGFWVGFPT-------RRHDWKSVVVWID  767267

Query  141     NPGLENATVLGVSMSAS-IGYSKQAPTDVK---------------YVDGTSVKVAYYYNH  184
               NP LE   ++GVSMS S   Y K+                     Y  G++  + + Y  
Sbjct  767268  NPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRFGYQM  767447

Query  185     LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                LG+  L      GE+QDLI W+QL+  AR +LN    D   F  A  ++P  D  +E+ 
Sbjct  767448  ELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALN----DDNNFEKA--EVPFSDEHYEDH  767609

Query  245     LDKTWPF  251
               LDK WP 
Sbjct  767610  LDKAWPL  767630

 Score = 165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 123/214 (57%), Gaps = 25/214 (12%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD+++PFPQP+P T+S+K A+KFKPQL I  G C  YPAV   G  +GGLK +   D 
Sbjct  777975  VDHDKIKPFPQPEPATISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGTNGNDA  778154

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG        ++ F    H+W+ VVVWID
Sbjct  778155  -CKYAPLGSQVYGRAGWYKDVWAIMYAWYFPKGF-------WMNFPSRCHDWKSVVVWID  778310

Query  141     NPGLENATVLGVSMS-ASIGYSKQAPT---------------DVKYVDGTSVKVAYYYNH  184
               NP LE   +LGVSMS     Y K+  T                  Y+ G++  + + Y+ 
Sbjct  778311  NPDLEMPKILGVSMSKGDTDYRKETKTWPSSFAGYRTEGRRFHRTYIYGSNSSLRFEYHV  778490

Query  185     LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLN  218
                + +  L      GE+QDLI W+QL+  AR +LN
Sbjct  778491  EMSSPYLNFAVWDGEYQDLIMWEQLTDPARAALN  778592

 Score = 119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 115/247 (47%), Gaps = 61/247 (25%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               I HD+V PFPQP+PVT+S+K A+ F+PQL I  G C  YPAV   G   GGLK S   D 
Sbjct  785445  IDHDKVLPFPQPEPVTISEKAAITFQPQLYIPEGVCVSYPAVNAAGETIGGLKGSNGNDA  785266

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  + LGSQ+Y R+ W  D+WA                                     
Sbjct  785265  -CMYAPLGSQVYGRARWFKDLWA-------------------------------------  785200

Query  141     NPGLENATVLGVSMSAS-IGYSKQAPTDVK---------------YVDGTSVKVAYYYNH  184
               NP LE   ++GVSMS S   Y+K+                     Y+ G++  + + Y  
Sbjct  785199  NPDLEMPKIVGVSMSESDTKYNKRLKLFASDFAGFQTMGRRRYRTYIYGSNTSLRFQYGT  785020

Query  185     LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                LG++ L  +   G++Q LI W+QL+  AR +LN    D   F  A  ++P  D  +E+ 
Sbjct  785019  TLGHSYLTFSRWDGDYQGLIMWEQLTDEARAALN----DGNNFEKA--EVPFSDEHYEDH  784858

Query  245     LDKTWPF  251
               LD+ WP 
Sbjct  784857  LDEAWPL  784837

 Score = 107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 114/244 (47%), Gaps = 46/244 (19%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
               IGH +V+PFPQ  PVT+S K A+KFKPQL   +  C PYPAV   G  +GGLK +   D 
Sbjct  582613  IGHGKVQPFPQVMPVTISDKAAIKFKPQLFTPEYVCVPYPAVDAAGETTGGLKGTKRNDA  582434

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  + LGSQ+Y R+    D+WAIMYAWYFPKG        F  F   RH+W+ V     
Sbjct  582433  -CKYAPLGSQVYGRA---KDLWAIMYAWYFPKGF-------FTEFSSRRHDWKSVD*QSR  582287

Query  141     NPGLENATVLGVSMSASIGYSKQAPTDV----------KYV----DGTSVKVAYYYNHLL  186
                        L V +   I +  Q    V          KY       +S+ + Y Y H  
Sbjct  582286  I*DA*GCCGLHVQVRREIHHECQNIARVLCWIPNMGVEKYCWRLQHVSSIPICYRYWH--  582113

Query  187     GNTALQLTEDTG-----EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
                       E TG         L +WDQL+  AR +LN    +   FG A  K+P  D  +
Sbjct  582112  -------CECTGVSRRWRVPGLDKWDQLTDAARVALN----NGKNFGKA--KVPFSDEHY  581972

Query  242     EELL  245
               E+ L
Sbjct  581971  EKHL  581960

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD+V+PFPQP+PVT+S+K A+KFKPQL I  G C  YPAV   G  +GGLK +   D 
Sbjct  772581  VDHDKVQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGTNGNDA  772402

 Score = 41.6 bits (96),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 52/111 (47%), Gaps = 16/111 (14%)
 Frame = +1

Query  149     VLGVSMSAS-IGYSKQAPTDVKYVDG-------TSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +LGVS+S +   + K       Y  G       TS++  Y  N  +  T L  +   G +
Sbjct  545869  ILGVSLSKNDKKHHKDVHLQPSYFAGGQIPDSSTSLRFIYDVNSFV--THLSFSRFDGNY  546042

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI W+QL+   R +LN ++     FG A  ++P  D  +++ L   WP 
Sbjct  546043  QDLIMWEQLTDAVRVALNGSN----KFGRA--EVPFSDEHYQDHLHNAWPL  546177

 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 7/42 (17%)
 Frame = +3

Query  103     AIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
               +IMY+W FPK         F+ F   RH+W+ VV+WI NP L
Sbjct  545751  SIMYSWCFPKN-------FFMDFPVRRHDWQSVVIWIGNPEL  545855

>PHSO:scaffold_33
Length=46552

 Score = 182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 137/246 (56%), Gaps = 26/246 (11%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD+V+PF QP+PVTVS+KTAVKFKP L+ID GCHPYPAV   G  S GLK SGP DG+
Sbjct  40509  IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGPDDGK  40688

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +        +   G RH W   VVW+DN
Sbjct  40689  CKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGF----GGILAKGQRHKWVSAVVWLDN  40856

Query  142    PGLENATVLGVSM-SASIGYS--KQAPTDV----------KYVDGTSVKVAY--YYNHLL  186
              P +E   +L +S  +   GY   K  P +           +Y++ T+  ++Y  Y+    
Sbjct  40857  PAVETPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDS  41036

Query  187    GNTALQLT-EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
               +T    T   TGE QDL+ W+QLS  AR +L   D+ +         +P  D      L
Sbjct  41037  FHTLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGEK------SPVPFIDTNLNATL  41198

Query  246    DKTWPF  251
              +   PF
Sbjct  41199  EAARPF  41216

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 138/241 (57%), Gaps = 28/241 (12%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQL--KIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
                I HD++ PFPQP PVT+S+K A+KFKPQL   I   C P+PAV   G ++GGLK +   D
Sbjct  1501318  IDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTVCAPFPAVNAAGDVTGGLKGTNGND  1501497

Query  80       GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                  C  +R GSQ+Y R+ W  D+WAIMYAWYFPKG        ++ F   RH+W+ VVVWI
Sbjct  1501498  A-CRFARKGSQVYGRAGWHKDMWAIMYAWYFPKGF-------WMDFPTRRHDWKNVVVWI  1501653

Query  140      DNPGLENATVLGVSMSASIGYSKQAPTD---------VKYVDGTSVKVAYYYNHLLGNTA  190
                DNP LE+  ++ VSMS S G S                   D TS++  ++Y   LG+  
Sbjct  1501654  DNPDLESPKIVAVSMSKS-GRSYHTEDQSGGLISRSFFNGFDRTSLR--FHYQTDLGSPY  1501824

Query  191      LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                L      GE+QDLI W+QL+  AR +LN       ++     ++P  D  FE+ LDK WP
Sbjct  1501825  LNFAWWGGEYQDLIMWEQLTDPARVALND------IYNFGDAEVPFSDNNFEDYLDKAWP  1501986

Query  251      F  251
                F
Sbjct  1501987  F  1501989

 Score = 163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 143/273 (52%), Gaps = 42/273 (15%)
 Frame = +3

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               M++R   VA    +A A A  I +D+V+P  QP PVT+S+K  VKFKPQL +D+GC  +P
Sbjct  424044  MSYRVFIVALAGVVATANAASIAYDKVQPIAQPKPVTISEKAGVKFKPQLFVDSGCFTFP  424223

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSR---LGSQIYARSAWVNDVWAIMYAWYFPKGRAAT  117
               AV   G  S GL     Q       R   LGSQ+Y R+ W   VWAIMYAWY+PK   A 
Sbjct  424224  AVNAAGETSSGL--PAEQGNYFCVKRYNLLGSQVYGRATWYKGVWAIMYAWYYPKTITAL  424397

Query  118     VPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS------------------ASIG  159
               V           H+W+  VVWI+NP LE+  ++G+S S                  + + 
Sbjct  424398  VA-------TATHDWQNAVVWINNPDLESPKIMGLSTSKKSETDHTKPHITRETFKSDVT  424556

Query  160     YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQ-LTEDTGEFQDLIQWDQLSSLARYSLN  218
               Y K+     +++DGTS K+A     +LG   L+ +TE  GEFQDL+ W QL  +AR +LN
Sbjct  424557  YDKRTKDFDQFLDGTSFKLA--STLILGPIFLRPMTEKKGEFQDLVMWSQLPDVARAALN  424730

Query  219     HTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                T+            +P  D  F++ L + WPF
Sbjct  424731  STEIGN---------VPFSDANFQKKLAEAWPF  424802

 Score = 140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 103/182 (57%), Gaps = 18/182 (10%)
 Frame = -2

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPY  59
               MN RA+       L       + HD+V P PQP+ VTVS+K A+KFKPQL I +  C  Y
Sbjct  221404  MNIRALATTLFTLLFACAYATVDHDKVEPLPQPEAVTVSEKAAIKFKPQLYIPEMVCVSY  221225

Query  60      PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
               PAV   G ++GGLK +   D  C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG     P
Sbjct  221224  PAVNAAGEVTGGLKGTNGNDA-CKYAPQGSQVYGRAGWYKDLWAIMYAWYFPKGFWLLSP  221048

Query  120     PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179
                        RH+W+ VVVWID+P LE   ++GVSMS S         D +Y   T ++ +
Sbjct  221047  -------SRRHDWKSVVVWIDDPTLETPKIVGVSMSKS---------DSRYHKTTKIQPS  220916

Query  180     YY  181
               Y+
Sbjct  220915  YF  220910

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 10/93 (11%)
 Frame = -3

Query  161     SKQAPTDVKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLN  218
               S  + TD  YV G  TS+++ YY +  LG   L L    GE+QDL+ W+QL   AR +LN
Sbjct  231975  SSVSNTDGWYVSGSNTSLRMRYYLD--LGTPYLNLNSVDGEYQDLVMWEQLPDAARAALN  231802

Query  219     HTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                   D + FG A  ++P  D  +EE LD  WP 
Sbjct  231801  ----DSSNFGKA--EVPFNDEHYEEHLDNAWPL  231721

>PHIF:NW_003303150.1 Phytophthora infestans T30-4 supercont1.629 
genomic scaffold, whole genome shotgun sequence
Length=20827

 Score = 181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 130/227 (57%), Gaps = 20/227 (9%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD V+PF QP+P T ++KTAVKFKP L + AGCHPYP V   G    GLK +G  DGE
Sbjct  12522  IDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGE  12701

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              CTGS LGSQ+Y+RS    + WAIMYAWYFPK          L   G RH+W  +VVW+DN
Sbjct  12702  CTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQNI----GLIKKGVRHDWVNLVVWLDN  12869

Query  142    PGLENATVLGVSMSASIGYSKQ-----APTDVKYVDGTSVKVAYYYNHLLG-NTALQLTE  195
              P L   T+L  S S    Y  Q      P     ++GT+ KV Y  +   G +T  Q  E
Sbjct  12870  PTLAKPTILATSAST---YGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHE  13040

Query  196    DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
              + GE+QDLIQW QL+  AR +L +TD     FG     +P  D  FE
Sbjct  13041  E-GEYQDLIQWTQLTDAAREALENTD-----FGDFA-NVPFNDAYFE  13160

>PHCA:scaffold_16 PHYCAscaffold_16
Length=1020712

 Score = 181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 150/269 (56%), Gaps = 31/269 (12%)
 Frame = -2

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPY  59
               MN R +     A+LA   +  + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+
Sbjct  404592  MNLRLLVATVFAALAANASATVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIVCVPF  404413

Query  60      PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
               PAV   G ++GGLK +   DG C  +  G+QIY R+ W  D+WAIMY+WYFPKG      
Sbjct  404412  PAVNAAGEVTGGLKGTNGNDG-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDS  404236

Query  120     PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDG--TSV  176
               P        RH+W+ VVVWIDNP LE   ++GV+MS S   YSK+      Y  G  T  
Sbjct  404235  PT------RRHDWKNVVVWIDNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEG  404074

Query  177     KVAYYYNHLLGNTALQLTEDT--------------GEFQDLIQWDQLSSLARYSLNHTDW  222
               + +    +L  NT+L+   DT              GE+QDLI W+QL+  AR +LN    
Sbjct  404073  RFSSRVEYLGSNTSLRFEYDTSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----  403906

Query  223     DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D   FG A  ++P  D  +E+ L K WPF
Sbjct  403905  DGKSFGKA--EVPFNDEHYEDHLGKAWPF  403825

 Score = 177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 147/269 (55%), Gaps = 31/269 (12%)
 Frame = +1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPY  59
               MN R +     A LA   +  + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+
Sbjct  391273  MNLRLLVATVFAVLAANASATVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPF  391452

Query  60      PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
               PAV   G ++GGLK +   DG C  +  G+QIY R+ W  D+WAIMY+WYFPKG      
Sbjct  391453  PAVNTAGEITGGLKGTNGNDG-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDS  391629

Query  120     PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDG--TSV  176
               P        RH+W+ +VVWIDNP LE   ++GV+MS S   YSK+      Y  G  T  
Sbjct  391630  PT------RRHDWKNIVVWIDNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEG  391791

Query  177     KVAYYYNHLLGNTALQLTEDT--------------GEFQDLIQWDQLSSLARYSLNHTDW  222
               + +    +L  NT+L+   DT              GE+QDLI W+QL+  AR +LN    
Sbjct  391792  RFSSRVEYLGSNTSLRFEYDTSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----  391959

Query  223     DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D   F  A  ++P  D  +E+ L K WP 
Sbjct  391960  DGKSFEKA--EVPFSDEHYEDHLGKAWPL  392040

 Score = 173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 133/247 (54%), Gaps = 28/247 (11%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD++ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGL  +   D 
Sbjct  221419  VDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHKQLCAPFPAVNAAGEVTGGLSGANGNDA  221598

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG       ++L F   RH+W+ VVVWID
Sbjct  221599  -CKYALKGAQVYGRAGWYKDVWAIMYSWYFPKGF------NWLGFPTRRHDWKNVVVWID  221757

Query  141     NPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDGTSVKVAYYYNHLL-------------  186
               NP LE   ++GV+M+ S   Y ++         G+ V+V                     
Sbjct  221758  NPELETPKIIGVAMAGSDTKYRREREMYNSNFVGSQVQVTRRDRRYYRSDSPGSSTNLRF  221937

Query  187     --GNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                 G T L      G++QDLI W+QL+  AR +LN    D   FG +  ++P  D  FE  
Sbjct  221938  ENGATHLDFARQDGDYQDLIMWEQLTDAARIALN----DNGSFGYSYAEVPFSDEHFEAN  222105

Query  245     LDKTWPF  251
                DK WP 
Sbjct  222106  RDKAWPL  222126

 Score = 173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 139/241 (58%), Gaps = 26/241 (11%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGLK +   +G
Sbjct  619282  VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPGNLCAPFPAVNAAGEVTGGLKGTN-GNG  619106

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG       ++L F   RH+W+ VVVWID
Sbjct  619105  ACKHATKGAQVYGRAGWYKDVWAIMYSWYFPKGF------NWLGFPTRRHDWKNVVVWID  618944

Query  141     NPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDGTSVKV---------AYYYNHLLGNTA  190
               NP LE   ++GV++S S   Y K       Y  G+ ++           ++YN  +  + 
Sbjct  618943  NPALETPKIVGVALSKSDTKYRKVREVWPPYFVGSEIRYDSSPASSTNIHFYN--VAGSD  618770

Query  191     LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
               L      GE+ DLI W+QL+  AR +LN+++     FG A  ++P  D  +E  LD+  P
Sbjct  618769  LDFARWDGEYHDLIMWEQLTDAARVALNNSE----FFGDA--EVPFSDEHYENHLDRACP  618608

Query  251     F  251
                
Sbjct  618607  L  618605

 Score = 169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 136/272 (50%), Gaps = 60/272 (22%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+PVT+S+K AVKFKPQ+ I  GC P+PAV   G +SGGL  +   DG 
Sbjct  910731  INHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKYTDG-  910555

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
               CT S +GSQ+Y R++W  D WAIMYAWYFPK        +F  FF   RH W  +V+W+D
Sbjct  910554  CTESPMGSQVYGRASWYRDHWAIMYAWYFPK--------NFRAFFARGRHGWANMVLWLD  910399

Query  141     NPGLENATVLGVSMSASIGYSKQ---APTDVK----------------------------  169
               NP LEN  +LG S+S     +++    P D +                            
Sbjct  910398  NPALENQKLLGASLSQQTLKAEKILFIPLDEREKEPYQKFNGIPPMGFVGMQEIRHTQLS  910219

Query  170     -------YVDGTSVKVAYYYNHLLGN---TALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
                      Y  G++V       H++       L      GE+QDLI W+QL+  AR  LN 
Sbjct  910218  RWSWNYTYEGGSNVSTRVI--HMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGLNS  910045

Query  220     TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                D+  T         P  D  F+  L+K WPF
Sbjct  910044  ADFGDTF-------APFTDDNFKTALEKAWPF  909970

 Score = 168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 135/275 (49%), Gaps = 63/275 (23%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QPDPVTVS+K AVK+KPQL I +GC  +PAV   G ++GGLK +   DG 
Sbjct  1017690  IDHDKVQPFKQPDPVTVSEKAAVKYKPQLVIGSGCVSFPAVNAAGDITGGLKGTKSTDG-  1017514

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG----HRHNWEYVVV  137
                CT + LGSQ+Y RS W  D WA+M+AWYFPK            F+G     RH W  +VV
Sbjct  1017513  CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPK-----------NFWGGEGESRHLWSNMVV  1017367

Query  138      WIDNPGLENATVLGVSMS------------------ASIGYSKQAPTDVKYVDGTSV---  176
                WIDNP LE   +LG S+S                    + Y K    D  +  G      
Sbjct  1017366  WIDNPALETPKILGASLSRQTLDPPKALFLFSLADRQKVPYKKVTGIDPMHFVGMQAIQT  1017187

Query  177      ----KVAYYYNHLLGNT----------------ALQLTEDTGEFQDLIQWDQLSSLARYS  216
                    +  Y YN+  G+                  L+     GE+QDLI W+QL+  AR +
Sbjct  1017186  GRIGRYRYTYNYTGGSNTSTRVYHGFPDSSAWIGLEFVNVNGEYQDLIMWNQLTDQARAT  1017007

Query  217      LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                L   D+ +        K+P  D  FE  L + WPF
Sbjct  1017006  LESADFGEK------TKVPFNDKNFEAALAQAWPF  1016920

 Score = 167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 141/274 (51%), Gaps = 62/274 (23%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                IGHD+V+PF QPDPVTVS+K AVK+KPQL+I   C  +PAV   G ++GGLK +   DG 
Sbjct  1013611  IGHDKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLKGTKGTDG-  1013787

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG----HRHNWEYVVV  137
                CT + LGSQ+Y RS W  D WA+M+AWYFPK            F+G     RH W  +V+
Sbjct  1013788  CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPK-----------NFWGGGAKSRHLWANMVL  1013934

Query  138      WIDNPGLENATVLGVSMSA-----------SIGYSKQAPTD-------VKYVDGTSVKVA  179
                WIDNP LE   +LG S+S            S+G  ++ P         + +V   +++ +
Sbjct  1013935  WIDNPALETPKILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQTS  1014114

Query  180      ------YYYNHLLGN----------------TALQLTEDTGEFQDLIQWDQLSSLARYSL  217
                      Y YN+  G+                 +L      GE+QDLI W+QL+  AR +L
Sbjct  1014115  RISRFRYTYNYTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARAAL  1014294

Query  218      NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                   D+ +        K+P  D  FE  L + WPF
Sbjct  1014295  ESADFGED------TKVPFNDKNFEAALAQAWPF  1014378

 Score = 165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 144/247 (58%), Gaps = 38/247 (15%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD++ PFPQP+PVTVS+K A+KFKPQL   A  C P+PAV   G ++GGLK +   D 
Sbjct  381692  VDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHANICAPFPAVNAAGEVTGGLKGTNGNDA  381513

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  +  G+Q+Y R+ W  D+WAIMY+WYFPKG       ++L F   RH+W+ VVVWID
Sbjct  381512  -CKYALKGAQVYGRAGWHKDLWAIMYSWYFPKGF------NWLGFPSRRHDWKNVVVWID  381354

Query  141     NPGLENATVLGVSMSASIGYSKQ-----------APTDVK---------YVDGTSVKVAY  180
               NP LE   ++GV+MS S    ++           +  D K         Y  G+S  +  
Sbjct  381353  NPDLETPKIVGVAMSKSDTEYRKVWQTFNSNFVGSQVDFKRRNGRRRRSYTSGSSTNLR-  381177

Query  181     YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                ++++ G+  L  +   G++QDLI W+QL+ +AR +LN+++     FG A  K+P  D  
Sbjct  381176  -FDNVAGD--LFFSRWDGDYQDLIMWEQLTDVARVALNNSE----SFGDA--KVPFSDKH  381024

Query  241     FEELLDK  247
               FE+ L K
Sbjct  381023  FEDHLTK  381003

 Score = 163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 136/271 (50%), Gaps = 56/271 (21%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PF QPDPVT+S+K AVK+KPQL I   C  +PAV   G ++GGLK +   D  
Sbjct  997376  IGHDKVQPFAQPDPVTISEKAAVKYKPQLVIFDSCVSFPAVNAAGDITGGLKGTSGTDA-  997200

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
               CT + LGSQ+Y RS W    WA+M+AWYFPK        +F       RH W  +V+W+D
Sbjct  997199  CTKAPLGSQVYGRSTWYQGKWAMMFAWYFPK--------NFWNLESRSRHLWANMVLWLD  997044

Query  141     NPGLENATVLGVSMSASI-----------------GYSKQAPT-DVKYVDGTSVKVA---  179
               NP LE  T+LG S+S                     YSK  P   + +V    ++ A   
Sbjct  997043  NPALETPTILGASLSRQTLEVPKWLFIPSGVQQKNSYSKATPIPPMGFVGTQQIRTARIG  996864

Query  180     ---YYYNHLLGNT----------------ALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                  Y YN+  G+T                 L  T   G++QDLI W+QL+  AR +L   
Sbjct  996863  RFQYTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESA  996684

Query  221     DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D+ +        K+P  D  FE  L + WPF
Sbjct  996683  DFGR------DTKVPFNDKNFEAALAQAWPF  996609

 Score = 160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 139/276 (50%), Gaps = 65/276 (24%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HD+V+PF QPDPVT+++K AVK+KPQL+I  GC  +PAV   G ++GGLK +   D  
Sbjct  998677  VDHDKVQPFAQPDPVTIAEKVAVKYKPQLRITDGCVSFPAVNAAGGITGGLKGTKGTDA-  998501

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-----RHNWEYVV  136
               CT + LGSQ+Y RS W    WA+M+AWYFPK             FG+     RH W  +V
Sbjct  998500  CTKAPLGSQVYGRSTWYQGKWAMMFAWYFPKN------------FGNDGSRSRHLWSNMV  998357

Query  137     VWIDNPGLENATVLGVSMSAS------------IGYSKQAP-------TDVKYVDGTSVK  177
               +W+DNP LE   +LG S+S              +GY +++P         + +    ++K
Sbjct  998356  LWLDNPALEAPKILGASLSRQTLKPPMFLFLLPLGYQQKSPYWKVTTIEPMNFAGMHAIK  998177

Query  178     VA------YYYNHLLGN----------------TALQLTEDTGEFQDLIQWDQLSSLARY  215
                       Y YN+  G+                  L  T   G++QDLI W+QL+  AR 
Sbjct  998176  TGRLSLYRYAYNYTGGSDVSLRLSQTFPDSSGWIGLDFTYGDGQYQDLIMWEQLTDQARG  997997

Query  216     SLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               +L   D+ +        K+P  D  F+E L + WPF
Sbjct  997996  ALESADFGED------TKVPFNDKNFQEALAQAWPF  997907

 Score = 160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 133/242 (55%), Gaps = 32/242 (13%)
 Frame = +1

Query  26      QVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
               Q R FPQP PVTVS+K A+KFKPQ+ + +  C P+PAV   G ++GGLK +   D  C  
Sbjct  437620  QGRAFPQPVPVTVSEKAAIKFKPQMHVQSNLCVPFPAVDSAGGVTGGLKGTDGNDA-CKY  437796

Query  85      SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
               +  G+Q+Y R+ W   +WAIMYAWYFPKG + T  P        RH+W+ VVVWIDNP L
Sbjct  437797  APKGAQVYGRAGWHKVLWAIMYAWYFPKGFSWTGYP------SRRHDWKSVVVWIDNPAL  437958

Query  145     ENATVLGVSMSAS---------------IGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNT  189
               E   ++GV MS S                G+ ++      Y   TS++  Y  ++     
Sbjct  437959  ETPKIVGVGMSKSDKDYSEEREIWPSYFAGFRRENRVVKTYGSNTSLRFDYDVSNF---P  438129

Query  190     ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                +      G++QDLI W+QL+  AR +LN    D+  FG A  ++P  D  +E+ LDK W
Sbjct  438130  DMGFATMDGDYQDLIMWEQLTDAARVALN----DRDSFGKA--EVPFSDEHYEDHLDKAW  438291

Query  250     PF  251
               P 
Sbjct  438292  PL  438297

 Score = 157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 135/271 (50%), Gaps = 56/271 (21%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+PVT+S+K AVK+KPQL I   C  +PAV   G ++GGLK +   +  
Sbjct  952096  IDHDKVQPFAQPEPVTISEKAAVKYKPQLVIFDSCVSFPAVNAVGDITGGLKGTSGTNA-  951920

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
               CT + LGSQ+Y RS W    WA+M+AWYFPK        +F       RH W  +V+W+D
Sbjct  951919  CTEAPLGSQVYGRSTWYQGKWAMMFAWYFPK--------NFWNLESRSRHLWANMVLWLD  951764

Query  141     NPGLENATVLGVSMSASI-----------------GYSKQAPT-DVKYVDGTSVKVA---  179
               NP LE  T+LG S+S                     YSK  P   + +V    ++ A   
Sbjct  951763  NPALETPTILGASLSRQTLEVPKWLFIPSGVQQKDSYSKATPIPPMGFVGTQQIRTARIG  951584

Query  180     ---YYYNHLLGNT----------------ALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                  Y YN+  G+T                 L  T   G++QDLI W+QL+  AR +L   
Sbjct  951583  RFQYTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESA  951404

Query  221     DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D+ +        K+P  D  FE  L + WPF
Sbjct  951403  DFGR------DTKVPFNDKNFEAALAQAWPF  951329

 Score = 109 bits (272),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGLK +   D 
Sbjct  330659  VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPIKLCVPFPAVNAAGDIAGGLKGTNGNDA  330480

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG  113
                C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG
Sbjct  330479  -CKYAPKGAQVYGRAGWYKDVWAIMYSWYFPKG  330384

 Score = 69.7 bits (169),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 16/126 (13%)
 Frame = -2

Query  128     HRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLG  187
                RH+W+ VVVWI+NP LE   ++GV+MS S    K+           S  V    N    
Sbjct  330360  RRHDWKSVVVWIENPDLETPKIVGVTMSRSGTKYKKVR--------DSFLVGSCTNLRFD  330205

Query  188     NTA--LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
               N A  +      G++QDLI W+QL+  AR +LN+++     FG A  ++P  D  +E  L
Sbjct  330204  NVADGIGFARWDGDYQDLIMWEQLTDAARVALNNSE----SFGDA--EVPFSDEHYEAHL  330043

Query  246     DKTWPF  251
               DK WP 
Sbjct  330042  DKAWPL  330025

 Score = 139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 90/139 (65%), Gaps = 18/139 (13%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + HD+V+PF QPDPVT+++K AVK+KPQL+I  GC  +PAV   G ++GGLK +   D  
Sbjct  999801   VDHDKVQPFAQPDPVTIAEKVAVKYKPQLRITDGCVSFPAVNAAGGITGGLKGTKGTDA-  999977

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-----RHNWEYVV  136
                CT + LGSQ+Y RSAW  D WA+M+AWYFPK             FG+     RH W  +V
Sbjct  999978   CTKAPLGSQVYGRSAWYQDKWAMMFAWYFPKN------------FGNDGSRSRHLWSNMV  1000121

Query  137      VWIDNPGLENATVLGVSMS  155
                +W+DNP LE   +LG S+S
Sbjct  1000122  LWLDNPALEAPKILGASLS  1000178

 Score = 135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 89/138 (64%), Gaps = 16/138 (12%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+PVT+S+KTAVK+KPQL I   C  +PAV   G ++GGLK +   +G 
Sbjct  953878  IDHDKVQPFAQPEPVTISEKTAVKYKPQLLISESCVSFPAVNAAGEITGGLKGTKGTEG-  954054

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG----RAATVPPDFLRFFGHRHNWEYVVV  137
               C  + LGSQ+Y RSAW  D WA+M+AWYFPK     +A +           RH W  +V+
Sbjct  954055  CIEAPLGSQVYGRSAWYQDKWAMMFAWYFPKNFQWDKAKS-----------RHLWSNMVL  954201

Query  138     WIDNPGLENATVLGVSMS  155
               W+DNP LE   +LG S+S
Sbjct  954202  WLDNPALETPKLLGASLS  954255

 Score = 128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 123/247 (50%), Gaps = 34/247 (14%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD++ PFPQP+P T S+K A+KF+PQL      C P+PAV   G ++GGL+ +   D 
Sbjct  327213  VDHDKIEPFPQPEPNTASEKAAIKFQPQLYTHRNLCVPFPAVDGAGGVTGGLRGTNGNDA  327392

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPD-FLRFFGHRHNWEYVVVWI  139
                C  +  G+Q+Y R+ W  D          P         D  L +    H+W+ VVVWI
Sbjct  327393  -CKYAPKGAQVYGRAGWYKD----------PSCTPGNFQKD*LLGYPSRHHDWKNVVVWI  327539

Query  140     DNPGLENATVLGVSMSAS-IGYSKQAPT-DVKYVDGTSV-KVAYYYNHLLGNTALQLTED  196
               DNP LE   ++GVS+  S   Y K+       +V   SV + +    H   NT+L+   D
Sbjct  327540  DNPALETPKIVGVSLCKSDTNYWKELKVLASSFVGYRSVGRKSRRIEHYGSNTSLRFQYD  327719

Query  197     T------------GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                            GE+QDLI W+QL+  AR +LN    D   FG   +++P  D  +E  
Sbjct  327720  ELNSPDVDFSPLDGEYQDLIMWEQLTDAARVALN----DGESFG--DVEVPFNDEHYENH  327881

Query  245     LDKTWPF  251
               L+K WP 
Sbjct  327882  LEKAWPL  327902

 Score = 105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 92/173 (53%), Gaps = 31/173 (18%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQL-KIDAGCHPYPAVQKDGSMSGGLKWSGPQD-  79
               + HD +  FP+P+P+TVS+K A+KFKP+L  +D  C P+P + +    S G   +     
Sbjct  361979  VDHDNIEAFPEPEPITVSEKAAIKFKPELYVVDFLCKPFPVLVRSVVDSKGRMETVSTRQ  362158

Query  80      --GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVV  137
                  +CTG  +G+++          W IMYAWYFPKG  +      L     RH+W+ VVV
Sbjct  362159  C*HKCTGEPVGTRM----------WVIMYAWYFPKGFNS------LDLPSTRHDWKNVVV  362290

Query  138     WIDNPGLENATVLGVSMSAS-------IGYSKQAPTDVKYVDGTSVKVAYYYN  183
               WIDNP LE   ++GV+MS         I  ++Q P  +  V    + V +++N
Sbjct  362291  WIDNPALETPKIVGVAMSKQGLVKSNMILIARQTPRQLIMV----LFVVFFFN  362437

 Score = 103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGLK +   D 
Sbjct  339597  VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPIKLCVPFPAVNAAGDIAGGLKGTNGNDA  339418

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYF  110
                C  +  G+Q+Y R+ W  DVWAIMY+WYF
Sbjct  339417  -CKYAPKGAQVYGRAGWYKDVWAIMYSWYF  339331

 Score = 103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HDQ+ PFPQP+PVTVS+K A+KFKPQL      C P+PAV   G ++GGLK +   D 
Sbjct  335133  VDHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPIKLCVPFPAVNAAGDIAGGLKGTNGNDA  334954

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYF  110
                C  +  G+Q+Y R+ W  DVWAIMY+WYF
Sbjct  334953  -CKYAPKGAQVYGRAGWYKDVWAIMYSWYF  334867

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 68/150 (45%), Gaps = 37/150 (25%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYP-------AVQKDGSMSGGL  72
               I HDQ+ PFPQP+PVTVS+K A+KF+PQL        H  P        V  +G M    
Sbjct  340700  IDHDQIEPFPQPEPVTVSEKAAIKFQPQLYTHKTYASHSLP*MLQVMSLVVSEGRMETT-  340524

Query  73      KWSGPQD-----GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG  127
               + S P+      GE  G R+   +   S  V  VW                         
Sbjct  340523  RVSTPRRELRCMGELVGIRIHHVLLVLSKRV*RVW----------------------LPS  340410

Query  128     HRHNWEYVVVWIDNPGLENATVLGVSMSAS  157
                RH+W+ VVVWI+NP +E   + GVS+S S
Sbjct  340409  RRHDWKSVVVWIENPDVETPKIGGVSLSKS  340320

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +2

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPY  59
               MN + + V+A  +LA   +  +GHD++  FPQP+ VTVS+K   KFKPQL      C P+
Sbjct  237386  MNLQLLAVSAFVALAAGASATVGHDKIELFPQPESVTVSKKATTKFKPQLFTKTSVCVPF  237565

Query  60      PAVQKDGSMSGGLK  73
               PAV  DG ++GGL+
Sbjct  237566  PAVNADGEVTGGLR  237607

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 5/70 (7%)
 Frame = -3

Query  183     NHLLGNTA-LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               N L+ ++  L      G++QDLI W+QL+  AR +LN    D   FG +  ++P  D  F
Sbjct  221186  NQLVSSSRNLDFARQDGDYQDLIMWEQLTDAARIALN----DSGSFGYSYAEVPFSDEHF  221019

Query  242     EELLDKTWPF  251
               E  LDK WP 
Sbjct  221018  EANLDKAWPL  220989

 Score = 42.0 bits (97),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V    Q  PVT+S   + KFKPQL++  G    P         G +      +G 
Sbjct  1018660  IDHDKV----QSHPVTISN*ASNKFKPQLRLRGGSASLPTKCCWRCYCGAMLKDPKHNGR  1018493

Query  82       CTGSRLGSQIYARS  95
                C  + LG QIY RS
Sbjct  1018492  CGEAPLGIQIYGRS  1018451

 Score = 25.0 bits (53),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 7/11 (64%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -2

Query  102      WAIMYAWYFPK  112
                W +MY+W+FPK
Sbjct  1018428  WTMMYSWHFPK  1018396

 Score = 42.0 bits (97),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 6/54 (11%)
 Frame = -2

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               GE+QDLI W+QL   AR +LN+++     FG A  ++P  D  F+  LDK WP 
Sbjct  340158  GEYQDLIMWEQLMDAARVALNNSE----SFGDA--EVPFSDEHFKGHLDKAWPL  340015

 Score = 41.2 bits (95),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = +2

Query  174     TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLK  233
               TS +V + +    G   L+     G++QDLI W+QL+  AR +L   D+ +        K
Sbjct  959333  TSTRVFHRHPDSSGWIGLEFGSVDGQYQDLIMWNQLTDQARAALESADFGED------TK  959494

Query  234     MPLKDGVFEELLDKTWPF  251
               +P  D  FE  L + W F
Sbjct  959495  VPFNDKNFETALAQAWLF  959548

>PHRA:scaffold_2136
Length=3667

 Score = 180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 131/230 (57%), Gaps = 15/230 (7%)
 Frame = +2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             IGHD+V+PFPQP+ VT+++K+ VKFKPQL I+ GC PYPAV   G  S GL+ +G  D  
Sbjct  602   IGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGVFD--  775

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C    L SQ+Y R+ W NDVWAIMYAWYFPKG     P         RH+W   VVWIDN
Sbjct  776   CIIPSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP-------WWRHDWSNAVVWIDN  934

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
             P  E   VLG+S+S S           + ++  +          + + AL    + GEFQ
Sbjct  935   PAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSRNVLPMRSAALGPAVNPGEFQ  1114

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             DL+ WDQL+  AR +LN    DQ  FG    ++P+ D  F + L K WPF
Sbjct  1115  DLVMWDQLTDAARAALN----DQDNFGRT--EVPISDDHFPKHLKKAWPF  1246

>PHKE:scaffold_1389 scf_22126_1389.1_contig_1 dna:supercontig 
supercontig:PhyKer238_432v1:scf_22126_1389.1_contig_1:1:1982:1 
REF
Length=1982

 Score = 177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 125/202 (62%), Gaps = 9/202 (4%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PFPQP+PVT S+K AVKFKPQLKID GC  YPAV   G ++GGLK +      
Sbjct  1386  INHDKVQPFPQPEPVTDSEKAAVKFKPQLKIDIGCASYPAVNAAGEINGGLKGTKGTSA-  1562

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C G  LGSQ+Y R    +DVWAIMYAWYFPKG        ++ F   RH+W++VVVWID+
Sbjct  1563  CEGPPLGSQVYGRVGLHDDVWAIMYAWYFPKGF-------WMYFPKKRHDWQHVVVWIDD  1721

Query  142   PGLENATVLGVSMSASIGYSKQAP-TDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
             P LE   VLG+S      Y+K +  T+ + +DGT+ K +           +    + G+ 
Sbjct  1722  PALETPKVLGLSAIQGSLYAKMSSVTNAEIIDGTTPKFSIGIPSYFDRLYVYAATEAGDS  1901

Query  201   QDLIQWDQLSSLARYSLNHTDW  222
             QDLI W+QL+  AR +L  TD+
Sbjct  1902  QDLILWEQLTDAARAALETTDF  1967

>PHIF:NW_003303722.1 Phytophthora infestans T30-4 supercont1.37 
genomic scaffold, whole genome shotgun sequence
Length=1588622

 Score = 180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 136/244 (56%), Gaps = 33/244 (14%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLK-WSGPQD  79
               + HD+V PFPQP+PVT+S+K A+KFK QL I  G C  YPAV   G + GGL  W    D
Sbjct  770633  VDHDKVEPFPQPEPVTISEKAAIKFKTQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  770812

Query  80      GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF-GHRHNWEYVVVW  138
                 C  + LGSQ+Y R+ W  D WAIMYAWYFPK        DF   F  HRH+W+ VVVW
Sbjct  770813  A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPK--------DFWTGFPTHRHDWKSVVVW  770965

Query  139     IDNPGLENATVLGVSMSAS-----------IGYSKQAPTDVKYVDGTSVKVAYYYNHLLG  187
               IDNP LE   + GVSMS S             Y   APT     +G++  + + Y    G
Sbjct  770966  IDNPALEIPKIEGVSMSKSDTKYKKKLKLKESYFSGAPT-----NGSNTSLRFEYEAGFG  771130

Query  188     NTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
               +T +  T   GE+Q+LI W+QL+  AR +LN    D   FG     +P  D  FE+ LD+
Sbjct  771131  STFMGFTRWDGEYQNLIMWEQLTDAARATLN----DGNNFGKEA-SVPFSDEHFEDRLDE  771295

Query  248     TWPF  251
                WPF
Sbjct  771296  AWPF  771307

 Score = 160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 118/201 (59%), Gaps = 8/201 (4%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I  + V P  QP P T +++ A++FKP+L I +GC  +PAV   G  S GL         
Sbjct  350303  IDLNNVAPIAQPSPSTATKRAAIRFKPRLSIASGCVSFPAVNAAGETSSGL*EGYGWSSG  350124

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQ+Y R+AW N  +AI+YAWYFPKG        +  +   RH+W   VVWID+
Sbjct  350123  CTNAPLGSQVYGRAAWYNGKYAILYAWYFPKGF-------WNEYATRRHDWASAVVWIDS  349965

Query  142     PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               P L + ++LG+S+S A   Y   AP      DGT+ ++A+  N   G   L  T+ TG+F
Sbjct  349964  PELASPSLLGLSISTADWKYKTYAPATSGITDGTTPRLAHVLNVERGYPYLATTDTTGDF  349785

Query  201     QDLIQWDQLSSLARYSLNHTD  221
               QDLI WDQLS+ AR +LN T+
Sbjct  349784  QDLIMWDQLSTAARAALNTTN  349722

 Score = 146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 116/206 (56%), Gaps = 24/206 (12%)
 Frame = +2

Query  56       CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA  115
                C P+PAV  +G  +GGL+ S   D  C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG  
Sbjct  1268522  CVPFPAVNAEGETTGGLQGSTGNDA-CKYAPLGSQVYGRAGWYKDVWAIMYAWYFPKGF-  1268695

Query  116      ATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPTDVKYVDG-  173
                      F+ F   R +W+ VVVWI+NPG E   + G SMS S   Y+K+     KY  G 
Sbjct  1268696  ------FMEFASRRRDWKSVVVWINNPGFETPMIAGASMSKSGAKYAKETKMLQKYFVGS  1268857

Query  174      --------TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQT  225
                        ++  + + +N  +G+ +L L+ + GE+QDLI W+QL+  AR +LN    D  
Sbjct  1268858  GRGWETAISNTSLRFKFNTNIGHGSLDLSVEKGEYQDLIMWEQLTGAARAALN----DGK  1269025

Query  226      LFGLAGLKMPLKDGVFEELLDKTWPF  251
                 F  A  ++P+ D  FE+ LD  WP 
Sbjct  1269026  NFRNA--EVPISDEHFEKHLDSAWPL  1269097

 Score = 146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 130/247 (53%), Gaps = 33/247 (13%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD+V PFPQP+PV  S+K A+ FKPQL +  G C  + AV   G ++GGLK S   D 
Sbjct  772204  VDHDKVEPFPQPEPVNASEKAAITFKPQLYVREGLCVSFTAVNTAGEVTGGLKGSNGNDA  772383

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  +  GSQ+Y R+ W  D+WAIMYAWYFPK      P        HRH+W  VVVWI+
Sbjct  772384  -CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKDFGTGFP-------THRHDWISVVVWIN  772539

Query  141     NPGLENATVLGV-SMSASIGYSKQAPTD---------VKYVDGTSVKVAYYYNHLLGNTA  190
               N  L+   + GV S   S+  S  + +D          ++V G +  ++    HL  +++
Sbjct  772540  NHDLDMPKIEGVGSPCPSLTQSITSRSDKWHPILLASKRWVGGITALISMTPTHLSDSSS  772719

Query  191     L------QLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                        T  T   QDLI W+QL+  AR +LN    D   F  A  K+P  D  FEE 
Sbjct  772720  R*VWALHSWTFHTD--QDLIMWEQLTDAARVALN----DGNNFSKA--KVPSSDEHFEER  772875

Query  245     LDKTWPF  251
               L+K WPF
Sbjct  772876  LNKAWPF  772896

 Score = 104 bits (260),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 98/196 (50%), Gaps = 32/196 (16%)
 Frame = +1

Query  71      GLKWSGPQDGECTGSRL---GSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG  127
               GLK S   DG     +    GSQIY+R+    D+WAIMYAWYFPKG     P        
Sbjct  893773  GLKGSNGNDGCKYAPKYAHQGSQIYSRAG*YKDIWAIMYAWYFPKGFWVFSPT-------  893931

Query  128     HRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQAPT---------------DVKYV  171
                RH+W+ VVVW DNP LE   +LGVSMS S   Y K+  T               +  Y+
Sbjct  893932  RRHDWKNVVVWNDNPDLEAPKILGVSMSKSDTAYMKEIKTWPSNFAGFRTEGRRYNRTYI  894111

Query  172     DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAG  231
                G++    + Y+   G++ L      GE+QDLI W+QL+  AR +L+    D   FG + 
Sbjct  894112  YGSNTSFRFEYHIDFGSSYLMFAVRDGEYQDLIMWEQLTDAARGALS----DSNNFGKS-  894276

Query  232     LKMPLKDGVFEELLDK  247
                ++P  D  +E  L +
Sbjct  894277  -EVPFSDDHYETHLKQ  894321

 Score = 53.9 bits (128),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGC  56
               I HD+V+PFPQP+PVT+S+K A+KFKPQL     C
Sbjct  893631  IDHDKVQPFPQPEPVTISEKAAIKFKPQLPRTRAC  893735

 Score = 20.8 bits (42),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 9/16 (56%), Gaps = 0/16 (0%)
 Frame = +2

Query  56      CHPYPAVQKDGSMSGG  71
               C  YPAV   G  +GG
Sbjct  893729  CVSYPAVNSAGDTTGG  893776

 Score = 120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 120/260 (46%), Gaps = 64/260 (25%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HDQV+P    DP+T+S+K  VKFKPQL ID GC  + AV   G +SGG K S   DG 
Sbjct  308450  LDHDQVQPL---DPITISEKVVVKFKPQLFIDHGCASFHAVNAAGELSGGFKGSDRTDG-  308617

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT      +   RS    D WA+++AWYF K   A    D       RH+W  +V+W+ N
Sbjct  308618  CT------EAPGRSTRYQDRWAMVFAWYFLKSFFAGSAQD-------RHDWACMVLWL-N  308755

Query  142     PGLENATVLGVSMSASI-------GYSKQAPTD---------------------------  167
               P LE   +LG S+S  +       GY + A  D                           
Sbjct  308756  PALEKPNILGASLSQQLMEPQKVFGYPRTALKDPYIKLTAVPPIGFVGTQEI*LNRISRW  308935

Query  168     ---VKYVDGT--SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDW  222
                    YV G+  S +V++         AL  +   GEF DLI W+QL+  AR +LN  D 
Sbjct  308936  NWNYTYVGGSNESTRVSHTIVEKFDWLALTFSCQDGEFHDLIMWNQLTDAARAALNSAD-  309112

Query  223     DQTLFGLAGLKMPLKDGVFE  242
                   FG A  K+PL D  FE
Sbjct  309113  ----FGEA--KVPLNDQNFE  309154

 Score = 114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 81/137 (59%), Gaps = 12/137 (9%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + HDQV+P    DP+T+S++ AVKFKPQL    GC   PAV     +SGGLK S   DG 
Sbjct  296764  LDHDQVQPL---DPITISERVAVKFKPQLYTKYGCASVPAVNAVDELSGGLKGSDGTDG-  296597

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQ+Y RS W  D WA+++AWYFPK   A    D       RH+W  + +W+ N
Sbjct  296596  CTEATLGSQLYGRSTWYQDRWAMVFAWYFPKSFFAGSAQD-------RHDWACMPLWL-N  296441

Query  142     PGLENATVLGVSMSASI  158
               P LE   +L  S+S  +
Sbjct  296440  PALEKPKILCASLSQQL  296390

 Score = 73.6 bits (179),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 9/95 (9%)
 Frame = -3

Query  40       QKTAVKFKPQLKIDAGCH-PYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWV  98
                +K A+KFKPQL      + PYPAV     ++GGLK +   D  C  + L  Q+Y R+ W 
Sbjct  1368765  KKPAIKFKPQLITPNIVYLPYPAVNAARDVTGGLKGTNGNDA-CEDAPLVPQVYGRARWY  1368589

Query  99       NDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWE  133
                 D WAIMYAWYFPK         F+ F   RH+W+
Sbjct  1368588  KDQWAIMYAWYFPKS-------VFMNFPTRRHDWK  1368505

 Score = 52.8 bits (125),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 11/122 (9%)
 Frame = -1

Query  135      VVVWIDNPGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGT--SVKVAYYYNH--LLGNT  189
                VVVWI N  +E   ++GVS+S A   + K+      Y  G+  S     + +H  +L  +
Sbjct  1368500  VVVWIYNSDVEAPQIIGVSISKADT*FFKEVNMQPAYFAGSQGSSTTLRFKHHVDVLAPS  1368321

Query  190      ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                +L  +E  G  QDLI  +QL+  AR +LN+ +     FG A  ++P  D  FE  L   W
Sbjct  1368320  SLYFSELDGNSQDLIM*EQLTDAAREALNNGNS----FGEA--EVPFSDEHFETFLKSAW  1368159

Query  250      PF  251
                PF
Sbjct  1368158  PF  1368153

 Score = 35.0 bits (79),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = -2

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQK  41
                M+ R +    + +L    A  I HD+V P PQP PVT+S+K
Sbjct  1368883  MSLRILTTILLVALVDCAATTIDHDKVEPIPQPAPVTISKK  1368761

 Score = 108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 93/173 (54%), Gaps = 14/173 (8%)
 Frame = -2

Query  44       VKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVW  102
                +KFKPQL   D  C PYPAV   G+ +GGLK +   D  C  + L  Q+Y R+ W  D W
Sbjct  1380742  IKFKPQLITPDIVCLPYPAVNAAGNATGGLKGTNGNDA-CKDAPLVPQVYGRARWYKDQW  1380566

Query  103      AIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS-ASIGYS  161
                AIMYAWYFPK         F+ F   RH+W+ V VWI N  +E   ++GVSMS A   + 
Sbjct  1380565  AIMYAWYFPKSV-------FMNFPTRRHDWKSVAVWIYNSDVEAPQIIGVSMSKADT*FF  1380407

Query  162      KQAPTDVKYVDGT--SVKVAYYYNH--LLGNTALQLTEDTGEFQDLIQWDQLS  210
                K+      Y  G+  S     + +H  +L  ++L  ++  G  QDLI W+ L+
Sbjct  1380406  KEVSMQPAYFAGSQGSSTTLRFKHHVDVLAPSSLYFSQLYGNSQDLIVWELLA  1380248

>PHKE:scaffold_819 scf_22126_819.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_819.1:1:7712:1 
REF
Length=7712

 Score = 180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 126/203 (62%), Gaps = 10/203 (5%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PFPQP+PVT S+K AVKFKP+LKI  GC  Y AV   G  +GGLK +G   G 
Sbjct  7113  IDHDKVQPFPQPEPVTDSEKAAVKFKPRLKIINGCGVYSAVNAAGETNGGLKGTGGVSG-  7289

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C  S L  Q+Y R+AW ND+WAIMYAWY PKG   T P         RH+W+ V+VWIDN
Sbjct  7290  CKISSLRPQVYGRAAWHNDIWAIMYAWYLPKGFWFTFPV-------RRHDWKNVIVWIDN  7448

Query  142   PGLENATVLGVSMSASIGYSKQAP-TDVKYVDGTSVKVAYYYNHL-LGNTALQLTEDTGE  199
             P LE   +LG+SMS    Y K AP ++   +DGT+ K    Y      NT L    + G+
Sbjct  7449  PALETPRMLGLSMSQGDDYGKIAPVSNPNTIDGTAPKFLIDYPEFGWSNTYLYSALEDGD  7628

Query  200   FQDLIQWDQLSSLARYSLNHTDW  222
             FQDLI W+QL+  AR +L  TD+
Sbjct  7629  FQDLIMWEQLTDAARAALETTDF  7697

>PHIF:NW_003303715.1 Phytophthora infestans T30-4 supercont1.44 
genomic scaffold, whole genome shotgun sequence
Length=1227050

 Score = 179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 141/270 (52%), Gaps = 55/270 (20%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF QPDPVT+S+K AVKFKPQL ID GC  +P V   G +SGGLK +   DG 
Sbjct  1054459  IDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLKGTKGTDG-  1054635

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C  S LGSQ Y+RSAW  D WAI++AWYFPKG AA  P         RH W  +V+WIDN
Sbjct  1054636  CRESPLGSQTYSRSAWYQDRWAIVFAWYFPKGFAAGQP-------RIRHYWSSMVLWIDN  1054794

Query  142      PGLENATVLGVSMSASI----------------------------GYSKQAPTDVKYVDG  173
                P L+  T+LGVS+S  +                            G+     T V  ++G
Sbjct  1054795  PALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVSQING  1054974

Query  174      ------------TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                             S++V++ Y +     AL      GE+ DL+ WDQL+  AR +LN  D
Sbjct  1054975  WSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAALNSAD  1055154

Query  222      WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                + ++       K+P  D  F+  L+ +W F
Sbjct  1055155  FGES-------KVPFSDQNFQRTLELSWLF  1055223

 Score = 154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 138/270 (51%), Gaps = 55/270 (20%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP+PVT+S+K AVKFKPQL I+ GC  +PAV   G ++GGLK      G 
Sbjct  785359  IDHDKVQPFAQPNPVTISEKAAVKFKPQLHIERGCVSFPAVNAAGELTGGLK-GTGGTGG  785183

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQIY RSAW  D WA+++AWYFPKG +++           RH W  +V+W+DN
Sbjct  785182  CTKAPLGSQIYGRSAWYQDKWAMLFAWYFPKGFSSSD-------HSIRHYWSSMVLWLDN  785024

Query  142     PGLENATVLGVSMSASIG-----------------YSKQAPTDVKYVDGTSVKVA-----  179
               P L+  T LG S+S  +                  YSKQ         GT   V      
Sbjct  785023  PALDAPTFLGASLSQQLHKPRKILFGLYTAERKEPYSKQTAIPPMGFVGTQATVVGRVSR  784844

Query  180     --YYYNHLLGNT----------------ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                 Y YN+  G+                 AL      GEFQDLI WDQ++  AR +LN  D
Sbjct  784843  WRYTYNYSGGSNVSTRISQTYTNKGDRLALTFAFQNGEFQDLIMWDQMTDAARAALNSAD  784664

Query  222     WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               + ++       K+P  D  F+  L  +WPF
Sbjct  784663  FGES-------KVPFSDQNFQTTLGLSWPF  784595

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  41      KTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAW  97
               K AVK KPQL+I++ C  +PAV   G ++G LK +   D     S LGSQ Y RSAW
Sbjct  707655  KAAVKLKPQLRIESSCASFPAVNAAGELTGKLKGTKGTDDYADAS-LGSQTYGRSAW  707822

>PHRA:scaffold_516
Length=11046

 Score = 179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 131/233 (56%), Gaps = 18/233 (8%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
             I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  8488  IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  8309

Query  80    GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVW  138
               CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        F     + RH+W   VVW
Sbjct  8308  A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKG--------FWDSRAYWRHDWSNAVVW  8156

Query  139   IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
             ID+P LEN  VLG+S+S S           + +   +    Y          L     +G
Sbjct  8155  IDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYECAELVPYYASG  7976

Query  199   EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             E QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L+K WP 
Sbjct  7975  EVQDLIMWDQLTDAARAALN----DQDNFGRT--EVPINDDHFLKHLEKAWPL  7835

>PHRA:scaffold_2762
Length=2418

 Score = 145 bits (367),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 104/172 (60%), Gaps = 15/172 (9%)
 Frame = +3

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
            G C GS  GSQ+Y RSAW+NDVWAIMY+WYFPK   ++         GHRH+WE+VVV+I
Sbjct  498  GGCRGSGHGSQVYGRSAWLNDVWAIMYSWYFPKDSPSS-------GMGHRHDWEHVVVFI  656

Query  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
            DNP +    ++G S S+  GY K AP     +DGTSVKV Y ++  + N  L +T D G 
Sbjct  657  DNPDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGT  833

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            FQDLI WDQ++  AR +LN        FG A    P+ DG F   L+K  PF
Sbjct  834  FQDLIMWDQMTEDARRALN-----GVHFGDA--NTPMNDGNFIPKLEKASPF  968

 Score = 72.8 bits (177),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
            I H +V+PF QP P T+S+K  VKFKPQ++I  GC PYPAV   G  SGGLK SG
Sbjct  325  ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSG  489

>PHPA:scaffold_31 NW_008649017.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.31, whole genome shotgun 
sequence
Length=700024

 Score = 178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 132/231 (57%), Gaps = 15/231 (6%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               +  ++V P  QP P T +QK A+KFKP+L I  GC  +PAV   G  S GL+        
Sbjct  319898  VDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSSG  319719

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQ+Y R+ W N  +AI+Y WYFPKG        +  +   RH+W   VVWIDN
Sbjct  319718  CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKGF-------WNEYATRRHDWASAVVWIDN  319560

Query  142     PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               P L + ++LG+S+S A   +   AP      DGT+ ++A+  N   G   L  T+  G+F
Sbjct  319559  PELASPSILGLSVSTADWKFKTFAPASSGITDGTTPRLAHVLNVEKGYPYLTTTDTVGDF  319380

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               Q+LI WDQL++ AR +LN TD     FG+A  K+P+ D  F+  L K WPF
Sbjct  319379  QELIMWDQLTTAARTALNTTD-----FGVA--KVPVSDAAFDTKLKKAWPF  319248

 Score = 173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 139/249 (56%), Gaps = 34/249 (14%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               +  D V+PF QP+PVTV +K A+KFKP L ID GC  +PAV + G++S GL+     DG 
Sbjct  256074  VDCDFVKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLRPLNGNDG-  255898

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C  +  GSQ+Y RS    D WAIM+AWYFPKG  + +P         RH+W  +VVWID+
Sbjct  255897  CIKAPQGSQVYGRSTQFQDKWAIMFAWYFPKGFWSGMP-------SRRHDWASMVVWIDD  255739

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVK-----------------YVDG--TSVKVAYYY  182
               P  E   +LGVS+S S     +A   +                  YV+G  TS+++++  
Sbjct  255738  PDFETPKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRISHSS  255559

Query  183     NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
                   G  +L L+   G++QDLI W QL+  AR +LN  ++ +++       +P  D  FE
Sbjct  255558  GFFFGPASLDLSTRDGDYQDLIMWKQLTEEARKALNSANFGKSV-------VPFNDDNFE  255400

Query  243     ELLDKTWPF  251
               ++L+K WPF
Sbjct  255399  DMLEKAWPF  255373

 Score = 40.4 bits (93),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 8/78 (10%)
 Frame = +1

Query  36      VTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARS  95
                T+S+       P   +     P+  +   G ++G L   G      TG+ LGS  Y R+
Sbjct  282223  ATISKSLQSSTNPSFTLTQVAFPF-TINAAGEITGDLGTKG------TGA-LGSLTYDRT  282378

Query  96      AWVNDVWAIMYAWYFPKG  113
                W  D WA+++A YFPKG
Sbjct  282379  TWYQDPWAMLFARYFPKG  282432

 Score = 28.9 bits (63),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  129     RHNWEYVVVWIDNPGLENATVLGVSM  154
               R++   + VW DNP LE   +LGVS+
Sbjct  282458  RYS*VRMTVWFDNPALETPNILGVSL  282535

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPY  59
               I HDQV+   QP+   + QK+A+K+KPQL IDAGC P+
Sbjct  282183  INHDQVQRLAQPNCHNI-QKSAIKYKPQLYIDAGCIPF  282293

>PHCA:scaffold_53 PHYCAscaffold_53
Length=465517

 Score = 177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 141/275 (51%), Gaps = 65/275 (24%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHDQV+PFPQP+PVT+S+K AVK+KP L I  GC  +PAV   G ++GGLK  G +D E
Sbjct  408919  IGHDQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLK--GTKDTE  408746

Query  82      -CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH----RHNWEYVV  136
                CT + LG+Q+Y RS W  D WA+MY+WYFPK            F GH    RH+W  VV
Sbjct  408745  DCTEAPLGTQVYGRSTWFQDKWAMMYSWYFPKN-----------FCGHKAADRHDWANVV  408599

Query  137     VWIDNPGLENATVLGVSMSA-----------SIGYSKQAPTDV-------------KYVD  172
               +WIDNP LENAT LG S+S            ++   K+ P                + V 
Sbjct  408598  IWIDNPALENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIVT  408419

Query  173     GTSVKVAYYYNHLLG-NTALQ---------------LTEDTGEFQDLIQWDQLSSLARYS  216
               G   + +Y Y ++ G NT ++                    GE QDLI W+QL+  AR +
Sbjct  408418  GRVSRHSYTYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARAA  408239

Query  217     LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               L   D+  T       ++P  D  FE  L   WPF
Sbjct  408238  LESADFGNT-------QVPFTDKNFETNLQAAWPF  408155

 Score = 171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 137/271 (51%), Gaps = 57/271 (21%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PFPQP+PVT+S+K AVK+KPQL+I  GC  +PAV   G ++GGLK  G +D E
Sbjct  413930  IDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLK--GTKDTE  413757

Query  82      -CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                CT + LGSQ+Y RS W  D WA+MY+WYFPK   A            RH+W  VV+WID
Sbjct  413756  ACTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCAYKA-------AGRHDWANVVIWID  413598

Query  141     NPGLENATVLGVSMSAS-----------IGYSKQAPTD----------------------  167
               NP  EN T LG S+S             +G   + P                        
Sbjct  413597  NPAAENVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRVG  413418

Query  168     -----VKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHT  220
                     KYV G  T+++ ++ Y    G   +   +  GE QDLI W+QL+  AR +L   
Sbjct  413417  RWSYTYKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALESA  413238

Query  221     DWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D+  T       ++P  D  F+  L   WPF
Sbjct  413237  DFGDT-------QVPFTDKNFDTNLQAAWPF  413166

 Score = 170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 133/270 (49%), Gaps = 55/270 (20%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+PVT+S+K AVK+KP L I  GC  +PAV   G ++GGLK +     +
Sbjct  388997  IDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLKGT-KNTKD  388821

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQ+Y RSAW  D WA+MY WYFPK   A            RH+W  VVVWIDN
Sbjct  388820  CTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCAYKA-------AGRHDWANVVVWIDN  388662

Query  142     PGLENATVLGVSMSA-----------SIGYSKQAPTD-----------------------  167
               P LENAT LG S+S            ++   K+ P +                       
Sbjct  388661  PALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVGR  388482

Query  168     ----VKYVDG--TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                    KYV G  T+++  + Y        +      GE QDLI W+QL+  AR +L   D
Sbjct  388481  WSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESAD  388302

Query  222     WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               +  T       ++P  D  FE  L   WPF
Sbjct  388301  FGNT-------QVPFTDKNFETNLQAAWPF  388233

 Score = 156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 12/136 (9%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP+PVT+S+K AVK+KPQL I AGC  +PAV   G ++GGLK  G +D E
Sbjct  386983  IDHDQVKPFAQPEPVTISEKAAVKYKPQLNIGAGCVSFPAVNAAGEITGGLK--GTKDTE  386810

Query  82      -CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWI  139
                CT + LGSQ+Y RSAW  D WA+MYAWYFPK        +F  +    RH+W  VVVWI
Sbjct  386809  ACTEAPLGSQVYGRSAWYQDKWAMMYAWYFPK--------NFCAYKAAGRHDWANVVVWI  386654

Query  140     DNPGLENATVLGVSMS  155
               DNP LENAT LG S+S
Sbjct  386653  DNPALENATFLGASLS  386606

 Score = 40.4 bits (93),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 28/54 (52%), Gaps = 7/54 (13%)
 Frame = -1

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               GE QDLI W+QL+  AR +L   D+  T       ++P  D  FE  L   WPF
Sbjct  382345  GESQDLIMWNQLTDKARAALESADFGDT-------QVPFTDKNFETNLQAAWPF  382205

>PHKE:scaffold_899 scf_22126_899.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_899.1_contig_1:1:6079:1 
REF
Length=6079

 Score = 177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 132/237 (56%), Gaps = 32/237 (14%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK-WSGPQDG  80
             I ++++ PF QP+ VTVS+K AVKFKPQL+I  GCH Y AV   G  S G    SG  D 
Sbjct  2977  IDYNEIEPFAQPEAVTVSEKAAVKFKPQLRISDGCHSYAAVNAVGDTSSGSDPTSGWGDW  2798

Query  81    ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
              C G+ +GSQ+Y RSAW N+VWAIMYAWYFP                  HNWE +VVWID
Sbjct  2797  VCRGADIGSQVYGRSAWHNNVWAIMYAWYFPNDEVT-------------HNWENIVVWID  2657

Query  141   NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY------YYNHLLGNTALQLT  194
             NP LE   VLG+S ++  GY + +P +    DG   ++ Y       Y+H      L  T
Sbjct  2656  NPALEEPKVLGISTTSGGGYVRYSPPEKSDFDGDGPQINYDVESSTSYHH-----GLDTT  2492

Query  195   EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                G+FQDLI WDQL+  AR +L +T+     FG A +  P KDG F   L    P+
Sbjct  2491  SRGGDFQDLIMWDQLTEEARAALQNTN-----FGEAAV--PFKDGNFTANLAFAKPY  2342

 Score = 107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 77/139 (55%), Gaps = 9/139 (6%)
 Frame = -2

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             ++FRAV    +A     +A  I +D+V PF +P+P T+S K AVKFKPQL+I   CH Y 
Sbjct  4068  VDFRAVGAIVIACTTAVEAAAIKYDEVEPFAEPEPTTISDKAAVKFKPQLRITGECHSYA  3889

Query  61    AVQKDGSMSGGL--KWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATV  118
              V   G  S GL  K SG     C G  + +Q+Y RS W ND+WAIMYA YFPK      
Sbjct  3888  VVNAAGETSAGLEHKLSGSGASGCRGFGVDTQVYGRSTWYNDMWAIMYA*YFPKDSDQG-  3712

Query  119   PPDFLRFFGHRHNWEYVVV  137
                   F G  HN E +VV
Sbjct  3711  ------FMGRIHN*ENIVV  3673

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 7/65 (11%)
 Frame = -2

Query  187   GNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLD  246
             G   L+LT   G+FQDLI W+QL+  AR +L  T++D+         +P+KDG F   L 
Sbjct  6024  GYHILELTSLKGQFQDLIMWEQLTEEARIALQTTEFDEAW-------VPMKDGNFTANLK  5866

Query  247   KTWPF  251
             + WPF
Sbjct  5865  EAWPF  5851

 Score = 38.9 bits (89),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 59/137 (43%), Gaps = 32/137 (23%)
 Frame = -3

Query  125   FFGHRHNWEYVVVWIDNPGLENA----------TVLGVSMSASIGYSKQAPTDVKYVDGT  174
             F   R +W     WIDN  L+N           +V   + S  + +  Q   D       
Sbjct  3698  FITERISW-----WIDNLALKNHGLGPYSIIH*SVHERNSSRRVQFGWQ*SKDRLPFGSV  3534

Query  175   SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKM  234
               +V+++ +H++            +FQDLI  +QL++ AR  L +T     +FG A   +
Sbjct  3533  DWRVSHFGDHII----------E*DFQDLIM*EQLTAQARVVLQNT-----IFGEA--VV  3405

Query  235   PLKDGVFEELLDKTWPF  251
             P KDG F   L+K W F
Sbjct  3404  PFKDGSFTANLEKAWAF  3354

>HYAP:scaffold_1905 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1905:1:1446:1 
REF
Length=1446

 Score = 172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 131/237 (55%), Gaps = 29/237 (12%)
 Frame = -1

Query  22    IGHDQVRPFPQ----PDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGP  77
             I HDQV+PF Q      P  V+   A+KFKPQL I +GCH YPAV   G  SGGLK +G 
Sbjct  1233  IKHDQVQPFQQVVGDDSPTAVA---ALKFKPQLHISSGCHSYPAVNTVGEFSGGLKPTGH  1063

Query  78    QDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVV  137
              +G+C GS  GSQ+Y RSAW  D WAIMY WYFPK                RH+WE++VV
Sbjct  1062  DNGKCKGSGYGSQVYGRSAWHQDKWAIMYVWYFPKDNRD----------DDRHDWEHIVV  913

Query  138   WIDNPGLENATVLGVSM---SASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLT  194
             W+DNP + N  +L VS+     S  ++   P  V +VDG+SVK+ Y   +    T L LT
Sbjct  912   WLDNPAVANQKLLAVSLWNGRKSDYWTLAIPGPV-FVDGSSVKLDYGKANKDERT-LSLT  739

Query  195   EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                GEFQ LI W Q+S  AR + N   W +         MPL D  FE+ L K + F
Sbjct  738   HLAGEFQPLIMWGQMSEKARTTFNTVLWRKEF-------MPLSDSCFEQHLKKAYDF  589

>PHSO:scaffold_2
Length=11587142

 Score = 177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 124/247 (50%), Gaps = 36/247 (15%)
 Frame = +1

Query  22        IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                 I HD+V+PF QP PVT+S+K AVKFKP L I   CHPYPAV   G  S GLK  G  + +
Sbjct  10059907  IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  10060086

Query  82        CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                 C GS LGSQ+Y R+ W   +WAIMYAWYFPK        D +  FG RH W   VVW+DN
Sbjct  10060087  CRGSELGSQVYGRATWHKGMWAIMYAWYFPK--------DSVSKFGQRHKWNAAVVWLDN  10060242

Query  142       PGLENATVLGVSMSASIG-------------YSKQA-----PTDVKYVDGTSVKVAYYYN  183
                 P +    +L VS     G             Y  ++     P  V  ++GT+  + Y   
Sbjct  10060243  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  10060422

Query  184       HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                  +            GEFQDLI W+QL+  AR +L   D     FG      P  DG F+ 
Sbjct  10060423  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAAD-----FG-----APFVDGAFKS  10060572

Query  244       LLDKTWP  250
                  LD   P
Sbjct  10060573  NLDSARP  10060593

 Score = 174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 123/247 (50%), Gaps = 36/247 (15%)
 Frame = +3

Query  22        IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                 I HD+V+PF QP PVT+S+K AVKFKP L I   CHPYPAV   G  S GLK  G  + +
Sbjct  10046472  IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  10046651

Query  82        CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                 C GS LGSQ+Y R+ W   +WAIMYAWYFPK        D +  FG RH W   VVW+DN
Sbjct  10046652  CRGSELGSQVYGRATWHKGMWAIMYAWYFPK--------DSVSKFGQRHKWNAAVVWLDN  10046807

Query  142       PGLENATVLGVSMSASIG-------------YSKQA-----PTDVKYVDGTSVKVAYYYN  183
                 P +    +L VS     G             Y  ++     P  V  ++GT+  + Y   
Sbjct  10046808  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  10046987

Query  184       HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                  +            GEFQDLI W+QL+  AR +L   D     FG      P  D  F+ 
Sbjct  10046988  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAAD-----FG-----APFVDEAFKS  10047137

Query  244       LLDKTWP  250
                  LD   P
Sbjct  10047138  NLDSARP  10047158

 Score = 173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 131/232 (56%), Gaps = 16/232 (7%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
                I  ++V PF QP   T +QK AVKFKP+L I +G C  +PAV   G  S GL   G    
Sbjct  1246622  IDLNKVAPFAQPTASTSAQKAAVKFKPRLSIGSGACVSFPAVNSAGDTSSGLSEEGKGST  1246801

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                +CT + LGSQ+Y R+AW N  +AI+YAWYFPKG     P         RH+W   VVWID
Sbjct  1246802  DCTNAPLGSQVYGRAAWYNTRFAILYAWYFPKGFWNDYP-------TRRHDWASAVVWID  1246960

Query  141      NPGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
                NP      +LG+S+S A   YS QAP      DGT+ K+++  +   G+  L  T+ +G+
Sbjct  1246961  NPDSNTPKILGLSLSTADWEYSTQAPATSGISDGTTPKLSHELSVECGDPYLTTTDGSGD  1247140

Query  200      FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                FQ LI W+QL++ AR +LN  D     FG A  K+P  D  FE  L   WPF
Sbjct  1247141  FQPLIMWEQLTTAARTALNSAD-----FGNA--KVPTSDVNFEMKLKSAWPF  1247275

 Score = 160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 140/272 (51%), Gaps = 43/272 (16%)
 Frame = +3

Query  1        MNFRav-fvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPY  59
                MNFRA+        +A A A  I +D+V P  QP+ VT+S+K  VKFKPQL +D GC  +
Sbjct  1883082  MNFRALFLSTVAVGIATADAASIAYDKVAPIAQPEAVTISEKAGVKFKPQLFVDGGCTSF  1883261

Query  60       PAVQKDGSMSGGLKWSGPQDG---ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAA  116
                PAV   G  S  L    P+DG    C  + LGSQ+Y R+ W  DVWAIMYAWY+PK    
Sbjct  1883262  PAVNAAGETSS*L----PRDGGNYGCVKAPLGSQVYGRATWYKDVWAIMYAWYYPKSF--  1883423

Query  117      TVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS--ASIGYSK------------  162
                     F       H+W+  VVWIDNP + +  +L +S S  +   Y K            
Sbjct  1883424  -----FASIGTGTHDWQNAVVWIDNPAVASPKILALSTSKKSETDYMKPTITTETFNSAS  1883588

Query  163      ---QAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
                   +A   ++ V+GTSVK+      +LG   L+ T + GEFQDLI W+QL   AR +L+ 
Sbjct  1883589  NYDKAKAPIQNVNGTSVKLV--STSILGPMFLRSTPEAGEFQDLIMWNQLPEEARAALSG  1883762

Query  220      TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 D            +P  D  F++ L + WPF
Sbjct  1883763  KDIGD---------VPFSDANFQKKLGEAWPF  1883831

 Score = 150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 133/239 (56%), Gaps = 25/239 (10%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V+PF Q +PVT+S+K  VK+KP +    GC  +PAV   G  +GGLK SG   G 
Sbjct  1155269  IDHDKVQPFAQREPVTLSEKLGVKYKPTMDDQEGCAVFPAVNAAGETNGGLKGSGGTTG-  1155445

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C  + LG+Q+Y RS W    +AI+YAWYFP G +A  P         RH+W   VVW+D+
Sbjct  1155446  CREAPLGAQVYGRSMWYEGKYAILYAWYFPNGFSADWPV-------RRHDWASAVVWLDD  1155604

Query  142      PGLENATVLGVSMSAS-IGYSKQAPTD-----VKYVDG---TSVKVAYYYNHLLGNTALQ  192
                P   + TV G+S S S   Y K+AP       +  V+G    ++ + +   + LG   L+
Sbjct  1155605  PEAASPTVSGLSYSTSDTKYDKEAPPSGDNACLASVNGGPYVTMVLEHAIPYFLGPMYLR  1155784

Query  193      LTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 +   G++ DLI W+QL+  AR +LN  D     FG A  ++P  D  FE+ L K WP+
Sbjct  1155785  CSGGGGDY-DLIMWEQLTDAARMALNTAD-----FGEA--EVPFNDVNFEKRLKKAWPY  1155937

 Score = 143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 118/234 (50%), Gaps = 24/234 (10%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +D+V PF QP PVT+S+K AV+F P L ID GC+PYPAV   G ++GGLK +  + G 
Sbjct  5455384  IDYDKVVPFAQPQPVTISEKIAVRFNPTLDIDGGCYPYPAVNAAGEITGGLKPTMGKQG-  5455560

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C     GSQ+Y R+ W ND +AIM+AWYFPK      P         RH+W  VV+WIDN
Sbjct  5455561  CLDPPAGSQVYGRATWHNDRYAIMFAWYFPKAFTRRKP-------SKRHDWANVVIWIDN  5455719

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
                P +E  +VL +++   +G      +  +  DG    +     H +       T       
Sbjct  5455720  PTVELPSVLQITVPDDLGRMVSGDSG-QCFDGLKPTLKSTTPHFVLTLQFINTRTVTYCH  5455896

Query  202      --------DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
                        +LI WDQL+  AR  LN   +D       G ++P  +  F   LD+
Sbjct  5455897  APGSSAPLNLIMWDQLTEAARNPLNTASFD-------GSQVPFNEPNFAAKLDE  5456037

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = -1

Query  69       SGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH  128
                SGGLK SG   G C GS  GSQ+Y  +AW ND++AI+YAWYFPKG +   P         
Sbjct  1153127  SGGLKVSGGSPG-CEGSPFGSQVYGCAAWHNDLYAIVYAWYFPKGFSGPSP-------SR  1152972

Query  129      RHNWEYVVVWIDNPGLENATVLGVSMSAS  157
                RHNW   VV +DNP +    ++G+ +S S
Sbjct  1152971  RHNWSSAVVGLDNPDVATPKIMGLLLSNS  1152885

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y R+AW ND++AI+YAWYFPKG +   P         RH+W   VVW+DN
Sbjct  1132012  CEGSPFGSQVYGRAAWHNDLYAIVYAWYFPKGFSGPSP-------SRRHDWVSAVVWLDN  1132170

Query  142      PGLENATVLGVSMSASIGYSKQAP  165
                  +    ++G+S+S S    K+ P
Sbjct  1132171  LDVATPKIMGISLSNSDDKYKKDP  1132242

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 17/87 (20%)
 Frame = -2

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSG------------G  71
                HD+V+P  QP+PVT+++K  VKFKP++ I  GC  YPAV + G  SG            G
Sbjct  1153270  HDKVKPHAQPEPVTIAEKAGVKFKPRMSIREGCASYPAVNEAGETSGPVEVLR*AEDLQG  1153091

Query  72       LK--WSGPQDGECTGSRLGSQIYARSA  96
                +K   SGP+    TG+R G+ I   S 
Sbjct  1153090  VKVLHSGPR---FTGARRGTTICTPSC  1153019

>PHRA:scaffold_2258
Length=3407

 Score = 176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 130/233 (56%), Gaps = 18/233 (8%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
             I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  2359  IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  2538

Query  80    GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVW  138
               CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG        F     + RH+W   VVW
Sbjct  2539  A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKG--------FWDSRAYWRHDWSNAVVW  2691

Query  139   IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
             ID+P LEN  VLG+S+S S           + +   +    Y          L     +G
Sbjct  2692  IDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSLYRMMPTYKCAELVPYYASG  2871

Query  199   EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             E QDLI W QL+  AR +LN    DQ  FG    ++P+ D  F + L+K WP 
Sbjct  2872  EVQDLIMWGQLTDAARAALN----DQGNFGRT--EVPINDDHFLKHLEKAWPL  3012

>HYAP:scaffold_64 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_64:1:357926:1 
REF
Length=357926

 Score = 176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 132/230 (57%), Gaps = 14/230 (6%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             + HD+++PF + +P T ++K  V+FKPQ+K   GCH Y AV   G  SGGLK  G  +G+
Sbjct  1261  LPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGK  1440

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C GS  GSQIY RSA   + WAIMYA YFPK          +   G+RH +E+V+VWID+
Sbjct  1441  CKGSGFGSQIYGRSAPFGNKWAIMYALYFPKDMK-------VLNRGYRHAFEHVIVWIDD  1599

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
               L++  +L V+   +  Y K    D + +DG SVK+ Y    L G   L  +   GEFQ
Sbjct  1600  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  1779

Query  202   DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              LI W+QL++ AR +L   +W +        KMPL D  F E L++ WPF
Sbjct  1780  PLIMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  1908

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 8/134 (6%)
 Frame = +3

Query  90      QIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL-ENAT  148
               + + RSA     WAIMY  YFPK  A       + + G+RH +E+V+VWID+P   EN T
Sbjct  340947  RAFERSALYEGKWAIMYVLYFPKDMA-------IMYKGYRHAFEHVIVWIDDPARGENLT  341105

Query  149     VLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQ  208
               +L V+   +  Y +  P + KYVDG SVK+ Y   + +    L  T + GEFQ LI W+Q
Sbjct  341106  ILAVTPWGNGCYLQLVPPEPKYVDGDSVKLLYDKKYYVEYHYLSPTREPGEFQPLIMWEQ  341285

Query  209     LSSLARYSLNHTDW  222
               L+  AR +L   DW
Sbjct  341286  LTDAARTALETVDW  341327

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPY  59
               I H++VRP  +P P T  +K  V++KPQ+    GCH Y
Sbjct  345915  IPHNEVRPLSEPAPKTNLEKAGVRYKPQIHFGYGCHSY  345802

>HYAP:scaffold_71 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_71:1:332402:1 
REF
Length=332402

 Score = 176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 130/228 (57%), Gaps = 14/228 (6%)
 Frame = +2

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HD+++PF + +P T ++K  V+FKPQ+K   GCH Y AV   G  SGGLK  G  +G+C 
Sbjct  158393  HDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGKCK  158572

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
               GS  GSQIY RSA   + WAIMYA YFPK              G+RH +E+V+VWID+  
Sbjct  158573  GSGFGSQIYGRSAPFGNKWAIMYALYFPKDMKVLN-------RGYRHAFEHVIVWIDDIA  158731

Query  144     LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
               L++  +L V+   +  Y K    D + +DG SVK+ Y    L G   L  +   GEFQ L
Sbjct  158732  LKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQPL  158911

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I W+QL++ AR +L   +W +        KMPL D  F E L++ WPF
Sbjct  158912  IMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  159034

 Score = 132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 104/192 (54%), Gaps = 17/192 (9%)
 Frame = -1

Query  62      VQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPD  121
               V   G  SGGL  +G  D  C GSR  SQIY RSA V + WAIMYA Y PK        D
Sbjct  135458  VDAAGHNSGGLNPTGRSDSNCKGSRHRSQIYGRSAPVGNKWAIMYALYLPK--------D  135303

Query  122     FLRFF-GHRHNWEYVVVWIDNPGL-ENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179
                +R   G+RH +E+V+VWIDNP L EN+T+L V+      Y ++ P   + +DG SVK+ 
Sbjct  135302  MMRCNKGYRHAFEHVIVWIDNPELEENSTILAVTPWEYNEYLRRVPPSPELMDGDSVKLK  135123

Query  180     YYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDG  239
               Y          L  T   GEFQ LI W+QL+  AR  L   DW +        +MP+ D 
Sbjct  135122  YESEDDYSYHWLSFTTVPGEFQPLIMWEQLTDDARTVLETVDWGKD-------RMPISDV  134964

Query  240     VFEELLDKTWPF  251
               VF+E L + WPF
Sbjct  134963  VFDESLKRAWPF  134928

>PLHA:NW_020187532.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_614, whole genome shotgun sequence
Length=3420761

 Score = 175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 140/231 (61%), Gaps = 15/231 (6%)
 Frame = -1

Query  25       DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
                D+V+PF Q  P T+SQ++A+K+KP+L +D GCHPYP VQ++GS+S G++W       C G
Sbjct  3164789  DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  3164610

Query  85       SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWIDNP  142
                S  GSQIY+RS W    WA++Y WY P    +T       +F  GHRH W +VV+W D+P
Sbjct  3164609  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDSTA------WFVDGHRHFWLWVVIWTDSP  3164448

Query  143      GLENATVLGVSMSA-SIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                  +++T+L  SMS       K AP   KY +   ++KV    + +     L+LT+  GEF
Sbjct  3164447  DPDDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEF  3164268

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                QDLI W+QLS  AR +L++      L   A    P++D +F E+L+K++PF
Sbjct  3164267  QDLITWEQLSDEARAALSNF---HRLEKRAN--PPIQDKLFYEVLEKSYPF  3164130

>PLHA:NW_020187732.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_816, whole genome shotgun sequence
Length=2620190

 Score = 174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 133/230 (58%), Gaps = 12/230 (5%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I  D V+PFP+  P   SQ TA+K+KP+L I  GCHPYPAVQ DG++S G +WS      
Sbjct  2328190  IDADNVQPFPESKPCNDSQTTALKYKPRLLITDGCHPYPAVQSDGAVSAGFEWSRFNRHP  2328369

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+YARS+W  D WA+MY WYFP    +     F+R  GHRH W + +VW   
Sbjct  2328370  CEGSPLGSQVYARSSWYEDKWAVMYVWYFPMALDSVS--TFVR--GHRHYWLWAIVWTSG  2328537

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                P  + +T LGVSMS   G +KQ     KYV + T+V +  +         L+LT+ +G  
Sbjct  2328538  PDPDESTFLGVSMSGDHGITKQLRPKSKYVFNETTVLLKSHEGFFSTRQGLELTKKSGGT  2328717

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGL-AGLKMPLKDGVFEELLDKTW  249
                Q+L+ WDQL+  AR SL+      +LF        PL+D  + ++L K +
Sbjct  2328718  QNLVTWDQLTPEARTSLS------SLFRTEVTANPPLQDRQYFDILKKAY  2328849

 Score = 172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 132/230 (57%), Gaps = 10/230 (4%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                +G D V PFP+    T SQK+A+ F+PQL I+ GCHPYPAVQ +GS++ GL++   +D  
Sbjct  2330329  LGADSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELFRDPT  2330150

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS+W    WA +Y WYFP       P       GHRH W + +VW  +
Sbjct  2330149  CEGSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHASPFS----TGHRHYWLWAIVWTTD  2329982

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                P       L VSMS + G S      +K+ V+GT+V +  + + +    AL LTE +GE 
Sbjct  2329981  PNPAEGHFLAVSMSGNFGISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGEK  2329802

Query  201      QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                +DLI W++L+  AR +L+     +     A    PL+D  F  LL+K +P
Sbjct  2329801  EDLITWEELTPEARAALSSVKRTE-----ATANSPLQDNKFFSLLEKAYP  2329667

 Score = 171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 135/236 (57%), Gaps = 19/236 (8%)
 Frame = -2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                +  ++V+PF Q  P T SQK+A+K++P+L +   C+PYPAVQ DGS+S GL W       
Sbjct  2320261  VNVNEVQPFKQRKPTTDSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQSR  2320082

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQIY+RS W    WAIMYAWY P+     +  +     GH H W +VVVW D+
Sbjct  2320081  CNGSPRGSQIYSRSDWYRGKWAIMYAWYLPRA----LDQNIWDVDGHSHFWTFVVVWTDS  2319914

Query  142      PGLENATVLGVSMSASIG--YSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTG  198
                P  + +T+L  S S  +G    K +P   KY ++  S+KV  + NH    T L+LTE  G
Sbjct  2319913  PDPDVSTILAASTSG-VGNRIKKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVG  2319737

Query  199      EFQDLIQWDQLSSLARYSL---NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                E Q LI W+QL+  AR +L   +++DW         ++ P++D  F  +L   +PF
Sbjct  2319736  ELQTLITWEQLTDEARAALSSVHYSDWR--------MESPIQDKWFRPMLSSAYPF  2319593

>PHRA:scaffold_319
Length=18160

 Score = 172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 109/160 (68%), Gaps = 8/160 (5%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD+V+PF QP+PVT S+K AV+FKP L+I +GCHPYPAV   G  S GLK +GP  G+
Sbjct  14408  IDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIFSGCHPYPAVNAAGETSAGLKGTGPSSGD  14587

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+DN
Sbjct  14588  CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWVNVVVWLDN  14746

Query  142    PGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAY  180
              P LE  T++GVS S+ +  Y K  P     + GT+  + Y
Sbjct  14747  PALERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTSMINY  14866

>PHPA:scaffold_60 NW_008649046.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.60, whole genome shotgun 
sequence
Length=386225

 Score = 172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 137/247 (55%), Gaps = 31/247 (13%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
              + HD+V PFPQP PVT+S+K A+KFKPQL      C P+P V   G ++GGLK +   D 
Sbjct  93461  VDHDKVEPFPQPVPVTISEKAAIKFKPQLYTPYNICVPFPGVNAVGEVTGGLKGTNGNDA  93282

Query  81     ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
               C  +  GSQIY R  W  D+WAIMYA Y PKG    +P         RH+ + VVVWI+
Sbjct  93281  -CKYAPKGSQIYGRGGWYKDIWAIMYACYLPKGFWMDLP-------SRRHDGKSVVVWIN  93126

Query  141    NPGLENATVLGVSMSAS---------------IGYSKQA-PTDVKYVDGTSVKVAYYYNH  184
              NPG E   ++GVSMS S                GY K+   ++  Y+ G++  + + Y  
Sbjct  93125  NPGFETPKIVGVSMSKSDTKYYKETKIGPFAFAGYRKEGRRSERAYIYGSNTSLRFQYES  92946

Query  185    LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
               LG++ L   +  GE+QDLI W+QL+  AR +LN    D   FG A  ++P  D  +++ 
Sbjct  92945  GLGSSYLSFADCDGEYQDLIMWEQLTDAARAALN----DGNNFGDA--EVPFSDEHYKQH  92784

Query  245    LDKTWPF  251
              LDK WP 
Sbjct  92783  LDKAWPL  92763

>PHSO:scaffold_8
Length=3549547

 Score = 172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 137/242 (57%), Gaps = 27/242 (11%)
 Frame = +3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +D+V+PFP+ +P T+S+K A+K+KP L I  GCH Y AV   G  SGG+    P  G 
Sbjct  3244779  IDYDKVQPFPELEPKTISEKAAIKYKPSLAIWDGCHSYAAVNAAGDTSGGMDPKAPDGGT  3244958

Query  82       ---------CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA---ATVPPDFLRFFGHR  129
                         C GS LGSQ+Y+RS W  DVWAIMYAWYFP+  +    + PP        R
Sbjct  3244959  QVQNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEESSPP-------VR  3245117

Query  130      HNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGN  188
                H+W   +VW+DNP LEN ++LGVS S     Y    PT   Y++GT  K+ YY   ++G 
Sbjct  3245118  HDWINTIVWLDNPALENPSLLGVSASREGAVYVTYPPTVKGYMNGTHPKMEYYLGFIVGG  3245297

Query  189      -TALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDK  247
                   + ++ + G+FQDL+ W QL+  AR +L   D     FG+    +P  D  FE+ L++
Sbjct  3245298  YHTIDVSLEAGDFQDLVHWSQLTDQARKALETAD-----FGVV-TPVPFNDVNFEKNLER  3245459

Query  248      TW  249
                 W
Sbjct  3245460  GW  3245465

 Score = 170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 130/231 (56%), Gaps = 17/231 (7%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I +DQV PFP+  P T+S+K A+KFKP L I  GCHPY AV   G  SGGL      D E
Sbjct  3215981  IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGLD-PKASDDE  3216157

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS LGSQ+Y+RS W  + WA MYAWYFPK         +LR  G RH+W   +VW+DN
Sbjct  3216158  CKGSTLGSQVYSRSTWYRNTWATMYAWYFPKDTNL-----YLR--GVRHDWVSAIVWLDN  3216316

Query  142      PGLENATVLGVSMS---ASIG--YSKQAPTDVKYVDGTSVKVAYY-YNHLLGNTALQLTE  195
                P L N T++GVS S   AS G  +  ++     YVDGT  K+ Y   +   G   +  +E
Sbjct  3216317  PALANQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASE  3216496

Query  196      DTGEFQDLIQWDQLSSLARYSLNHTDWDQTL---FGLAGLKMPLKDGVFEE  243
                D G+FQDLI W QL+  AR +L   D+       F  A  K  L+ G  ++
Sbjct  3216497  DVGDFQDLIHWSQLTEEARNALETGDFGSDTPVPFNNANFKKNLERGFIDD  3216649

 Score = 111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/246 (35%), Positives = 114/246 (46%), Gaps = 48/246 (20%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKD----GSMSGGLKWSGP  77
                I +D+V+PFP+P+    S +  +    QL     C    A  +     G  SGGL     
Sbjct  3217375  IDYDKVQPFPEPE----SPRRPLSSSNQL-----CSSRTAATRTLL*TGDTSGGLDPKAS  3217527

Query  78       QDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVV  137
                 D EC GS LGSQ+Y++S W  D  A MYAWYFPK          L   G RH+W   +V
Sbjct  3217528  DD-ECKGSALGSQLYSQSTWHRDTGATMYAWYFPKDTN-------LYLRGVRHDWVSAIV  3217683

Query  138      WIDNPGLENATVLGVSMSASIGYSKQAPTD-VKYVDGTSVKVAYYY-------------N  183
                W+DNP L N TV+GVS+S       +  TD V +   TS + AY               N
Sbjct  3217684  WLDNPALVNQTVVGVSLS-------RGGTDYVAFHPATSRRSAYLMEDGRHPMMEYSAEN  3217842

Query  184      HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                   G   +  +   G+ QDLI W QL+  AR +L   D     FG + L  P  D  F +
Sbjct  3217843  TKSGYHTIDASLSVGDSQDLIHWSQLTDQARDALQTGD-----FGSSTLA-PFNDANFAK  3218004

Query  244      LLDKTW  249
                 L++ W
Sbjct  3218005  NLERGW  3218022

 Score = 62.8 bits (151),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQK  64
                I HD+V+PF QP+P TVS+K AVKFKP L     CHPYP V++
Sbjct  1040539  IDHDKVQPFAQPEPATVSEKAAVKFKPSLIFSYACHPYPGVRR  1040667

 Score = 60.5 bits (145),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 77/183 (42%), Gaps = 24/183 (13%)
 Frame = +3

Query  66       GSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF  125
                G  SGGLK +G  D +C GS LGSQ+Y R+  + DV         P+   A      LR 
Sbjct  1040658  GETSGGLKGTGDLDSDCEGSSLGSQVYGRAVSIRDVGQRRCVAR*PRLEEARDSQCRLRT  1040837

Query  126      FGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHL  185
                       E              T+ G +     GY+   P    Y + TS  + Y     
Sbjct  1040838  RRGAMTLER-------------TLRGFTR---CGYTSCTPYFTDYFNDTSPILVYSDLER  1040969

Query  186      LGNTALQLT--EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                   + L ++   DT E QDLI W+QL+  AR +L+ TD+ +        K+P  D  FE 
Sbjct  1040970  THGSKLFMSTANDTREPQDLIMWEQLTEEARSALSETDFGEK------TKVPFVDANFEA  1041131

Query  244      LLD  246
                 L+
Sbjct  1041132  NLN  1041140

>PHRA:scaffold_765
Length=8667

 Score = 171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 127/231 (55%), Gaps = 15/231 (6%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I   +V P  QP P T ++K  VKFKPQL I  GC  +PAV   G  + GLK        
Sbjct  7711  IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  7532

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C+ + LGSQ+Y RSAW N  +AI+YAWYFPKG  A V          RH+W   VVWID 
Sbjct  7531  CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWANVAT-------RRHDWASAVVWIDR  7373

Query  142   PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
             P   + ++LG+S+S A   Y  QAP       GT+ ++++      G   L  T+ TG  
Sbjct  7372  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  7193

Query  201   QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             QDLI W+QLSS AR +L+ TD     FG A  K+P+ D  F+  L K WPF
Sbjct  7192  QDLIMWEQLSSAARTALSTTD-----FGNA--KVPMSDANFQTKLKKAWPF  7061

>PHRA:scaffold_149
Length=60000

 Score = 171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 127/231 (55%), Gaps = 15/231 (6%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I   +V P  QP P T ++K  VKFKPQL I  GC  +PAV   G  + GLK        
Sbjct  23440  IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  23619

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C+ + LGSQ+Y RSAW N  +AI+YAWYFPKG  A V          RH+W   VVWID 
Sbjct  23620  CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWANVAT-------RRHDWASAVVWIDR  23778

Query  142    PGLENATVLGVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
              P   + ++LG+S+S A   Y  QAP       GT+ ++++      G   L  T+ TG  
Sbjct  23779  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  23958

Query  201    QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              QDLI W+QLSS AR +L+ TD     FG A  K+P+ D  F+  L K WPF
Sbjct  23959  QDLIMWEQLSSAARTALSTTD-----FGNA--KVPMSDANFQTKLKKAWPF  24090

>PHCA:scaffold_27 PHYCAscaffold_27
Length=705730

 Score = 171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 124/227 (55%), Gaps = 26/227 (11%)
 Frame = +1

Query  25      DQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
               D+V PFP+ +P T+SQK AV+ KPQL I  GCHPY AV   G ++ G+  +  +D +C+G
Sbjct  137395  DKVEPFPELEPTTISQKAAVRLKPQLHISKGCHPYAAVNAAGEITAGI--TTTRDPDCSG  137568

Query  85      SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
                 +GSQ+Y RS W  DVWAIMYAWYFP                  H+W+ +VVWIDNP L
Sbjct  137569  RGIGSQVYVRSTWYKDVWAIMYAWYFPSSLI--------------HDWKNIVVWIDNPSL  137706

Query  145     ENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLI  204
                   VLGVS     GY +    +    DG S K+ Y Y        L  T   GEFQ+LI
Sbjct  137707  AVPRVLGVSAQVDGGYLRYNKFNWDKFDGASPKIKYDYPD------LDWTSKRGEFQNLI  137868

Query  205     QWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                WDQL+  AR +LN+T++     G     +P  D  F+  LD   P+
Sbjct  137869  MWDQLTEAARTALNNTNFK----GNGDATVPFIDANFKANLDFAIPY  137997

>PLHA:NW_020187575.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_658, whole genome shotgun sequence
Length=2021493

 Score = 171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 133/236 (56%), Gaps = 24/236 (10%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I  + V+PFP+  P T S+++A+K+KP L +  GCHPYPAVQ++GS+S G +W       
Sbjct  1748985  IDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQP  1748806

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPK-----GRAATVPPDFLRFFGHRHNWEYVV  136
                C  S  GSQIY+RS+W    WAIMYAWYFPK     GR  +         G RH W + +
Sbjct  1748805  CGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKAAVHIGRGVS---------GRRHYWLHAI  1748653

Query  137      VWIDNPGLENATVLGVSMSASIGYSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTE  195
                VW D     N+++LGV+MSA IG  K+      Y + GT++K+  Y +      AL+ T 
Sbjct  1748652  VWTDEENPNNSSILGVTMSAGIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFTV  1748473

Query  196      DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                  GE QDLI W+QLS  AR +L   D+            PL+D  F+ L+ + +PF
Sbjct  1748472  KLGETQDLITWEQLSHEARKALA-LDYKS--------DTPLQDYRFDGLIKEAYPF  1748332

 Score = 168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 136/235 (58%), Gaps = 17/235 (7%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                +  + V+PF QP P T SQK+A+K++P+L + + C+PYPAVQ +GS+S GL W      +
Sbjct  1739086  LHFNAVQPFKQPTPTTDSQKSAIKYQPRLYVVSDCYPYPAVQANGSLSYGLPWEVFAPTK  1739265

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQIY+RS W   +WAIMYAWY P+    +         GHRH W +VVVW ++
Sbjct  1739266  CNGSPYGSQIYSRSDWYRGMWAIMYAWYLPRALDHSS----WLVDGHRHFWTFVVVWTNS  1739433

Query  142      PGLENATVLGVSMSASIGYSKQ-APTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
                P    +T+L  S S +    K+  P   KY +D  ++KV  Y N+ L  T L+LT+  G+
Sbjct  1739434  PDPNVSTILAASTSGTDNRIKKYLPVKSKYLLDRRTLKVKLYQNYWLDKTGLKLTDKVGD  1739613

Query  200      FQDLIQWDQLSSLARYSL---NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 Q LI W+QL+  AR +L   ++ DW         ++ P++D  F  +L   +PF
Sbjct  1739614  LQPLITWEQLTDEARAALSSFHYPDW--------RMETPIQDKWFRYMLSSAYPF  1739754

 Score = 155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 125/233 (54%), Gaps = 30/233 (13%)
 Frame = +1

Query  22      IGHDQVRPF--PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79
               I +D++ PF   QP   T+S+KTA++F+P L I  GC+PYPAV K G +S G+  + P  
Sbjct  569668  IAYDKIEPFEMAQPSSATISEKTAIRFRPTLYIANGCYPYPAVNKAGQVSKGIPRADPSF  569847

Query  80      GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                 C+    G+Q+Y RSAW   VWAIMY W+FP                   NWEY +VW+
Sbjct  569848  ASCSKPCEGTQVYGRSAWFGTVWAIMYTWFFPSFPV---------------NWEYAIVWM  569982

Query  140     DNPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
               +NP +    V GV++S S G  S Q P +   + G + K+AY       N  L+ T   G
Sbjct  569983  NNPNVTKMVVHGVTVSLSNGSVSSQLPPNPAMMRGWNAKIAY------NNNGLESTTIDG  570144

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 Q+L+ W QL+  A+ +LN    D+  FG A  ++P  D  F   LD +WPF
Sbjct  570145  GAQNLVMWHQLTLEAQEALN----DKHSFGNA--QVPFNDANFLRYLDASWPF  570285

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 115/238 (48%), Gaps = 30/238 (13%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
               I HD+++P  +  PVT++++   KF P +KI +  C  YPAV  DG+ SGGLK +    G
Sbjct  512828  IDHDKIKPIEERQPVTLTERLVFKFNPSMKIREELCVDYPAVDADGNFSGGLKPTNGNSG  512649

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C    + SQ+Y R     ++WAI+Y WYFPK   +  P         RH+WE  VVW D
Sbjct  512648  -CERPPMDSQVYVRVRKYEEMWAIVYVWYFPKRFQSGWP-------SARHDWEQAVVWFD  512493

Query  141     NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTAL---------  191
               +   EN  V+ V+ S    Y    P+     + T     +++ +  G   L         
Sbjct  512492  DLK-ENPYVVSVATSRGGKYLFFNPSH----ETTYGPPLHFFPNYFGAPTLIRESYPVKW  512328

Query  192     QLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               +  ++   +  ++ W+QL   AR +L+    D   FG A  K P++D   +  L+K +
Sbjct  512327  KFYKEHPRYY-IVMWEQLPEPARAALS----DDKNFGDA--KCPIRDDKIDHHLEKAY  512175

>PHPA:scaffold_27 NW_008649013.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.27, whole genome shotgun 
sequence
Length=867849

 Score = 169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 137/269 (51%), Gaps = 54/269 (20%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QPDPVT+S+K AVKF PQL I  GC  +PAV   G ++GGLK +   DG 
Sbjct  542502  INHDQVQPFTQPDPVTISEKAAVKFMPQLHIGEGCVSFPAVNAAGEITGGLKGTKGTDG-  542678

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQ+Y R+ W  D WA+M+AWYFPKG +        R    RH+W  +V+W+DN
Sbjct  542679  CTEAPLGSQMYGRATWYEDKWAMMFAWYFPKGFSG-------RLARIRHDWASMVIWLDN  542837

Query  142     PGLENATVLGVSMSAS-------------------IGYSKQAPT----------------  166
               P LE   +LG S+S                     I Y+   P                 
Sbjct  542838  PALETPKILGASLSHQLLKPRRWFGFKMTDEKEPFIKYTSIPPMGFVGTQQVLVNRISRW  543017

Query  167     --DVKYVDGTSV--KVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDW  222
                 +  YV G++V  +V++          L+ +   GE+ DL+ W+QL+  AR +LN  D+
Sbjct  543018  HYNYTYVGGSNVSTRVSHTIVDKFDWYTLRFSYQDGEYLDLVMWEQLTDEARVALNTADF  543197

Query  223     DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                ++       K+P  D  FE  L   WPF
Sbjct  543198  GES-------KVPFNDRNFETTLQLAWPF  543263

>HYAP:scaffold_220 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_220:1:90999:1 
REF
Length=90999

 Score = 168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 126/232 (54%), Gaps = 18/232 (8%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HDQV+PF Q  P T S K  VKFKP+     GC PYPA  + G  SGGL+  G  +  
Sbjct  28722  ISHDQVKPFSQ*KPETASDKACVKFKPRFSTYDGCQPYPAANEVGETSGGLEPEGTTNAG  28543

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
                GSRLG Q+Y RSAW  + W I+YAWY PK        D + F FG RH W YV+V  +
Sbjct  28542  FKGSRLGFQVYGRSAWHGEKWVIVYAWYMPK--------DMMPFMFG*RHLWTYVIV*TN  28387

Query  141    NPGLENATVLGVSMSASIGYSK--QAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
              +P +EN  +L V +   +   K  + P+D +  DG  +KV + ++ +     L+ T +  
Sbjct  28386  DPAVENTKILAVLLGDGLRARKARKVPSDDELKDGVGIKVKHLWHGVHNGRMLEFTTEDD  28207

Query  199    EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              + QDL+ WDQLS+ AR + N   W +        KMPL D  F+  L+  WP
Sbjct  28206  KEQDLVTWDQLSANARQASNEVRWGKQ-------KMPLSDDEFKNNLELAWP  28072

>PHPA:scaffold_6 NW_008648992.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.6, whole genome shotgun 
sequence
Length=2202294

 Score = 167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 136/249 (55%), Gaps = 34/249 (14%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQL---KIDAGCHPYPAVQKDGSMSGGLKWSGPQ  78
               + HD+V PFPQPDP T+S+K A+KFKPQL   K++  C  +PAV   G ++GGLK +   
Sbjct  279282  VDHDKVEPFPQPDPATISEKAAIKFKPQLYSAKLEY-CVSFPAVNAVGEVTGGLKGTNGN  279106

Query  79      DGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVW  138
               D  C  + LGSQIY R+ W ND WAIMYAWYFPKG    +P         RH+W+ VVVW
Sbjct  279105  DA-CRLAPLGSQIYGRAGWHNDRWAIMYAWYFPKGFYMGLP-------TRRHDWKSVVVW  278950

Query  139     IDNPGLENATVLGVSMSAS---------------IGYSKQAPT-DVKYVDGTSVKVAYYY  182
               IDN  LE   +LGVS S S                GY  Q P      V G++  + +  
Sbjct  278949  IDNAELETPKILGVSTSVSDTRYKRDLVIFPRNFAGYQLQGPRFHHTEVFGSNTSLRFKI  278770

Query  183     NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
                  L    +   +  GE+QDLI W+QL+  AR +LN    D   FG A  ++P  D  ++
Sbjct  278769  WPTLFVPYMGFADFDGEYQDLIMWEQLTDAARAALN----DDNNFGRA--EVPFSDTHYK  278608

Query  243     ELLDKTWPF  251
               E L+  WPF
Sbjct  278607  EHLENAWPF  278581

>PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.7, whole genome shotgun 
sequence
Length=2078921

 Score = 167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 141/272 (52%), Gaps = 59/272 (22%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK-WSGPQDG  80
                I HD V+PF QPDPVT+S+KTAVKFKPQL ++ GC P+PAV   G ++ GLK W   +D 
Sbjct  1077845  ISHDSVQPFVQPDPVTISEKTAVKFKPQLHVEKGCVPFPAVNAAGEITEGLKGWIWSED-  1078021

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                 C+ + LGSQ+Y RS W  D WA++YAWYFP G AA            RH W  +V+WID
Sbjct  1078022  -CSVAPLGSQMYGRSTWFQDKWAMVYAWYFPTGFAAGGAEI-------RHYWSSMVMWID  1078177

Query  141      NPGLENATVLGVSMSASI----GY-------SKQAPTDVKYV------------------  171
                NP LE   +LG S+S  +    GY        ++ P D KY+                  
Sbjct  1078178  NPALETPNILGASLSQQLLEPRGYLLGFLTPQRKDPYD-KYISIPPVSFVGAQPVSSRRI  1078354

Query  172      ------------DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
                               S KV++ Y +     AL  +   G++ DLI WDQL+  AR +LN 
Sbjct  1078355  SRWRVEYTYSGGSNVSTKVSHRYANKGDWLALVFSAREGQYHDLIMWDQLTDEARAALNS  1078534

Query  220      TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 D+ ++       K+P  D  F+  L+K +PF
Sbjct  1078535  VDFGES-------KVPFNDQNFQSTLEKAYPF  1078609

 Score = 160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 133/269 (49%), Gaps = 54/269 (20%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QPDPVT+S+K AVK++PQL +  GC  +PAV   G ++GGLK +   DG 
Sbjct  1783595  INHDQVQPFAQPDPVTISEKAAVKYRPQLHVKDGCASFPAVNAAGDITGGLKPTKETDG-  1783419

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C  + LGSQ+Y RS W  D WA+M+AWYFPKG   + P         RH W  +V+W+DN
Sbjct  1783418  CAEAPLGSQMYGRSKWYQDRWAMMFAWYFPKGFITSQP-------RIRHYWMSMVLWLDN  1783260

Query  142      PGLENATVLGVSMSASI-------GYSKQAPTD---------------------------  167
                P LE   VLG S+S  +       G++     D                           
Sbjct  1783259  PALETPKVLGASLSQQLLKPRRWMGFNMAGDKDPYQKFTSVPPIGFVGTQEIRQNRITRT  1783080

Query  168      ---VKYVDGT--SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDW  222
                     Y  G+  S +V+       G   L  +   G++ DLI W+QL+  AR +LN  D+
Sbjct  1783079  RWNFTYEGGSNISTRVSTIMVDSFGWLPLTFSYRDGQYHDLIMWEQLTDEARAALNSADF  1782900

Query  223      DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 ++       K+P  D  FE  L   WPF
Sbjct  1782899  GES-------KVPFNDENFETSLGLAWPF  1782834

>PHPA:scaffold_54 NW_008649040.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.54, whole genome shotgun 
sequence
Length=467981

 Score = 160 bits (404),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = +1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               MN R + V+   +L    A  I HD+V+PF QP P TVS+  A+ FKP L+ID+GCHPYP
Sbjct  358948  MNIRTLLVSISTALWTVMAGSIVHDKVQPFAQPVPATVSETVAITFKPSLRIDSGCHPYP  359127

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV   G  + GLK +G   G C GS LGSQIY R+AW   +WAI+YAWYFPK R     P
Sbjct  359128  AVNAAG*TNAGLKGTGSPSGGCKGSHLGSQIYGRAAWHKGLWAIIYAWYFPKDR-----P  359292

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSK  162
                +L   G RH+W  VVVW+DNP +EN  ++GVS S+ +  ++
Sbjct  359293  SWLFTEGQRHDWANVVVWLDNPAVENPAMIGVSPSSYVSSTR  359418

 Score = 45.8 bits (107),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 12/94 (13%)
 Frame = +3

Query  162     KQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT----GEFQDLIQWDQLSSLARYSL  217
               K  P   + ++GT+ ++ Y  +    N  L   + T    GEFQDLI W+QL+  A  +L
Sbjct  359409  KYTPPHAEGLNGTNCRINYLEDG--NNHGLHTVDITWKSGGEFQDLIMWEQLTDSAHVAL  359582

Query  218     NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               N+TD     FG    K+P  D  F   L   WP+
Sbjct  359583  NNTD-----FG-GRAKVPFNDADFILNLQNAWPY  359666

>PHKE:scaffold_8 scf_22126_8.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_8.1_contig_1:1:276008:1 
REF
Length=276008

 Score = 166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 126/231 (55%), Gaps = 24/231 (10%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV  F +  PVTV+Q  A +F+P LK+  GC P+PAV + G+ + GL+ SG  +G 
Sbjct  215168  INHDQVVGFQEVSPVTVTQIAAKRFQPYLKVYHGCVPFPAVDQQGNTNAGLQTSGSPNGN  215347

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C+ S    Q+Y+RSAW N VWAIMYAWYFPK   ++         GHRH+WE +VVW+DN
Sbjct  215348  CSSST--GQVYSRSAWHNGVWAIMYAWYFPKDSPSS-------GLGHRHDWEGIVVWVDN  215500

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGT---SVKVAYYYNHLLGNTALQLTEDTG  198
               P   N  +L ++ S    ++  AP++    D     S    +  NH LG     +T   G
Sbjct  215501  PAAVNPQILSIAYSGHGQFTNVAPSNTNLNDTNPLISYNSTWPLNHELG-----VTGTVG  215665

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                 Q LI WD L+S AR +LN TD            +PL D  F   L+K W
Sbjct  215666  GMQPLIGWDDLTSAARNALNTTD-------FCSANVPLNDSNFTNNLNKAW  215797

>PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.22, whole genome shotgun 
sequence
Length=998868

 Score = 166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 132/247 (53%), Gaps = 31/247 (13%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               I HD+V+ FPQP+PVT S+KTA+KFKP+L      C PYPAV   G +SGGLK +   D 
Sbjct  508170  IDHDKVQAFPQPEPVTASEKTAIKFKPRLYTPRHVCVPYPAVNAAGEVSGGLKGTNGNDA  508349

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                C  S  GSQ+Y R+ W  D+WAIMY WYFPKG        F  F   RH+W+ VVVWI+
Sbjct  508350  -CKYSIQGSQVYGRAGWYRDLWAIMYTWYFPKGF-------FADFASKRHDWQNVVVWIN  508505

Query  141     NPGLENATVLGVSMSAS---------------IGYSKQAPTDVKY-VDGTSVKVAYYYNH  184
               NP LE   ++GVSMS                  GY  +     +  + G++  + + Y  
Sbjct  508506  NPDLEWPKIVGVSMSNVDSEYTTKLEMMAYYFSGYRMEGTRGYRRSIYGSATSLRFAYEM  508685

Query  185     LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
               +L +  L   ++ GE+Q LI W+QL+  AR +LN +            ++P  D  + + 
Sbjct  508686  ILTSPYLDFADEDGEYQSLIMWEQLTDAARAALNDSS------NFEEREIPFSDEHYMDH  508847

Query  245     LDKTWPF  251
               L+  WP 
Sbjct  508848  LEMAWPL  508868

>PHKE:scaffold_277 scf_22126_277.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_277.1_contig_1:1:48515:1 
REF
Length=48515

 Score = 153 bits (387),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 92/152 (61%), Gaps = 7/152 (5%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              + H  V  FPQPDPVT+S+K +VKFKPQL I  G HPYPAV   G  SGGL+ SG     
Sbjct  26685  VKHSDVHLFPQPDPVTISEKASVKFKPQLHISTGYHPYPAVDAAGETSGGLQPSGVPSAA  26864

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C G  LGSQ+Y  S W+N   AIMY+WYF K   +T         GHRH+WE+ +VWIDN
Sbjct  26865  CKGFGLGSQVYGHSDWLNGARAIMYSWYFAKDSLST-------GLGHRHDWEHAIVWIDN  27023

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDG  173
              P  EN+ +L  S SA  GYSK        +DG
Sbjct  27024  PVGENSKILAASPSAHSGYSKYVSPGAMTIDG  27119

 Score = 48.5 bits (114),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = +1

Query  175    SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKM  234
              ++KV+Y  +H   N AL LT   GE Q LI WDQL+  A  +LN  +     FG A + M
Sbjct  27121  AIKVSYE-SHWPVNHALDLTSTGGENQPLIMWDQLTDAACNALNTVN-----FGAANVSM  27282

Query  235    PLKDGVFEELLDKTWPF  251
                 DG F   L+KTWP+
Sbjct  27283  --NDGNFLAKLEKTWPW  27327

 Score = 49.3 bits (116),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 13/100 (13%)
 Frame = -2

Query  22     IGHDQVRPFPQ--PDPVTVSQKTAVKFKPQLKIDAGCHPY-PAVQKDGSMSGGLKWSGPQ  78
              I  D+V+PF Q   D + +S          ++  A   PY P++   G      +W    
Sbjct  28276  IDADKVQPFAQLVCDCLQISHY*-------VQASAQTLPYMPSIPSGGCKRRH*RWG*A*  28118

Query  79     DGECT---GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRA  115
                 C     S  GSQIYARS W +DVW I+YAWYFP+  A
Sbjct  28117  LDVCEQLWDSDFGSQIYARSTWRSDVWVIVYAWYFPRASA  27998

 Score = 38.1 bits (87),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = -1

Query  119    PPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM  154
              P  F    G    W+Y ++WIDNP L+N  +LG+++
Sbjct  28013  PTGFGYGMGRTSQWQYSIIWIDNPSLKNPAILGLTV  27906

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -3

Query  36     VTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK  73
              VTV +    KFKPQLK+   CHPYPAV   G +S G+K
Sbjct  28236  VTVFR*ATTKFKPQLKLSRTCHPYPAVDAKGDISAGVK  28123

>PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 
genomic scaffold, whole genome shotgun sequence
Length=3114892

 Score = 162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 139/273 (51%), Gaps = 62/273 (23%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP PVT+S+KTAV FKPQL +  GC  +PAV   G +SGG+K +   +G 
Sbjct  1712663  INHDQVQPFAQPLPVTISEKTAVTFKPQLLVAEGCASFPAVNAAGEVSGGIKGTKGTEG-  1712487

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG----RAATVPPDFLRFFGHRHNWEYVVV  137
                CT + LGSQ+Y RS W  D WA+++AWYFPKG    +A +           RH W  +V+
Sbjct  1712486  CTDAPLGSQVYGRSRWYRDKWAMVFAWYFPKGF*SYKAVS-----------RHYWASMVL  1712340

Query  138      WIDNPGLENATVLGVSMSASI----------------GYSKQAPTDVKYVDGT-------  174
                W+DNP L++  ++G S+   +                 Y KQ   D  Y  GT       
Sbjct  1712339  WLDNPVLDSPKIIGASLQQQLLKTRGLKGFMFTEPREPYYKQTYIDPMYYVGTQRIRRNR  1712160

Query  175      ----------------SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLN  218
                                S++V + Y +     ALQ +E  G++QDLI W+QL+  AR +L 
Sbjct  1712159  ISYRHWNFTIIPGSNESIRVFHTYWNSFEWLALQFSETDGQYQDLIMWEQLTDEARTALI  1711980

Query  219      HTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                  D+ ++       K+P  D   +E L   WPF
Sbjct  1711979  TVDFGES-------KVPFSDKNLDETLKLAWPF  1711902

 Score = 144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 120/233 (52%), Gaps = 49/233 (21%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HDQV+PF QP PVT+S+K  V FKPQL +  GC  +PAV   G +SGGLK +   +G 
Sbjct  1800791  INHDQVQPFAQPLPVTISEKATVTFKPQLLVAEGCASFPAVNAAGEVSGGLKGT*GTEG-  1800967

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFG-HRHNWEYVVVWID  140
                CT + LGSQ+Y RS W  D WA+++AWYFPKG        F  +    RH W  +V+W+D
Sbjct  1800968  CTDAPLGSQVYGRSRWYRDKWAMVFAWYFPKG--------FWSYKAVSRHYWASMVLWLD  1801123

Query  141      NPGLENATVLGVSMSASI----------------GYSKQAPTDVKYVDGT----------  174
                NP L++  ++G S+   +                 Y KQ   D  Y  GT          
Sbjct  1801124  NPALDSPKIIGASLQQQLLKTRGFKGSLLTEPREPYYKQTYIDPMYYVGTQRIRGNRISY  1801303

Query  175      -------------SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLAR  214
                             S++V + Y +     ALQ ++  G++QDLI W+QL+  AR
Sbjct  1801304  RHWNFTIIPGSNESIRVFHTYWNSFEWLALQFSKTDGQYQDLIMWEQLTDEAR  1801462

>PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.9, whole genome shotgun 
sequence
Length=1651025

 Score = 161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 134/269 (50%), Gaps = 54/269 (20%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PF QP PVT+++K AV FKPQL I  GC  +PAV   G +SGG+K +   +G 
Sbjct  334607  IDHDKVQPFAQPVPVTIAEKAAVMFKPQLHISQGCVSFPAVNAAGEISGGVKGTKNTEG-  334431

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               CT + LGSQ+Y R+ W  D WA+++AWYFPK   +    D       RH W  +V+W+DN
Sbjct  334430  CTEAPLGSQVYGRAKWYQDKWAMVFAWYFPKSFWSFEAVD-------RHYWASMVLWLDN  334272

Query  142     PGLENATVLGVSMSASI----------------GYSKQAPTDV-KYV-------------  171
               P L    ++G S+   +                 Y KQ   D+  YV             
Sbjct  334271  PALSAPKIIGASLQQQLLKKRGFLGFMFTEPREPYFKQTSIDIMSYVGAQRIRLNPIGYR  334092

Query  172     ---------DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDW  222
                           S +V + Y +     AL  +E  G+FQDLI W+QL+  AR +LN  D+
Sbjct  334091  RWSYNFTPGSNVSTRVTHTYWNSFEYLALHFSETDGQFQDLIMWEQLTDEARSALNSADF  333912

Query  223     DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                ++       K+P  D   EE L+  WPF
Sbjct  333911  GES-------KVPFNDENIEETLELAWPF  333846

>PYAP:scaffold_973 pag1_scaffold_973 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_973:1:9291:1 
REF
Length=9291

 Score = 160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 129/232 (56%), Gaps = 27/232 (12%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD V  +PQP+P   +Q  AV+FKPQL +  GC PYPAV   G+ SGGLK SG Q   
Sbjct  8412  INHDAVPVWPQPEPADATQVLAVRFKPQLDVVNGCQPYPAVDPQGNTSGGLKPSGSQAAA  8233

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C      +Q+Y+RS   N  +AIMY+WY PK   +T         GHRH+WE VVVW+DN
Sbjct  8232  CR-DMSKAQVYSRSGTYNGYYAIMYSWYMPKDSPST-------GIGHRHDWENVVVWLDN  8077

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDT  197
                 +A ++ +S SA  GY K  P D  Y+DG + K++Y      +H LG      T   
Sbjct  8076  AA--SANIVALSASAHSGYKKSFPADKSYLDGITAKISYKSTWPLDHELG-----FTTSA  7918

Query  198   GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             G+ Q LIQW+Q++  AR +L  TD     FG A +  P K   F++ L K +
Sbjct  7917  GKQQPLIQWEQMTQAARDALESTD-----FGNANV--PFKSN-FQDKLAKAF  7786

 Score = 43.5 bits (101),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = -3

Query  135   VVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYY----YNHLLGNT  189
             +VVW+D+  +  A V+ V+ SA   Y K  P D K++ DG S K+ Y      NH  G T
Sbjct  9259  IVVWLDSGNIATAKVVAVAASAHGNYKKSYPIDSKFLADGISAKINYKSTWPVNHETGFT  9080

Query  190   ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
              +     TG  Q LIQW+QL+  A+ +L  TD
Sbjct  9079  TI-----TGVKQPLIQWEQLTPAAQQALETTD  8999

>PHCA:scaffold_547 PHYCAscaffold_547
Length=3140

 Score = 158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 133/270 (49%), Gaps = 54/270 (20%)
 Frame = -2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP PVT+S+K A K+KPQL+I   C  +PAV   G ++GGLK S   DG 
Sbjct  1144  IDHDKVQPFAQPVPVTISEKAADKYKPQLEIYGSCVSFPAVNAAGDITGGLKGSEGTDG-  968

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             CT + LGSQ+Y RSAW  D WA+M+AWYFPK      P         RH W  +V+W+DN
Sbjct  967   CTKAPLGSQVYGRSAWYQDKWAMMFAWYFPKNFWEGRPKS-------RHLWANMVLWLDN  809

Query  142   PGLENATVLGVSMSAS-------------------------------IGYSKQAPTDV--  168
             P LE   +LG S+S                                 +G S+     +  
Sbjct  808   PALETPKILGASLSRQTIKVPTLLLLPRGERQKDPYTKVTALHPMDFVGASQTKTGRISR  629

Query  169   -----KYVDGT--SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                   Y  G+  S +V   Y    G   L+ +   G++QDLI W+QL+  AR +L   D
Sbjct  628   FKYTFNYTSGSNRSTRVQQRYPDNSGWIGLEFSTADGQYQDLIMWNQLTDQARAALESAD  449

Query  222   WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             + Q       +K+P  D  FE  L + WPF
Sbjct  448   FGQD------IKVPFYDKNFEAALAQAWPF  377

>PHRA:scaffold_140
Length=80602

 Score = 103 bits (257),  Expect(3) = 4e-42, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 82/145 (57%), Gaps = 15/145 (10%)
 Frame = -2

Query  107   AWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPT  166
             +WYFPK   ++         GHRH+WE+VVV+IDNP +    ++G S S+  GY K AP 
Sbjct  5502  SWYFPKDSPSS-------GMGHRHDWEHVVVFIDNPDVAEPKIMGCSASSHNGYKKYAPC  5344

Query  167   DVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTL  226
                 +DGTSVKV Y ++  + N  L +T D G FQDLI WDQ++  AR +LN        
Sbjct  5343  PPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQDLIMWDQMTEDARRALN-----GVH  5182

Query  227   FGLAGLKMPLKDGVFEELLDKTWPF  251
             FG A    P+ DG F   L+K  PF
Sbjct  5181  FGDA--NTPMNDGNFIPKLEKASPF  5113

 Score = 72.8 bits (177),  Expect(3) = 4e-42, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
             I H +V+PF QP P T+S+K  VKFKPQ++I  GC PYPAV   G  SGGLK SG
Sbjct  5746  ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSG  5582

 Score = 38.5 bits (88),  Expect(3) = 4e-42, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -3

Query  80    GECTGSRLGSQIYARSAWVNDVW  102
             G C GS  GSQ+Y RSAW+NDVW
Sbjct  5573  GGCRGSGHGSQVYGRSAWLNDVW  5505

>PYAP:scaffold_984 pag1_scaffold_984 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_984:1:9149:1 
REF
Length=9149

 Score = 156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 116/204 (57%), Gaps = 10/204 (5%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD V  +PQP PV  +QK AVKFKPQ+  +  C  YPAV + G++ GGL  SG     
Sbjct  6901  INHDAVPVWPQPTPVGGNQKLAVKFKPQIVYENSCTAYPAVDRWGNIGGGLAPSGSPSAG  7080

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C   R   Q+YAR+ W N+ +AIMYAWY PK   +T         GHRH WE +VVW+ N
Sbjct  7081  CK-DRSKQQLYARTGWYNNNFAIMYAWYMPKDSPST-------GLGHRHEWENLVVWLSN  7236

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVD-GTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                + A ++G++ SA  GY K    D   +D G S KV Y++N       L  T+  GE 
Sbjct  7237  SNEQTAKIVGMAASAHGGYKKMRNVDWNKIDRGVSPKVRYFFN-WPNTHELDFTDKKGEQ  7413

Query  201   QDLIQWDQLSSLARYSLNHTDWDQ  224
             Q LIQWDQL+  AR SL   D+D+
Sbjct  7414  QPLIQWDQLTDAARESLEKYDFDR  7485

>PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 
genomic scaffold, whole genome shotgun sequence
Length=5458067

 Score = 156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 126/266 (47%), Gaps = 53/266 (20%)
 Frame = -1

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
                HDQV+PF QP P T+S+K AVK++PQL +  GC  +PAV   G ++GGLK +   DG CT
Sbjct  4011950  HDQVQPFAQPKPATISEKAAVKYRPQLHVLDGCASFPAVNAAGDITGGLKPTKGTDG-CT  4011774

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                 + LGSQ+Y RS W  D WA+M+AWYFPKG     P         RH W  +V+W+DNP 
Sbjct  4011773  EAPLGSQMYGRSKWYQDRWAMMFAWYFPKGFITGQPRI-------RHYWMNMVLWLDNPA  4011615

Query  144      LENATVLGVSMSAS---------------------------IGYSKQAPTDVKYVDGTSV  176
                LE  T+LG S+S                             IG+          +  T  
Sbjct  4011614  LETPTILGASLSQRLLKPRRWMGLKLTEEKDPYRKFTTIPPIGFVGTKEIRQNRLTRTRW  4011435

Query  177      KVAYYYNHLLGNTALQLTEDT-----------GEFQDLIQWDQLSSLARYSLNHTDWDQT  225
                   Y     +      + +             G++ DLI WDQL+  AR +LN  D+ ++
Sbjct  4011434  NFTYEGGSNISTRVFTVIDSKDWLPLTFSYYDGQYHDLIMWDQLTDEARAALNSADFGES  4011255

Query  226      LFGLAGLKMPLKDGVFEELLDKTWPF  251
                       K+P  D  FE LL   WPF
Sbjct  4011254  -------KVPFNDENFEALLSLAWPF  4011198

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 57/155 (37%), Gaps = 45/155 (29%)
 Frame = -1

Query  135      VVVWIDNPGLENATVLGVSMSAS---------------------------IGYSKQAPTD  167
                +V+W+DNP LE  T+LG S+S                             IG+       
Sbjct  4018367  MVLWLDNPALETPTILGASLSQRLLKPRRWMGLKLTEEKDPYRKFTTIPPIGFVGTKEIR  4018188

Query  168      VKYVDGTSVKVAYYYNHLLGNTALQLTEDT-----------GEFQDLIQWDQLSSLARYS  216
                   +  T     Y     +      + +             G++ DLI WDQL+  AR +
Sbjct  4018187  QNRLTRTRWNFTYEGGSNISTRVFTVIDSKDWLPLTFSYYDGQYHDLIMWDQLTDEARAA  4018008

Query  217      LNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                LN  D+ ++       K+P  D  FE LL   WPF
Sbjct  4018007  LNSADFGES-------KVPFNDENFEALLSLAWPF  4017924

>PHCA:scaffold_477 PHYCAscaffold_477
Length=4533

 Score = 154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 108/192 (56%), Gaps = 15/192 (8%)
 Frame = -1

Query  60    PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
             PAV + G  SGGLK +G   G C GS  GSQ+Y R  W+  VW IMY+WYFPK   +T  
Sbjct  3063  PAVDETGQTSGGLKPTGNSKGGCRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPSTG-  2887

Query  120   PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179
                    GHRH+WE+ +V+IDNP +    +L  S+S+  GY K  P     +DGTS+KV 
Sbjct  2886  ------MGHRHDWEHAIVFIDNPDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVR  2725

Query  180   YYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDG  239
             Y +   L N  L  T D G FQDLI WDQ++  AR +LN        FG A    P  DG
Sbjct  2724  YKHGWPL-NHDLDTTGDAGTFQDLIMWDQMTEDARRALN-----SVHFGSA--NTPFNDG  2569

Query  240   VFEELLDKTWPF  251
              F+  L+K WPF
Sbjct  2568  NFKPKLEKAWPF  2533

>PLHA:NW_020188871.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1963, whole genome shotgun sequence
Length=1304

 Score = 149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 130/235 (55%), Gaps = 25/235 (11%)
 Frame = -3

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + +D+V+PFP  +      + A+ F+P L+I++GCHPYPAV K+G +S GL  S     +
Sbjct  894  LQYDKVKPFPATERDCPINEIALDFQPMLRIESGCHPYPAVDKNGYISDGLGVSH-WFTD  718

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR---FFGHRHNWEYVVVW  138
            C+GS  GSQ+Y R+       AIMYAWYFP+        DF+    + GHRH WE+ ++W
Sbjct  717  CSGSPEGSQVYGRAHVYKGYLAIMYAWYFPR--------DFMTTPFYVGHRHGWEHAILW  562

Query  139  IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA--LQLTED  196
            I+    E+A +L  S+ +++ Y   AP   KY+    +K+ Y +   LG T   L  T++
Sbjct  561  IEGSS-EDAVLLAASVESTLSYDTYAPVPSKYMKSDHIKLEYTW---LGVTHHYLTATKE  394

Query  197  TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
            +GEFQDL+ WD L+  A  SLN                PL D  F + L K++PF
Sbjct  393  SGEFQDLVMWDNLTENAHKSLNEK-------VSLNFDSPLSDKRFFKALRKSYPF  250

>PHIF:NW_003303667.1 Phytophthora infestans T30-4 supercont1.92 
genomic scaffold, whole genome shotgun sequence
Length=551618

 Score = 154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 130/237 (55%), Gaps = 36/237 (15%)
 Frame = +1

Query  35      PVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK-WSGPQDGECTGSRLGSQIYA  93
               PVTVS+  A+KFKP L ID GC  +PAV   G  SGGLK W G  DG C  + LGSQ+Y 
Sbjct  169432  PVTVSETVALKFKPMLLIDGGCVSFPAVNVAGETSGGLKPWDG-TDG-CEEAPLGSQVYG  169605

Query  94      RSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS  153
               RS+W  D WA+M+AWYFPK   A +P         RH+W  +VVWIDNP LE   +LGVS
Sbjct  169606  RSSWYEDKWAMMFAWYFPKAFWAGMP-------SRRHDWASMVVWIDNPDLETPKILGVS  169764

Query  154     MSASIG-YSKQ--APTDVKYV----------------DGTSVKVAYYYNHLLGNTALQLT  194
               +S S   YSK   +P++  +                   TS++V +       +  L  +
Sbjct  169765  LSTSTNRYSKDTGSPSEGYFAGFQIYGRRGNLTRTPGSNTSIRVTHSTELAFSSAYLDFS  169944

Query  195     EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                + GE+QDLI W+QL+  A+ + + TD+ ++       K+P  +  F + L+K  PF
Sbjct  169945  AEDGEYQDLIMWEQLTEEAQLAPDSTDFGKS-------KVPFNEDNFGDKLEKASPF  170094

>HYAP:scaffold_33 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_33:1:475050:1 
REF
Length=475050

 Score = 154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 124/223 (56%), Gaps = 17/223 (8%)
 Frame = +1

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HDQ++P+ QP+  TV++K A ++KP L    GC+PYPAV  +G  +GGLK +G    +C 
Sbjct  467980  HDQIKPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKATGGSRSKCG  468159

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR-FFGHRHNWEYVVVWIDNP  142
                  +G Q+YAR  W ++ + I++AWYFPK        D +R   GHRH+WE+  +W++NP
Sbjct  468160  QPYMGGQVYARGKWCDEQFGIIFAWYFPK--------DSVRDGVGHRHDWEWATIWLNNP  468315

Query  143     GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                   + +LGV+   S    +      +  +G +VK+ Y  +       + L+ + GE Q 
Sbjct  468316  EANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDHGR--RHYIALSGNDGELQP  468489

Query  203     LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
               LI WDQ++  +R +LN   W++         MPL D VF+  L
Sbjct  468490  LIMWDQMTEASRCALNTVGWNKHRL------MPLADTVFDNNL  468600

>HYAP:scaffold_40 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_40:1:448896:1 
REF
Length=448896

 Score = 153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 124/223 (56%), Gaps = 17/223 (8%)
 Frame = -3

Query  24     HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
              HDQ++P+ QP+  TV++K A ++KP L    GC+PYPAV  +G  +GGLK +G    +C 
Sbjct  31396  HDQIQPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKATGGSRSKCG  31217

Query  84     GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR-FFGHRHNWEYVVVWIDNP  142
                 +G Q+YAR  W ++ + I++AWYFPK        D +R   GHRH+WE+  +W++NP
Sbjct  31216  QPYMGGQVYARGKWCDEQFGIIFAWYFPK--------DSVRDGVGHRHDWEWATIWLNNP  31061

Query  143    GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                  + +LGV+   S    +      +  +G +VK+ Y  +      A  L+ + GE Q 
Sbjct  31060  EANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDHGRRHYIA--LSGNDGELQP  30887

Query  203    LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
              LI WDQ++  +R +LN   W++         MPL D VF+  L
Sbjct  30886  LIMWDQMTEASRCALNTVGWNKHRL------MPLADTVFDNNL  30776

 Score = 152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 124/223 (56%), Gaps = 17/223 (8%)
 Frame = +3

Query  24     HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
              HDQ++P+ QP+  TV++K A ++KP L    GC+PYPAV  +G  +GGLK +G    +C 
Sbjct  20382  HDQIKPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKATGGSRSKCG  20561

Query  84     GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR-FFGHRHNWEYVVVWIDNP  142
                 +G Q+YAR  W ++ + I++AWYFPK        D +R   GHRH+WE+  +W++NP
Sbjct  20562  QPYMGGQVYARGKWWDEQFGIIFAWYFPK--------DSVRDGVGHRHDWEWATIWLNNP  20717

Query  143    GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                  + +LGV+   S    +      +  +G +VK+ Y  +       + L+ + GE Q 
Sbjct  20718  EANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDHGR--RHYIALSGNDGELQP  20891

Query  203    LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
              LI WDQ++  +R +LN   W++         MPL D VF+  L
Sbjct  20892  LIMWDQMTEASRCALNTVGWNKHRL------MPLADTVFDNNL  21002

 Score = 148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 124/223 (56%), Gaps = 17/223 (8%)
 Frame = -2

Query  24     HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
              HDQ++P+ + +  TV++K A +++P L    GC PYPAV  +GS +GGLK +G    +C 
Sbjct  87488  HDQIQPYAKREETTVTEKAAARYQPSLHSSHGCEPYPAVDAEGSTNGGLKATGGSRSKCG  87309

Query  84     GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR-FFGHRHNWEYVVVWIDNP  142
                 +G Q+YAR  W ++ + I++AWYFPK        D +R   GHRH+WE+  +W++NP
Sbjct  87308  QPYMGGQVYARGKWWDEQFGIIFAWYFPK--------DSVRDGVGHRHDWEWATIWLNNP  87153

Query  143    GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                  + +LGV+   S G  +      +  +G +VK+ Y  +      A  L+ + G+ Q 
Sbjct  87152  EANVSEILGVTTIGSRGPKRTNKLKRENRNGDTVKLDYRDHGRRHYIA--LSGNDGQLQP  86979

Query  203    LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
              LI WDQ++  +R +LN   W++         MPL D VF+  L
Sbjct  86978  LIMWDQMTEASRCALNTVGWNKHRL------MPLADRVFDNNL  86868

>PHIF:NW_003303729.1 Phytophthora infestans T30-4 supercont1.30 
genomic scaffold, whole genome shotgun sequence
Length=2025055

 Score = 143 bits (360),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 92/145 (63%), Gaps = 10/145 (7%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
                + HD+V PFPQP PVT+S+K A+KFKPQL      C PYPAV  DG ++GGLK +   D 
Sbjct  1617140  VNHDKVEPFPQPKPVTISEKAAIKFKPQLMPSGPICVPYPAVNADGGVTGGLKGTNKNDA  1616961

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                 C  + LGSQ+Y R+ W N +WAIMYAWYFPKG    +P         RH+W   VVWID
Sbjct  1616960  -CMYAPLGSQVYGRAGWHNGLWAIMYAWYFPKGFWGLLP-------WRRHDWTDFVVWID  1616805

Query  141      NPGLENATVLGVSMSAS-IGYSKQA  164
                NP  E   ++GVSMS S   YSK+ 
Sbjct  1616804  NPKFETPKIIGVSMSKSNTEYSKET  1616730

 Score = 45.4 bits (106),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 6/71 (8%)
 Frame = -2

Query  181      YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGV  240
                Y   L  +  L L    GE+QDLI W+QL+  AR +LN    D+  FG A  K+P  D  
Sbjct  1616643  YEMFLFSSPYLNLASMDGEYQDLIMWEQLTDAARAALN----DKKNFGKA--KVPFSDEH  1616482

Query  241      FEELLDKTWPF  251
                F++ L+K W +
Sbjct  1616481  FQDHLNKAWLY  1616449

 Score = 147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 131/234 (56%), Gaps = 35/234 (15%)
 Frame = +3

Query  37       TVSQKTAVKFKPQLKIDAG--CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYAR  94
                T + + ++KFKPQL + +G  C P+PAV  DG ++GGLK +   D  C  + LGSQ+Y R
Sbjct  1575522  TPALQRSIKFKPQL-MPSGPICVPFPAVNADGGVTGGLKGTNKNDA-CMYAPLGSQVYGR  1575695

Query  95       SAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM  154
                + W N +WAIMYAWYFPKG     P         RH+W   VVWIDNP LE   +LGVSM
Sbjct  1575696  AGWHNGLWAIMYAWYFPKGFWGLFP-------SRRHDWTDFVVWIDNPKLETPKILGVSM  1575854

Query  155      SAS-IGYSKQA---PTD-------------VKYVDGTSVKVAYYYNHLLGNTALQLTEDT  197
                S S + YSK+    P++             + +   TS+++  Y   LL +  L L    
Sbjct  1575855  SKSNMEYSKKTRLWPSNFVGYRRFGRYNPTIFFGSNTSLRLD-YKAILLSSPYLNLASMD  1576031

Query  198      GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                GE+QDLI W+QL+  AR +LN    D+  FG A  K+P  D  F+  L+K W F
Sbjct  1576032  GEYQDLIMWEQLTDAARAALN----DKKNFGEA--KVPFSDEYFQGHLNKAWLF  1576175

>PHRA:scaffold_271
Length=25029

 Score = 152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 139/255 (55%), Gaps = 27/255 (11%)
 Frame = +3

Query  1     MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
             MNF  + + A   LA A+A+ +  + V PF +    T     A+ FKPQLKI +GCHPYP
Sbjct  2967  MNFLRLVIVAAGLLAFARAEELDFNSVVPFTETKASTAGYSLALTFKPQLKIVSGCHPYP  3146

Query  61    AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
             AV  +G+ + G+     +   C GS LGSQIY R+    D +AI+Y+WYFP+ R  T   
Sbjct  3147  AVDSEGNTNAGIDIFSFK--SCEGSSLGSQIYGRATTYEDSYAILYSWYFPRDRKGT---  3311

Query  121   DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIG-YSKQAPTDVKYV-DGTSVKV  178
                  FGHRH+WE+++VWI+        +  VS S S G Y    P D   V D TSVK+
Sbjct  3312  -----FGHRHSWEHIIVWIERTSSTKGALSSVSASTSDGKYFTITPPDTDMVWDKTSVKI  3476

Query  179   AY---YYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMP  235
              Y    ++H      + ++ ++G+FQDL+ W+ +SS AR +LN  D     FG A   +P
Sbjct  3477  QYKAKTFSHY-----VNVSTESGDFQDLVMWEDMSSAARTALNLND-----FGSA--TVP  3620

Query  236   LKDGVFEELLDKTWP  250
              K+  F + L   +P
Sbjct  3621  FKEDTFLDNLKNAYP  3665

>PLHA:NW_020187243.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_322, whole genome shotgun sequence
Length=1809241

 Score = 152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 124/217 (57%), Gaps = 15/217 (7%)
 Frame = -3

Query  37       TVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSA  96
                T SQK+AVK+KP L ID+GCHPYPAVQ +GS+S G++W       C GS LGSQ+Y+RS 
Sbjct  1725410  TKSQKSAVKYKPSLYIDSGCHPYPAVQANGSLSSGVEWKHNPRASCRGSPLGSQVYSRSD  1725231

Query  97       WVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM-S  155
                W    WAIMY WYFP     T      +F  H   W + ++W ++P  + +T+L V++  
Sbjct  1725230  WYKGKWAIMYTWYFPGALDPTT-----QFVSH---WLWAIIWTNSPDPDESTLLAVTLPR  1725075

Query  156      ASIGYSKQAPTDVKYV-DGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLAR  214
                 + G  K +P   KYV + T+VK+    +  L     +LT  +GEFQDLI  DQL+  A+
Sbjct  1725074  LADGVKKYSPLHSKYVHNHTTVKIKSQQSFWLKMHGFELTSRSGEFQDLITLDQLTDEAK  1724895

Query  215      YSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 +L  T+     F       PL+D  F E+L   +PF
Sbjct  1724894  AAL-MTNHRPEHFA----NPPLQDLRFNEVLQMAFPF  1724799

 Score = 140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 122/239 (51%), Gaps = 31/239 (13%)
 Frame = +1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK---WSGPQ  78
                + +D+ RPF +  P     + A+ FKPQL I +GCHPYPA+ +DG  SGGL    W+   
Sbjct  1561663  VAYDKARPFDEVKPDCPLNELALMFKPQLHIASGCHPYPAIDRDGYYSGGLSAFHWA---  1561833

Query  79       DGECTGSRLGSQIYARSAWVND--VWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVV  136
                   C GS+ GSQ+Y R+ + +D  VW +MYAWYFP  R   + P    ++GH H WE+ +
Sbjct  1561834  -TSCDGSKEGSQVYGRAFYNSDTNVWEVMYAWYFP--RDTMITP---VYYGHNHGWEHAI  1561995

Query  137      VWI----DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQ  192
                V+I    D P L     L V+ S    Y    P    YV G S K+ Y +   + +  L+
Sbjct  1561996  VYIGVSSDTPKL-----LAVAASGMWSYRTYNPPRSDYVSGNSFKLKYTWIG-ISHHYLK  1562157

Query  193      LTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 T + GEFQ LI W+ ++S  R+      W        G K P  D  F + L K  PF
Sbjct  1562158  GTHNPGEFQPLIMWENMTSSVRHLFQEKTW-------FGTKAPFSDDNFFKHLKKARPF  1562313

 Score = 131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 111/232 (48%), Gaps = 19/232 (8%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + +D + P     P       A++F+P+L I  GCHPYPAV  +G +S GL  S     +
Sbjct  1544210  LPYDSLVPVLPSKPNCRINSIALQFQPELNIKHGCHPYPAVDDNGYISSGLGVSH-FFTD  1544034

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C GS  GSQ+Y R+       AIMYAWYFP+   AT       + GHRH WE+ ++W   
Sbjct  1544033  CMGSPKGSQVYGRAFVYRGYLAIMYAWYFPRDYVATP-----FWIGHRHGWEHAILWFGG  1543869

Query  142      PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA--LQLTEDTGE  199
                   E   +L V+  + IGY   AP   K++D    K+ Y +   +G T   L  T   GE
Sbjct  1543868  -MTEKPELLAVTAKSLIGYRTYAPPQSKHMDKDRFKLKYTW---MGVTQHYLSATTSPGE  1543701

Query  200      FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 Q L+ WD L   AR SL    W          K PL D  F   L K +PF
Sbjct  1543700  LQSLVMWDDLPDKARASLKPRSWSH-------FKPPLADNRFFRALRKAYPF  1543566

>HYAP:scaffold_20 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_20:1:619894:1 
REF
Length=619894

 Score = 129 bits (323),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 94/175 (54%), Gaps = 18/175 (10%)
 Frame = -2

Query  77    PQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVV  136
             P   EC GS  GSQ+Y R  W    WAIMY+W FPK   ++          HRH+WE+VV
Sbjct  9240  PFSAECKGSGWGSQVYGRLRWFK*KWAIMYSWSFPKDSPSSG-------LDHRHDWEHVV  9082

Query  137   VWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTED  196
             VWI+NP +EN+T+LGVS+S+  GYS + P   + +D  SVKV Y  +    N  L+ T  
Sbjct  9081  VWINNPAIENSTILGVSVSSHNGYSFRVPPRPENMDNASVKVEYDCDR-PKNHELKFTRK  8905

Query  197   TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              G+  DLI W+Q+S  AR +          F       P  D  FE  L ++WPF
Sbjct  8904  GGDLVDLITWEQMSENARRA----------FSWGAAHAPFTDNSFEHRLLRSWPF  8770

 Score = 58.2 bits (139),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -3

Query  22    IGHDQVRPFPQ-PDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGP  77
             I H+ +RPFPQ  +P + S + ++KFKPQL    GCH YPAV  DG+ SGG    GP
Sbjct  9410  IEHN*LRPFPQVANPESPSARASLKFKPQLHNTNGCHSYPAVDYDGNTSGGRDTKGP  9240

 Score = 136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 119/233 (51%), Gaps = 23/233 (10%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I H++V+ F   +P T ++K AV+F   + +  GC+PY  V+++G +S GLK SGP  G 
Sbjct  217586  INHNEVKAFAHLEPKTDAEKAAVRFNSTIVVSYGCYPYAMVKEEGQISKGLKPSGPNHGH  217765

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+Y RS W  D+WAI+Y +  PK +       +   + HRH W++  VW++ 
Sbjct  217766  CKGSGHGSQVYVRSTWFRDIWAIVYVY*SPKKQ-------WFGGWNHRHGWDHATVWLNT  217924

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLT---EDTG  198
               P   NAT      + S    K      K   G SVK+ ++     G + + L    ++ G
Sbjct  217925  P---NATTTLAVTAGSDHNGKMFKASEKV--GESVKLEFWKQ---GRSEIMLAISGKEGG  218080

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               +   LI W+Q    AR SLN   W          +MPL D  F+E+L   WPF
Sbjct  218081  KTLPLITWEQFPDKARCSLNEAKWIN-----GEERMPLSDARFKEILTDDWPF  218224

>PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2386, whole genome shotgun sequence
Length=2296535

 Score = 150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 126/235 (54%), Gaps = 25/235 (11%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + +D+++P P  +  ++    A+ F+P L I +GCHPYPAV + G +S GL  S     +
Sbjct  722127  LQYDEIKPIPGVESNSLINSIALHFQPMLFISSGCHPYPAVDEHGYISNGLGVSH-LFTD  722303

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR---FFGHRHNWEYVVVW  138
               C GS  GSQ+Y R+       AIMY+WYFP+        DF+    + GHRH WE+ ++W
Sbjct  722304  CMGSPQGSQVYGRAFAFRGHLAIMYSWYFPR--------DFMTAPFYIGHRHGWEHAILW  722459

Query  139     IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA--LQLTED  196
                  P  EN T+L V++ ++ GY   AP   KY+ G   K+ Y +   LG T   L  TE 
Sbjct  722460  F-GPDTENPTLLAVTVESTFGYKTYAPPPSKYMHGDHFKLKYTW---LGVTQHYLTATEK  722627

Query  197     TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               +GEFQDLI WD +    R+SLNH               P++D  F   L K++PF
Sbjct  722628  SGEFQDLIMWDCMDEHVRHSLNHKVSH-------NFDPPIRDDRFFHALRKSFPF  722771

>PHKE:scaffold_333 scf_22126_333.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_333.1:1:41401:1 
REF
Length=41401

 Score = 150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 118/219 (54%), Gaps = 16/219 (7%)
 Frame = +3

Query  35     PVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYAR  94
              P  VS+  A+ FKPQL I   CH YPAV   G++S G++ +G          + SQ+Y R
Sbjct  40374  PRAVSEIAAIHFKPQLHISGECHSYPAVSAAGNISAGVEPTGSPASGWREVLITSQVYGR  40553

Query  95     SAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM  154
              SAW NDVWAIMY WYFPK   A +P       G RH+W+  ++WI NP L+   +L +SM
Sbjct  40554  SAWHNDVWAIMYTWYFPKVSPADLP-------GRRHDWKNCILWIGNPALDFPKILEISM  40712

Query  155    SA-SIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGN-TALQLTEDTGEFQDLIQWDQLSSL  212
              S+ +  Y    P     + G    +AYY +   G    +++T   G  QD + W+QL+  
Sbjct  40713  SSDNQKYISSVPPGKSVLSGNRSSIAYYSDQSSGEYHGVKVTTRRGSSQDPVMWEQLTEE  40892

Query  213    ARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              AR +L  T++D+         +P+KDG F   L + WPF
Sbjct  40893  ARIALQTTEFDEAW-------VPMKDGNFTANLKEAWPF  40988

>PHSO:scaffold_16
Length=803425

 Score = 149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 85/123 (69%), Gaps = 8/123 (7%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V+PFPQP+PVT+S+K AV FKPQL I  GCH YPAV + G  SGGL  +G    +
Sbjct  707668  IGHDKVKPFPQPEPVTISEKAAVTFKPQLLITNGCHSYPAVNEAGETSGGLSPTGGTSAK  707489

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS LGSQ+Y RS W ND+WA MY+WYFPK   ++         G RH WE V+VWIDN
Sbjct  707488  CGGSALGSQVYGRSKWYNDIWA-MYSWYFPKDSPSS-------GLGTRHGWENVIVWIDN  707333

Query  142     PGL  144
               P +
Sbjct  707332  PAV  707324

>HYAP:scaffold_1660 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1660:1:2270:1 
REF
Length=2270

 Score = 148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 121/226 (54%), Gaps = 23/226 (10%)
 Frame = -1

Query  24   HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
            HDQ+ P+ +P+  TVS+K A +++P L    GC PY AV  +G  SGGLK +G   G+C 
Sbjct  815  HDQIHPYEKPEETTVSEKAAARYQPSLHSSHGCDPYAAVDAEGRTSGGLKATGDSRGKCG  636

Query  84   GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR-FFGHRHNWEYVVVWIDNP  142
             S +G Q+YAR  W +  + I+YAWYFPK        D +R   GHR++WE+  +W++NP
Sbjct  635  QSYMGGQVYARGEWWDKQFGIVYAWYFPK--------DSVRDGIGHRYDWEWATIWLNNP  480

Query  143  GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY---YNHLLGNTALQLTEDTGE  199
                + + GV+   S G  +      +   G +VK+ Y      H +      L+ + G+
Sbjct  479  EANVSEIRGVTTIGSGGPKRTDKLKPENRVGDTVKLDYRDHGRRHFIA-----LSGNDGQ  315

Query  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELL  245
             Q LI WDQ++  +R + N   W++         MPL D VFE+ L
Sbjct  314  LQPLIMWDQMTEASRCAFNTVGWNKHRL------MPLADTVFEKTL  195

>PHKE:scaffold_104 scf_22126_104.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_104.1:1:101703:1 
REF
Length=101703

 Score = 148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 125/232 (54%), Gaps = 27/232 (12%)
 Frame = +1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGG-LKWSGPQDG  80
              I  D V+PFP+  P T   +  ++FKPQL I+  CHPYPAV  DG+ SGG +++S     
Sbjct  31102  INFDVVKPFPETKPTTTEYEVGLQFKPQLYINYVCHPYPAVDADGNTSGGSIRFSS---K  31272

Query  81     ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
              +C GS+ GSQ+Y RS    DVW IMYAWYFPK        D L     RH W   +  +D
Sbjct  31273  KCKGSQYGSQVYDRSVMNRDVWVIMYAWYFPK--------DVL----SRHTWVSAIA*LD  31416

Query  141    NPGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
              +P + NAT+  +S S S G Y K AP DV  V+GTSVK+ Y     +       T    +
Sbjct  31417  SPSV-NATISALSASFSFGYYQKCAPPDVNMVNGTSVKILYKKKKYMSYE--MSTPGPEQ  31587

Query  200    FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              FQDL+    L+  AR +L   D+  +       K+P+ D  F + L K +PF
Sbjct  31588  FQDLVM*SGLTDQAREALETADFGSS-------KVPMIDDEFLDNLKKAYPF  31722

 Score = 55.8 bits (133),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 16/92 (17%)
 Frame = +2

Query  72    LKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHN  131
             +K+SG    E  G R    IY RSA    VWAI+YA YFP+G         LR    RHN
Sbjct  1235  MKFSG---SELQGPRNKLHIYGRSAMYKGVWAIVYARYFPRG--------ALR----RHN  1369

Query  132   WEYVVVWIDNPGLENATVLGVSMSASIGYSKQ  163
             W++V+VW+D+P   N  +     S SI ++ +
Sbjct  1370  WKHVIVWLDSPS-TNLAISARGHSVSISHTHR  1462

 Score = 47.0 bits (110),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGG  71
             I +++V PFP+ +P T      ++FK Q+ I   C  YPAV  +G+ SGG
Sbjct  1080  IDYNEVEPFPETEPTTNEYVVGLEFKLQIYIRNDCRSYPAVDTEGNTSGG  1229

>HYAP:scaffold_149 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_149:1:161935:1 
REF
Length=161935

 Score = 120 bits (300),  Expect(3) = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 74/122 (61%), Gaps = 8/122 (7%)
 Frame = +2

Query  22     IGHDQVRPFPQP-DPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDG  80
              I HDQVRPF +  +PVT S+K   KFKPQL I  GCHPYPAV  +G  SG LK  G    
Sbjct  88967  IDHDQVRPFAKVVNPVTPSEKAFFKFKPQLHITNGCHPYPAVDCEGKTSGSLKIRGAPSS  89146

Query  81     ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
              +  GS  GSQ+Y RS    + W I+YAWYFPK   +T         GHRH+WE+V+VW  
Sbjct  89147  KSKGSGWGSQVYGRSGLYRNKWTILYAWYFPKDSPST-------GLGHRHDWEHVIVWDR  89305

Query  141    NP  142
               P
Sbjct  89306  QP  89311

 Score = 48.1 bits (113),  Expect(3) = 8e-39, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 16/83 (19%)
 Frame = +1

Query  173    GTSVKVAYY----YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFG  228
              G S K+ Y      NH LG      +  +G++QDLI W+Q+S  A  +LN  D      G
Sbjct  89404  GVSAKINYESKWPVNHALG-----FSSKSGDYQDLITWEQMSEKAHRALNAVD-----SG  89553

Query  229    LAGLKMPLKDGVFEELLDKTWPF  251
              +A    P  DG  E  L + WPF
Sbjct  89554  VA--HAPFNDGAVEHKLARVWPF  89616

 Score = 35.8 bits (81),  Expect(3) = 8e-39, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +3

Query  139    IDNPGLENATVLGVSMSASIGYSKQAPTD  167
              IDNP LEN   L VS SA  GYS Q P D
Sbjct  89301  IDNPELENPKTLAVSTSAHDGYSFQEPPD  89387

>PHCA:scaffold_139 PHYCAscaffold_139
Length=29350

 Score = 147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 123/233 (53%), Gaps = 27/233 (12%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             + ++ V P P+    +     A+KF+PQL I +GCHPYPAV  DG+ + GL     +   
Sbjct  5581  LAYNSVVPLPETTASSTEYSLALKFQPQLNIASGCHPYPAVDADGNTNSGLSIFSLK--S  5754

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C    LGSQ+Y R+    D +AIMYAWYFP+ R   V        GHRH WE+V++WI  
Sbjct  5755  CVEPSLGSQVYGRATTYEDSYAIMYAWYFPRDRKGVV--------GHRHAWEHVILWIKR  5910

Query  142   PGLENATVLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAY---YYNHLLGNTALQLTEDT  197
              G  N  +  VS S + G Y    P     VDGTSVKV Y    ++H +  TA+      
Sbjct  5911  SGF-NQKISAVSASVADGKYFTVIPPTTAMVDGTSVKVQYKAKAFSHYVNVTAV-----A  6072

Query  198   GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
             G+FQ+L+ W+ + + AR +LN  D     FG A   +P K   F + L+  +P
Sbjct  6073  GDFQELVIWEDMPAAARTALNLND-----FGSA--TVPFKTDTFLDNLEDAYP  6210

>PYAP:scaffold_530 pag1_scaffold_530 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_530:1:22792:1 
REF
Length=22792

 Score = 147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 124/231 (54%), Gaps = 28/231 (12%)
 Frame = +2

Query  24    HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
             HD+V  + QP     +Q+ A++FKPQL I  GC PYPAV   G+  GGLK SG Q   C+
Sbjct  4733  HDRVPVWQQPAAADNTQRLALRFKPQLNIVNGCQPYPAVDAQGNTGGGLKPSGSQGAGCS  4912

Query  84    GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
               +  +QIY+RS   N  +AIMYAWYFPK    T         GHRH+WE +VVW+DN  
Sbjct  4913  -DKSKAQIYSRSGTYNGYYAIMYAWYFPKDSPFTGQ-------GHRHDWENIVVWLDN--  5062

Query  144   LENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYY----YNHLLGNTALQLTEDTG  198
               +A V+ VS SA  GY K  P +  Y+ +G S K++Y      NH LG      T   G
Sbjct  5063  AASAKVVAVSASAHSGYKKSFPINQSYLANGVSAKISYSSTWPLNHELG-----FTSAGG  5227

Query  199   EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               Q LIQW+Q++  AR +L  T       G     +P K   F++ L K +
Sbjct  5228  AQQPLIQWEQMTQAARDALERT-------GFGDANVPFKSN-FQDKLAKAF  5356

 Score = 137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 124/232 (53%), Gaps = 27/232 (12%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD V  +PQP P   +Q  AV+FKPQL +  GC PYPAV   G+  GGLK +G     
Sbjct  2904  INHDAVPVWPQPAPADAAQALAVRFKPQLNVVNGCQPYPAVDAQGNTGGGLKPAGSSAAA  3083

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C      +Q+Y+RS   N  +AIMY+WY PK          L   GHRH+WE VVVW+DN
Sbjct  3084  CRDMS-KAQVYSRSGTYNGYYAIMYSWYMPKDSP-------LTGMGHRHDWENVVVWLDN  3239

Query  142   PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDT  197
                 +A V+ +S SA  GY K  P D  ++ G S K++Y      NH LG      T   
Sbjct  3240  AA--SANVVALSASAHSGYKKSFPVDKNFLSGVSAKISYSSTWPLNHELG-----FTSSA  3398

Query  198   GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             G+ Q LIQW+Q++  AR +L  TD     FG A   +P K   F++ L K +
Sbjct  3399  GKQQPLIQWEQMTQAARDALERTD-----FGNA--NVPFKSN-FQDKLAKAF  3530

 Score = 108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 97/185 (52%), Gaps = 27/185 (15%)
 Frame = +2

Query  69    SGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH  128
             SGGL  +G Q   C      +Q+Y+RS   N  +AIMY+WY PK          L   GH
Sbjct  6410  SGGLNPTGSQAAACRDMS-KAQVYSRSGTYNGYYAIMYSWYMPKDSP-------LTGEGH  6565

Query  129   RHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY----YNH  184
             RH+WE VVVW+DN    +A ++ +S SA  GY K  P D KY+ G S K++Y      +H
Sbjct  6566  RHDWENVVVWLDNAA--SANIVALSASAHSGYKKSFPVDKKYLSGVSAKISYKSTWPLDH  6739

Query  185   LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
              LG      T   G+ Q LIQW+Q++  AR +L  TD     FG A +  P K   F++ 
Sbjct  6740  ELG-----FTTSAGKQQPLIQWEQMTQAARDALERTD-----FGKANV--PFKSN-FQDK  6880

Query  245   LDKTW  249
             L K +
Sbjct  6881  LAKAF  6895

 Score = 36.6 bits (83),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGS  67
             I HD V  +PQP P   +Q  AV+FKPQL +  GC PYPAV   G+
Sbjct  5977  INHDAVPVWPQPAPADAAQALAVRFKPQLNVVNGCQPYPAVDAQGN  6114

>PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_323, whole genome shotgun sequence
Length=2746546

 Score = 145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 124/230 (54%), Gaps = 19/230 (8%)
 Frame = +3

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
                +D+++PFP         + A+ F+P L+I++GCHPYPAV K+G +S GL  S     +C+
Sbjct  2356746  YDKIKPFPVAKRDCRINEIALDFQPMLRIESGCHPYPAVDKNGYVSDGLGVSH-WFTDCS  2356922

Query  84       GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                GS  GSQ+Y R+       AIMYAWYFP  R   V P ++   GHRH WE+ ++WI    
Sbjct  2356923  GSPEGSQVYGRAYVFKGYLAIMYAWYFP--RDFMVTPFYV---GHRHGWEHAILWIGG-S  2357084

Query  144      LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA--LQLTEDTGEFQ  201
                 E+   L  ++ ++ GY K +P   KYV     K+ Y +   LG T   L  T++ GEFQ
Sbjct  2357085  TEDPVFLAATVESTFGYKKYSPVPTKYVKSDHFKLEYTW---LGVTHHYLTATKNMGEFQ  2357255

Query  202      DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                DL+ W+ L+  AR SLN                PL D  F   L K++PF
Sbjct  2357256  DLVMWNNLTDEARVSLNEKI-------SLNFNSPLSDKRFFTALRKSYPF  2357384

 Score = 144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 128/235 (54%), Gaps = 25/235 (11%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                + +D+++PFP  +      + A+ F+P L+I++GCHPYPAV ++G +S GL  S     +
Sbjct  2366795  LQYDKIKPFPATERDCPINEIALDFQPMLRIESGCHPYPAVDENGYISDGLGVSH-WFTD  2366619

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR---FFGHRHNWEYVVVW  138
                C GS  GSQ+Y R+       AIMYAWYFP+        DF+    + GHRH WE+ ++W
Sbjct  2366618  CLGSPEGSQVYGRAHVYKGYLAIMYAWYFPR--------DFMTTPFYVGHRHGWEHAILW  2366463

Query  139      IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTA--LQLTED  196
                I     E+A +L  S+ +++ Y    P   KY+ G  VK+ Y +   LG T   L  T++
Sbjct  2366462  IGGSS-EDAVLLAASVESTLSYDTYNPVPSKYMKGDHVKLEYTW---LGVTHHYLTATKE  2366295

Query  197      TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                +GEFQDL+ WD ++  A  SLN                PL D  F + L K++PF
Sbjct  2366294  SGEFQDLVMWDNMTENAHISLNEK-------VSLNFNSPLSDKRFFKALLKSYPF  2366151

>PHKE:scaffold_1562 scf_22126_1562.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_1562.1:1:1478:1 
REF
Length=1478

 Score = 142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 84/124 (68%), Gaps = 8/124 (6%)
 Frame = +2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP+PVTV++K AVKFKP   I++GC  YPAV   G ++GGLK +G   G 
Sbjct  1130  IDHDKVQPFAQPEPVTVAEKAAVKFKPTFIIESGCASYPAVNAAGEITGGLKGTGFTSG-  1306

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C  S +GSQ+Y RS W NDVWAIMYAWYFPKG  +        +   RH+W  V+VWIDN
Sbjct  1307  CKVSLMGSQVYGRSVWYNDVWAIMYAWYFPKGFWSD-------YASRRHDWANVIVWIDN  1465

Query  142   PGLE  145
             P  E
Sbjct  1466  PASE  1477

>PHIF:NW_003303720.1 Phytophthora infestans T30-4 supercont1.39 
genomic scaffold, whole genome shotgun sequence
Length=1432524

 Score = 144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/272 (36%), Positives = 134/272 (49%), Gaps = 58/272 (21%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV+PF QP PVT++++ AVKFKPQL I  G   +PAV   G  SGGLK +   +G 
Sbjct  731739  INHDQVQPFAQPVPVTIAERAAVKFKPQLYITQGRVSFPAVNAAGETSGGLKVTKGTEG-  731915

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH-RHNWEYVVVWID  140
               C+ + LGSQ+  RS W  D WA+++AWYFPK         F  F    RH W  +V+W+D
Sbjct  731916  CSEAPLGSQVCGRSTWYQDKWAMVFAWYFPK--------SFWDFDAKDRHYWASMVLWLD  732071

Query  141     NPGL--ENATVLGVSMSASI----------------GYSKQAPT----------------  166
               NP L  E   +LG S+S  +                 Y KQ                   
Sbjct  732072  NPALHVETPKILGASLSHQLQKRQWMATLTMAERRDAYFKQTNIPPMGFVGTQQIAQNRI  732251

Query  167     -----DVKYVDGTSV--KVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNH  219
                    +  YV G++V  +++  Y       AL  +E  G+FQDLI W+QL+  AR +LN 
Sbjct  732252  SRRRWNYTYVGGSNVSTRISTTYWDSFEWLALTFSEVDGKFQDLIVWEQLTDDARAALNS  732431

Query  220     TDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                ++ ++       K+PL D   E  L   +PF
Sbjct  732432  AEFGES-------KVPLNDHNLENTLKLAYPF  732506

>PYAP:scaffold_1161 pag1_scaffold_1161 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_1161:1:6079:1 
REF
Length=6079

 Score = 142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 118/233 (51%), Gaps = 26/233 (11%)
 Frame = -2

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            + HD +  + QP     +Q  AV+FKPQL I  GC PYPAV   G+ SGGL  SG     
Sbjct  645  VAHDSIAVWAQPAAADNAQALAVRFKPQLNIVNGCQPYPAVDASGNTSGGLNPSGSPGAA  466

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
            C+  +  +Q+YARS   N  +AIMYAWY PK   +T         GHRH WE  +VW+D+
Sbjct  465  CS-DKSKAQVYARSGTYNGAYAIMYAWYMPKDSPST-------GLGHRHEWENTIVWLDS  310

Query  142  PGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYY----YNHLLGNTALQLTED  196
              +  A ++  + SA  GY K  P D  YV +G SVK+ Y      NH  G      T  
Sbjct  309  TNIATAKIVAAATSAHGGYKKSYPIDGNYVANGASVKIEYKSTWPINHETG-----FTTS  145

Query  197  TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
             G  Q LIQW+QL+  AR  L   D     FG A   +P K   F+  L K +
Sbjct  144  GGAQQPLIQWEQLTQAARNGLESAD-----FGDA--TVPFKSN-FQSYLAKAY  10

>PHCA:scaffold_6 PHYCAscaffold_6
Length=1423605

 Score = 140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 85/134 (63%), Gaps = 8/134 (6%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD+V PF QP PVT+S+  AVK+KPQL++  GC P+PAV   G +SGGLK S   DG 
Sbjct  1149731  IDHDKVEPFAQPQPVTISENVAVKYKPQLQVSRGCVPFPAVNAAGEISGGLKGSTGTDG-  1149907

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                CT + LGSQ+Y RSAW  D WA+M+AWYF K      P         RH W   V+W+DN
Sbjct  1149908  CTEAPLGSQVYGRSAWYQDKWALMFAWYFLKNFCGGSPKS-------RHLWANYVLWLDN  1150066

Query  142      PGLENATVLGVSMS  155
                P LE   +LG S+S
Sbjct  1150067  PALETPKILGASLS  1150108

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 6/62 (10%)
 Frame = +1

Query  190      ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                 L  T   G++QDLI W+QL+  AR +L   D+ +        K+P  D  FE  L   W
Sbjct  1150330  GLDFTYGDGQYQDLIMWNQLTDQAREALESADFGED------TKVPFNDKNFEAALGHAW  1150491

Query  250      PF  251
                PF
Sbjct  1150492  PF  1150497

>PYAR:scaffold_4659 par_scaffold_4659 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4659:1:2077:1 
REF
Length=2077

 Score = 139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 125/234 (53%), Gaps = 30/234 (13%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             +GHD +  + +P P    QK AV+FKP L +  GC PYP V   G+  GGLK  G     
Sbjct  1177  VGHDAIPVWAEPAPADAPQKLAVRFKPYLDVVNGCQPYPVVDAQGNTGGGLKPVGSSTAA  998

Query  82    CTGSRLG-SQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C    +G +Q+Y+RS   N  +AIMY+WY  K   +T         GHRH+WE  VVW+D
Sbjct  997   C--KDMGKAQVYSRSGTYNGFYAIMYSWYMAKDSPST-------GMGHRHDWENAVVWLD  845

Query  141   NPGLENATVLGVSMSASIGYSKQAPTDVKYV-DGTSVKVAYYY----NHLLGNTALQLTE  195
             +    +A V+ ++ SA  GY K  P D KY+ DG ++K++Y      NH LG      T 
Sbjct  844   SAA--SAKVVAIAASAHGGYKKSHPADNKYLEDGVNMKLSYKAMWPKNHELG-----FTT  686

Query  196   DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
               G+ Q LIQW+Q++  A+ +L  TD     FG AG+  P K   FE  L K +
Sbjct  685   KKGKQQPLIQWEQMTPEAQKALESTD-----FGSAGV--PFKSN-FESNLAKAF  548

>PHKE:scaffold_563 scf_22126_563.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_563.1_contig_1:1:18668:1 
REF
Length=18668

 Score = 140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 92/136 (68%), Gaps = 10/136 (7%)
 Frame = -2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I HD+ +PF   +PVT ++K AVKFK  L ID+GC+PYPAV   G  SGGLK SG ++G+
Sbjct  14155  IDHDKAQPF---EPVTEAEKAAVKFKLSLLIDSGCNPYPAVNAAGETSGGLKNSGWRNGK  13985

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C GS LG Q+Y RS+W  ++WAIM++WYFPK  A  +       +GHRH+W  VVVW +N
Sbjct  13984  CKGSSLGPQVYVRSSWYRNLWAIMHSWYFPKNPAGLM-------YGHRHDWANVVVWSNN  13826

Query  142    PGLENATVLGVSMSAS  157
              P + N T + V  S+S
Sbjct  13825  PAVTNPTSVAVCPSSS  13778

>HYAP:scaffold_73 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_73:1:324626:1 
REF
Length=324626

 Score = 138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 131/248 (53%), Gaps = 38/248 (15%)
 Frame = -3

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               HD++ P  QP P+T S K A+K+KPQL +  GC  +PAV   G  +GGLK +     +C 
Sbjct  251022  HDKIVPLIQPKPITTSDKAALKYKPQLYVANGCSSFPAVNAAGKTNGGLKGTKGAS-KCG  250846

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKG---RAATVPPDFLRFFGHRHNWEYVVVWID  140
                S  GSQ+Y RS W    WAIM++WYFPKG   R A+           RH+W  VV+W+D
Sbjct  250845  VSPTGSQVYGRSKWYKGDWAIMFSWYFPKGFHDRKAS----------RRHDWASVVIWLD  250696

Query  141     NPGLENATVLGVSMSASIGYSKQA-----------PTDVKYVD------GTSVKVAYYYN  183
               NP  +   +L VS+S S    K+              +++Y +       +SVKV Y+  
Sbjct  250695  NPARKTQKILRVSLSISDTEYKKIVHIPPIFFAGNRGNMRYGNVGGRGSNSSVKV-YHGT  250519

Query  184     HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                    + L+L++  GE+QDLI W+QL +++R +L     D   FG A  ++P  D  F++
Sbjct  250518  KTSCGSFLRLSQYEGEYQDLIMWNQLPNVSRAALE----DPKNFGDA--RVPFTDANFDK  250357

Query  244     LLDKTWPF  251
                L   + F
Sbjct  250356  SLGMAF*F  250333

>PYUU:scaffold_1981 scf1117875581981 dna:supercontig supercontig:pug:scf1117875581981:1:580909:1 
REF
Length=580909

 Score = 89.4 bits (220),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 53/91 (58%), Gaps = 6/91 (7%)
 Frame = +3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              +GHDQV  F         QK A+KF  Q+ I  GCHPYPAV   G  SGGLK SG Q  +
Sbjct  95337  VGHDQVVSF------AALQKAALKFNSQIHISNGCHPYPAVDAAGITSGGLKPSGSQSAD  95498

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPK  112
              C GS   +Q+Y R A    V A MY+WYFPK
Sbjct  95499  C*GSVKCTQVYGRGAAYKGVHAHMYSWYFPK  95591

 Score = 68.9 bits (167),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +1

Query  123    LRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY  180
              +   GH H+WE+VVVWIDNP   N  +L VS SA  GY K AP     VDGTSVKV Y
Sbjct  95623  IAVIGHHHDWEHVVVWIDNPNATNPKILAVSPSAHSGYQKYAPPKANTVDGTSVKVDY  95796

 Score = 34.3 bits (77),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 7/56 (13%)
 Frame = +3

Query  194    TEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
              T   GE Q LI WDQ+    R +L +T+     FG A +  P+K+G F + L K +
Sbjct  95817  TTTAGEKQPLIMWDQMMQATRMALENTN-----FGDANV--PMKNGNFMDKLAKAY  95963

>PHIF:NW_003303734.1 Phytophthora infestans T30-4 supercont1.25 
genomic scaffold, whole genome shotgun sequence
Length=2165783

 Score = 113 bits (282),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 10/123 (8%)
 Frame = +2

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG--CHPYPAVQKDGSMSGGLKWSGPQD  79
                I HD++  F QP+P T+S++ A+KFKPQL       C P+PAV   G ++GGLK +   +
Sbjct  1444754  IDHDKIESFAQPEPATISERVAIKFKPQLFTPKRKVCAPFPAVNAAGGVTGGLKGTNGNE  1444933

Query  80       GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                  C  +  GSQ+Y R+ W  D+WAIMYAWYFPK         ++ F   RH+W+ VVVWI
Sbjct  1444934  A-CRLTPNGSQVYGRAGWHQDMWAIMYAWYFPKAF-------WMDFPTSRHDWKNVVVWI  1445089

Query  140      DNP  142
                DNP
Sbjct  1445090  DNP  1445098

 Score = 58.5 bits (140),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 9/112 (8%)
 Frame = +3

Query  143      GLENATVLGVSMSASIGYSKQAPTDVK--YVDGTS-VKVAYYYNHLLGNTALQLTEDTGE  199
                GL    ++ VSMS S     Q    +   +  G     + ++Y   LG+T++ L    GE
Sbjct  1445085  GLTTPNIMAVSMSKSGSKEDQWERKIANAFFSGLGRTSLRFHYETDLGSTSINLAWWEGE  1445264

Query  200      FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                +QDLI W+QL+  AR ++N    D + FG A  ++P  D  FE+ L + WPF
Sbjct  1445265  YQDLIMWEQLTDPARVAMN----DISNFGDA--EVPFNDNNFEDFLQRAWPF  1445402

 Score = 112 bits (279),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 10/123 (8%)
 Frame = -1

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG--CHPYPAVQKDGSMSGGLKWSGPQD  79
                I HD++  F QP+P T+S++ A+KFKPQL       C P PAV   G ++GGLK +   +
Sbjct  1462112  IDHDKIESFAQPEPATISERVAIKFKPQLFTPKRKVCAPLPAVNAAGGVTGGLKGTNGNE  1461933

Query  80       GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                  C  +  GSQ+Y R+ W  D+WAIMYAWYFPK         ++ F   RH+W+ VVVWI
Sbjct  1461932  A-CRLTPNGSQVYGRAGWHQDMWAIMYAWYFPKAF-------WMDFPTSRHDWKNVVVWI  1461777

Query  140      DNP  142
                DNP
Sbjct  1461776  DNP  1461768

 Score = 57.8 bits (138),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 12/115 (10%)
 Frame = -2

Query  143      GLENATVLGVSMSAS-IGYSKQAPTDVKYVDG-----TSVKVAYYYNHLLGNTALQLTED  196
                GL    ++ VSMS S   Y K+   + K  +          + ++Y   LG++++ L   
Sbjct  1461781  GLTTPNIMAVSMSKSGRSYHKEDQWERKIANAFFSGLGRTSLRFHYETDLGSSSINLAWW  1461602

Query  197      TGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 GE+QDLI W+QL+  AR ++N    D + FG A  ++P  D  FE+ L + WPF
Sbjct  1461601  EGEYQDLIMWEQLTDPARVAMN----DISNFGDA--EVPFNDNNFEDFLQRAWPF  1461455

>PHIF:NW_003303725.1 Phytophthora infestans T30-4 supercont1.34 
genomic scaffold, whole genome shotgun sequence
Length=1799396

 Score = 130 bits (326),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 117/247 (47%), Gaps = 55/247 (22%)
 Frame = -2

Query  45       KFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAI  104
                K++PQL ID GC  + AV   G ++GGLK +   DG CT + LGSQ Y RS W  D WA+
Sbjct  1489237  KYRPQLNIDFGCVSFAAVNAAGEITGGLKPTKGTDG-CTEAPLGSQTYCRSTWYQDKWAM  1489061

Query  105      MYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSK--  162
                ++AWYFPKG     P         RH WE +V+W+DNP LE+ T+ G S+S  +   +  
Sbjct  1489060  VFAWYFPKGFLGPDP-------RIRHYWESMVIWLDNPALESPTIFGASLSQRLLKPRRQ  1488902

Query  163      ---------QAPTDVK---------------------------YVDGT--SVKVAYYYNH  184
                         + P D +                           Y+ G+  S +V +Y + 
Sbjct  1488901  FGLFNFTEPREPYDRRTVIPITGFVGAQRNLVNRTGRWSYSYEYISGSNISTRVTHYMDG  1488722

Query  185      LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                     AL  +   G++ DLI W+QL+  AR +LN  D+ +        K+P  D  F+  
Sbjct  1488721  TYNWLALSYSYSDGQYPDLIMWEQLTDEARAALNTADFGEP-------KVPFNDANFQST  1488563

Query  245      LDKTWPF  251
                L   WPF
Sbjct  1488562  LRLAWPF  1488542

 Score = 40.8 bits (94),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTA  43
                I HDQV+PF QPDPVT+S+K A
Sbjct  1489308  INHDQVQPFAQPDPVTISEKAA  1489243

 Score = 102 bits (255),  Expect(3) = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 97/210 (46%), Gaps = 54/210 (26%)
 Frame = +1

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                CT + LGSQ Y RS W  D WA+++AWYFPKG     P         RH WE +V+W+DN
Sbjct  1524883  CTEAPLGSQTYCRSTWYQDKWAMVFAWYFPKGFLGPDP-------RIRHYWESMVIWLDN  1525041

Query  142      PGLENATVLGVSMSASI----------GYSK-QAPTDVK---------------------  169
                P LE+ T+LG S+S  +           ++K + P D +                     
Sbjct  1525042  PALESPTILGASLSQQLLKPRRQFGLFNFTKPREPYDRRTVIPITGFVGAQRNLVNRTGR  1525221

Query  170      ------YVDGT--SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                      Y+ G+  S +V +Y +      AL  +   G++ DLI W+QL+  AR +LN  D
Sbjct  1525222  WSY*YEYIPGSNISTRVTHYMDGTYNWLALSYS*SDGQYPDLIMWEQLTDEARAALNTAD  1525401

Query  222      WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                + +        K P  D  F+  L  TWPF
Sbjct  1525402  FGEP-------KDPFNDANFQSTLRLTWPF  1525470

 Score = 41.2 bits (95),  Expect(3) = 5e-32, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTA  43
                MNF    V   A L  A+A  I HDQV+PF QPDPVT+S+K A
Sbjct  1524642  MNFLITLVLCYALLFPARAGTINHDQVQPFAQPDPVTISEKAA  1524770

 Score = 37.0 bits (84),  Expect(3) = 5e-32, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +2

Query  45       KFKPQLKIDAGCHPYPAVQKDGSMSGGLK  73
                K++PQL ID GC  + AV   G ++GGLK
Sbjct  1524776  KYRPQLHIDFGCVSFAAVNAAGEITGGLK  1524862

>PHIF:NW_003303745.1 Phytophthora infestans T30-4 supercont1.14 
genomic scaffold, whole genome shotgun sequence
Length=3113719

 Score = 136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 127/242 (52%), Gaps = 35/242 (14%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + HD+V PFPQP+PV  S+  A+ FKPQL +  G C  +PAV   G ++GGLK S   D 
Sbjct  127796  VDHDKVEPFPQPEPVNASEIAAITFKPQLYVREGLCVSFPAVNTAGEVTGGLKGSNGNDA  127975

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF-GHRHNWEYVVVWI  139
                C  +  GSQ+Y R+ W  D+WAIMYAWYFPK        DF   F  HRH+W  VVVWI
Sbjct  127976  -CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPK--------DFWTGFPTHRHDWISVVVWI  128128

Query  140     DNPGLENATVLGV-SMSASIGYSKQAPTD---------VKYVDGTSVKVAYYYNHLLGNT  189
               +N  L+   + GV S   S+  S  + +D          ++V G +  ++    HL  ++
Sbjct  128129  NNHDLDMPKIEGVGSPCPSLTQSITSRSDKWHPILLASKRWVGGITALISMTPTHLSDSS  128308

Query  190     A------LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
               +      L  T  T   QDLI W+QL+  AR +LN    D   F  A  K+P  D  FE 
Sbjct  128309  SRWIWALLSWTFHTD--QDLIMWEQLTDAARVALN----DGNNFSKA--KVPFSDEHFEG  128464

Query  244     LL  245
                L
Sbjct  128465  RL  128470

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 75/150 (50%), Gaps = 21/150 (14%)
 Frame = +2

Query  113     GRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-----------IGYS  161
               G    +P     F  HRH+W+ VVVWIDNP LE   + GVSMS S             Y 
Sbjct  126467  GTPPCLPHTTTGFPTHRHDWKSVVVWIDNPALEIPKIEGVSMSKSDTKYKKKLKLKESYF  126646

Query  162     KQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                 APT     +G++  + + Y    G+T +  T   GE+Q+LI W+QL+  AR +LN   
Sbjct  126647  SGAPT-----NGSNTSLRFEYEAGFGSTFMGFTRWDGEYQNLIMWEQLTDAARATLN---  126802

Query  222     WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                D   FG     +P  D  FE+ LD+ WPF
Sbjct  126803  -DGNNFGKEA-SVPFSDEHFEDRLDEAWPF  126886

>PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_499.1_contig_1:1:23234:1 
REF
Length=23234

 Score = 127 bits (318),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 107/202 (53%), Gaps = 16/202 (8%)
 Frame = -3

Query  52    IDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFP  111
             +  GCHPYPAV+  G +S  L+ +   DG      LG+Q+Y R+ W  D+WA M+AWYF 
Sbjct  8238  VSGGCHPYPAVKAAGEISDELRPAKGSDGYLNPP-LGAQVYGRAVWKEDIWATMFAWYFS  8062

Query  112   KGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSK-QAPTDVKY  170
             +G +        R+   RH+W  VVVWIDNP LE   ++G+S S +I Y K   P DV Y
Sbjct  8061  QGSST-------RYPNRRHDWANVVVWIDNPELETPAIMGISTSYNIVYDKFTLPEDVNY  7903

Query  171   VDGTSVKVAYYYNHLLGNTALQLTEDTG-EFQDLIQWDQLSSLARYSLNHTDWDQTLFGL  229
              +G+S  +      +  +     + D G + + LI W+QL+  A  +LN    D   FG 
Sbjct  7902  FNGSSPVLYRKLQSVRSDLLACESRDEGAQDEVLIMWEQLTEEAWMALN----DMDNFGR  7735

Query  230   AGLKMPLKDGVFEELLDKTWPF  251
             A   MP  +  F + LD  WPF
Sbjct  7734  A--DMPFSEENFLDSLDHVWPF  7675

 Score = 42.7 bits (99),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQ  49
             I HD+V PFPQ  P T+S+K AVKFKPQ
Sbjct  8324  IDHDKVEPFPQLGPTTISEKAAVKFKPQ  8241

>PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 
genomic scaffold, whole genome shotgun sequence
Length=734189

 Score = 133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 116/234 (50%), Gaps = 42/234 (18%)
 Frame = -2

Query  39      SQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE--CTG--SRLGSQIYAR  94
               S +  +KFKPQL ++ GC+ +PAV   G  S GL     + G   C    ++LGSQ+Y R
Sbjct  216349  SLRAGIKFKPQLHVETGCYSFPAVNAKGETSTGLP---AEQGNYFCVKQYNQLGSQVYGR  216179

Query  95      SAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM  154
               + W   VWAIMYAWY+PK     V           H+W+  VVWI NP +E+  +LG+S 
Sbjct  216178  ATWYKGVWAIMYAWYYPKAITMMVA-------TATHDWQNAVVWISNPDVESPKILGLST  216020

Query  155     S-----------------ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDT  197
               S                 +   Y K+      +++GTS K+A     +LG   L+ T D 
Sbjct  216019  SKKSETDHTKPVTKEMFKSDTTYDKRTKNLDPFLEGTSFKLASTL--VLGPIFLKPTVDK  215846

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               G  QDL+ W QL + AR +LN T+            +P  D  F++ LD+ WPF
Sbjct  215845  GNVQDLVMWSQLPNAARVALNSTEIGN---------VPFSDANFQKKLDEAWPF  215711

>HYAP:scaffold_58 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_58:1:378272:1 
REF
Length=378272

 Score = 133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 123/233 (53%), Gaps = 23/233 (10%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD V+ F QP P+T  Q+ AV+F P + +  GC+ YPAV   G +S GL+ SG   G 
Sbjct  267180  INHDLVKVFHQPKPMTEPQRAAVRFNPTVVVSYGCYLYPAVNALGQISKGLQNSGWPSGM  267359

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  G+Q+Y RS W+   +AIMYA++ PK +             HR+  +Y +VW+  
Sbjct  267360  CKGSGHGTQVYGRSTWIKGKFAIMYAYFSPKQQTTHGQ-------NHRYGRDYAIVWLAT  267518

Query  142     PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE-DTGEF  200
               P  +  T L V++  +    K  P +     G SVK+ + + H      L ++E + G+ 
Sbjct  267519  P--KAMTFLAVAVGWNEMSYKFKPGE---KVGESVKIEFGH-HGGDRLILGISEKEGGKR  267680

Query  201     QDLIQWDQLSSLARYSLNHTDW--DQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 LI W+QL   AR SLNH  W  D+        KMPL D  F+ LL+K WPF
Sbjct  267681  LPLIMWEQLPFAARCSLNHARWIYDKE-------KMPLSDERFQHLLNKAWPF  267818

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 46/89 (52%), Gaps = 10/89 (11%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKD-GSMSGGLKWSGPQDG  80
               I HD+V  F  P+PVT S+K AV+F P +     C  YPAV K+ G +SGGL  SG   G
Sbjct  358947  ICHDRVEVFAHPEPVTESEKAAVRFNPTILFICRCDLYPAVDKELGKISGGLYPSGKPYG  358768

Query  81      EC---------TGSRLGSQIYARSAWVND  100
                C          G R GS +Y+ S   N 
Sbjct  358767  SCKNLSMALKSMGVRFGSGVYSPSCTHNS  358681

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 77/168 (46%), Gaps = 19/168 (11%)
 Frame = -2

Query  85      SRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGL  144
               S+ G+Q+Y RS W   V+AIMYA + PK      P D   +  HR+ W+Y ++W+  P  
Sbjct  358756  SKYGAQVYGRSIWFGCVFAIMYA*FTPK-----RPVDKGTY--HRYGWDYAIIWLATP--  358604

Query  145     ENATVLGVSMSASIGYSKQAPT-DVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
                NAT    ++S  +G ++   T       G SVK+    +       +   ++ G+   L
Sbjct  358603  -NAT---AALSVMVGQTRDGNTLKPTETIGESVKIELGLHGGHDIVLVISQKEHGKTIPL  358436

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I W++L   AR    H +  +  F     KMP  D  FE L  +  P 
Sbjct  358435  IMWEKLPIEAR--CPHNEAKRVNF---EEKMPRGDERFEGLSTEARPL  358307

>PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1343, whole genome shotgun sequence
Length=1546205

 Score = 132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 127/240 (53%), Gaps = 28/240 (12%)
 Frame = -1

Query  25      DQVRPFPQPDPVTVSQKTAVKFKPQLKID-AGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               D++ PFPQP P   +QK A+K+KP L      C PY AV  DG +S GLK S   DG CT
Sbjct  955997  DKIEPFPQPIPTCATQKLALKYKPLLYTSMVVCVPYAAVDADGEVSDGLKGSNGNDG-CT  955821

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                +R GSQIY R     ++ AIMYAWYFPK         +L F   RH+W+ VVVW+++  
Sbjct  955820  YARHGSQIYGRIGSYENLSAIMYAWYFPKRF-------WLGFPIQRHDWKSVVVWLNDLK  955662

Query  144     LENATVLGVSMSAS-IGYSKQAPTDVK-----------YVDGTSVKVAYYYNHLLGNTAL  191
                   T++ VSM+ S   Y      D+             +  TS++   Y+   L ++ +
Sbjct  955661  SMTPTIVAVSMAKSDTRYKTVTKLDLNDFARLQVGSNVVISNTSLRFE-YFEFGLRSSNI  955485

Query  192     QLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               +LT   G++Q LI WDQL+  AR +LN    + + FG A   +P  D  F++ L + +P 
Sbjct  955484  RLTGHNGQYQKLILWDQLTDPARDALN----EDSNFGSA--VVPFNDNQFKDHLQEAYPL  955323

>PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_289, whole genome shotgun sequence
Length=778693

 Score = 132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 117/233 (50%), Gaps = 21/233 (9%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + +D++ P P     ++    A+ F P L + +GCHPYPAV K G +S GL  S     +
Sbjct  546906  VQYDEIEPLPVVARDSLINSIALNFHPMLFVSSGCHPYPAVDKHGYISNGLGVSH-LFTD  547082

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR---FFGHRHNWEYVVVW  138
               C  S  GSQ+Y R+       AIMY WYFP+        DF+    + GHRH WE+ + W
Sbjct  547083  CMDSPKGSQVYGRAFEFKGHLAIMYTWYFPR--------DFMSAPFYIGHRHGWEHAIFW  547238

Query  139     IDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTG  198
                     +N  +L V++ ++ GY   AP   + + G   K+  Y   ++ +  L  +E TG
Sbjct  547239  F-GAYRKNPRLLAVTVESTFGYKTYAPPSSENMHGDHFKLE-YTTLIVTHHYLTASERTG  547412

Query  199     EFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               EFQ+L+ W+ ++  ARYSLNH               P++D  F   L  ++PF
Sbjct  547413  EFQNLVMWNSMNERARYSLNHKVSH-------NFDPPIRDERFFHALRNSFPF  547550

>PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2904, whole genome shotgun sequence
Length=1431973

 Score = 132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 109/180 (61%), Gaps = 9/180 (5%)
 Frame = +2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I  + V+PF QP P T SQ++A+K++P+L I + CHPYPAVQ +GS++ GL W   Q   
Sbjct  401102  INVNAVQPFKQPKPTTDSQRSAIKYQPRLSISSRCHPYPAVQANGSLNEGLPWKVFQ-YR  401278

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQIY+ S W    WAIMYAWY PK    T   ++L   GH H W +VVVW D+
Sbjct  401279  CHGSPHGSQIYS*SDWYRGKWAIMYAWYLPKALDQT---NWL-VDGHCHFWTWVVVWTDS  401446

Query  142     PGLENATVLGVSMSASIG--YSKQAPTDVKY-VDGTSVKVAYYYNHLLGNTALQLTEDTG  198
               P    +T+L  S +A IG    K  P + KY +D  S+KV  + ++L   T +++TE  G
Sbjct  401447  PDPNVSTILAGS-TAGIGDKIKKYLPLESKYLLDNKSLKVKTHESYLWKRTGVKVTEKVG  401623

>PHCA:scaffold_37 PHYCAscaffold_37
Length=577888

 Score = 130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 94/157 (60%), Gaps = 23/157 (15%)
 Frame = +1

Query  99      NDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI  158
               N +WAIMY+WYFPK   +T         GHRH+WE+V+VWIDNP +    +L V+ SA  
Sbjct  141094  NGIWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDNPEIAEPKILAVTPSAHS  141252

Query  159     GYSKQAPTDVKYVDGTSVKVAYY----YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLAR  214
               GYS Q P D   V+GTSVKV Y      NH LG+T        G++QDLI W+QL+  AR
Sbjct  141253  GYSAQVPPDADKVEGTSVKVNYESKWPINHALGSTT-----KGGDYQDLIMWEQLTDAAR  141417

Query  215     YSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                +L +TD     FG A +  P+KDG F   L+K WPF
Sbjct  141418  LALENTD-----FGKANV--PMKDGNFVGKLNKAWPF  141507

 Score = 102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               IGHD+V PF QP+PVT+++K A+KFKPQL I  GCH YPAV   G  SGGLK +G     
Sbjct  135175  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAG  135354

Query  82      CTGSRLGSQIYARSAWVNDV  101
               C GS  GSQ+Y RS W N V
Sbjct  135355  CKGSGWGSQVYGRSTWHNVV  135414

>PHIF:NW_003307271.1 Phytophthora infestans T30-4 supercont1.1289 
genomic scaffold, whole genome shotgun sequence
Length=5319

 Score = 111 bits (277),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 98/189 (52%), Gaps = 33/189 (17%)
 Frame = +1

Query  82    CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
             C  + LGSQ+Y RS+W  D WA+M+AWYFPK   A +P         RH+W  +VV IDN
Sbjct  655   CEEAPLGSQVYGRSSWYEDKWAMMFAWYFPKAFWAGMP-------SRRHDWASMVV*IDN  813

Query  142   PGLENATVLGVSMSASIG-YSKQAPTDVK-YVDG-----------------TSVKVAYYY  182
             P LE   +LGVS+S S   YS+   +  + Y  G                 TS++V +  
Sbjct  814   PDLETPKILGVSLSTSTNRYSRDTGSPSEGYSAGFQIYGRRGNLTRTPGSNTSIRVTHST  993

Query  183   NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFE  242
                  +  L  + + GE+QDLI W+QL+  AR + + TD+ ++       K+P  +  F 
Sbjct  994   ELAFSSAYLDFSAEDGEYQDLIMWEQLTEEARLAPDSTDFGKS-------KVPFNEDNFG  1152

Query  243   ELLDKTWPF  251
             + L+K WPF
Sbjct  1153  DKLEKAWPF  1179

 Score = 52.0 bits (123),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  35   PVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLK  73
            PVTVS+  A+KFKP L ID GC  +PAV   G  SGGLK
Sbjct  516  PVTVSETVALKFKPMLLIDGGCVSFPAVNVAGETSGGLK  632

>PHKE:scaffold_147 scf_22126_147.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_147.1:1:78312:1 
REF
Length=78312

 Score = 129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 125/232 (54%), Gaps = 24/232 (10%)
 Frame = -3

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              I H +VRP  QP+ VTVS+K  VKF+P+L I +GC  +P V  +G  SGGL+    + G 
Sbjct  62152  IDHGKVRPLAQPESVTVSEKAGVKFRPELMIISGCCWFPVVN-EGETSGGLR-GTGRTGG  61979

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG--RAATVPPDFLRFFGHRHNWEYVVVWI  139
              C  + L  Q+Y   AW  + WAI+Y+ Y+P+G   ++T P         RH+W Y +V I
Sbjct  61978  CDSAPLRLQVYD*GAWYKNYWAIIYSRYYPRGFWASSTTP---------RHDWSYAIV*I  61826

Query  140    DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199
              DNP  E+ T+ G+S      +S  +   +   D  S +  +  + L+G      T   G+
Sbjct  61825  DNPEFESPTIKGLSTY----HSGSSFGKIASPDAFSTRCYHRISPLIGCAFTDWTILDGD  61658

Query  200    FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               QDLI WDQL+  AR +LN TD+  T        +  KD  FE+ L+K WPF
Sbjct  61657  SQDLIMWDQLTDAARKTLNTTDFGNT-------NVLFKDNNFEKKLEKAWPF  61523

>PHIF:NW_003303721.1 Phytophthora infestans T30-4 supercont1.38 
genomic scaffold, whole genome shotgun sequence
Length=1642046

 Score = 129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 108/229 (47%), Gaps = 15/229 (7%)
 Frame = -3

Query  22       IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
                I HD V+PF QP+P T ++K AVKFKP L +  GCHPYPAV   G  SGGLK SGP DG 
Sbjct  1544934  IDHDTVQPFAQPEPTTDAEKAAVKFKPSLAVKYGCHPYPAVNAGGDTSGGLKGSGPADGX  1544755

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF----FGHRHNWEYVVV  137
                                                     P D         G RH+W  +VV
Sbjct  1544754  XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXLVFPKDMQNLGIIKKGVRHDWVNLVV  1544578

Query  138      WIDNPGLENATVLGVSMSAS-IGYS-KQAPTDVKYVDGTSVKVAYYYNHLLG-NTALQLT  194
                W+DNP + N T+L  S S S  GY   + P     +DG + KV Y  N     +T  Q  
Sbjct  1544577  WLDNPAIANPTILATSASTSGTGYVINKPPKRSDIIDGITAKVRYDENDRDRWHTIFQFH  1544398

Query  195      EDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEE  243
                E  GE+QDLIQW QL+  AR +L +TD     FG     +P  D  FE+
Sbjct  1544397  E-VGEYQDLIQWTQLTDAARKALENTD-----FGDFA-NVPFNDAYFEK  1544272

>PHPA:scaffold_110 NW_008649096.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.110, whole genome 
shotgun sequence
Length=116850

 Score = 75.9 bits (185),  Expect(3) = 6e-32, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -1

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPY  59
              MN RA+  A  ++L V     + HD++ PF QP+P+  S+K A+KFKP L   +  C  +
Sbjct  79641  MNIRAIAAAVFSALVVCATANVDHDKIEPFLQPEPM--SEKAAIKFKPNLSTSEIVCVSF  79468

Query  60     PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAI  104
              PAV   G ++GGLK +   +  C  +  GSQ+Y RS W  D+WAI
Sbjct  79467  PAVNAAGEVTGGLKATN-DNSACKYALKGSQVYERSGWYKDLWAI  79336

 Score = 54.7 bits (130),  Expect(3) = 6e-32, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = -2

Query  179    AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKD  238
              +++Y+  LG   + L+   GEFQDLI W+QL+ +AR +LN    D T F  A  ++P+ D
Sbjct  79136  SFHYHITLGTPYMSLSGVGGEFQDLIMWEQLTDIARMALN----DSTNFENA--EVPISD  78975

Query  239    GVFEELLDKTWPF  251
                +E+ LDK WP 
Sbjct  78974  DHYEDHLDKAWPL  78936

 Score = 50.4 bits (119),  Expect(3) = 6e-32, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (56%), Gaps = 8/62 (13%)
 Frame = -3

Query  106    YAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-IGYSKQA  164
              + WYFPK   AT P         RH+W+ V++WIDNP LE   ++GVS S S   Y K+ 
Sbjct  79336  HTWYFPKVFWATCP-------KRRHDWKNVILWIDNPDLETPKIIGVSTSKSDTKYHKET  79178

Query  165    PT  166
               T
Sbjct  79177  IT  79172

>PHKE:scaffold_564 scf_22126_564.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_564.1:1:18646:1 
REF
Length=18646

 Score = 127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 127/283 (45%), Gaps = 76/283 (27%)
 Frame = +2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWS-----  75
             I  D+V PFP+  P T      +KFKPQ+ + D  C+ YPAV  DG+ SGG  +S     
Sbjct  332   IDFDEVEPFPETKPTTDEYAVGLKFKPQIYVPDFSCYTYPAVDADGNTSGGSPFSFLRSK  511

Query  76    ------GPQ----------------------------DG-------------ECTGSRLG  88
                   G Q                            DG             +C GS  G
Sbjct  512   CQGSEYGSQVYGRTAVYKDTWAXXXTWSCYPYPAVDADGNTSGGSPHSLLGSKCQGSEYG  691

Query  89    SQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENAT  148
             SQ+Y R+A   D WAIMYAWYFP+                RHNWE+++VW+D    +NAT
Sbjct  692   SQVYGRTAVYKDTWAIMYAWYFPRTGVL------------RHNWEHIIVWLDG-SPKNAT  832

Query  149   VLGVSMSASIG-YSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWD  207
                +S   S G Y   AP      DG S+KV Y   ++ G   L+ T+  G FQ L+ W+
Sbjct  833   FSALSTPRSFGFYRTYAPPSSNKFDGDSIKVRYM--NVNGARYLKPTQKIGAFQGLVMWE  1006

Query  208   QLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              L+  AR +L     + + FG+A  K+P  DG F   L + +P
Sbjct  1007  DLTDKARAAL-----ETSAFGIA--KVPFIDGKFLSNLREAYP  1114

>PHPA:scaffold_47 NW_008649033.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.47, whole genome shotgun 
sequence
Length=490393

 Score = 127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 115/228 (50%), Gaps = 12/228 (5%)
 Frame = +3

Query  24      HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECT  83
               H   RP P PD    S  T+ +     +       Y          GGL +SG  +G+C 
Sbjct  280626  HQDDRP*PSPD--LQSAGTSQQLGENCRQVQATAAYLGRMSSVRCCGGLAFSGRANGDCN  280799

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
                  +G Q+Y+RS W  D WAI+YAWYFPKG    +        GHRH W + +VW D+P 
Sbjct  280800  YPDVGGQVYSRSNWYKDKWAIVYAWYFPKGAEFVLN----HVKGHRHVWSHAIVWTDSPN  280967

Query  144     LENATVLGVSMSASIGYSKQAPTDVKYVDG-TSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                + + +LGVS+S   GY K+ P   K ++G  +VK+  Y ++ +GN +L  T   G+   
Sbjct  280968  PDASVILGVSLSIPTGYEKEVPPKAK*IEGEETVKLDSYVDYWVGNQSLSFTRKWGK---  281138

Query  203     LIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                 + +QL+  AR SL   D+ Q       + MP KDGVF   L +T+P
Sbjct  281139  -TKREQLTDEARDSLGMFDF-QPESSQVNVAMPQKDGVFLSNLRETYP  281276

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAV  62
               I HDQV+ F QP+P + S+KTAVKFKP L I  GCHPY AV
Sbjct  280636  IDHDQVQTFSQPEPASNSEKTAVKFKPLLHISDGCHPYAAV  280758

>HYAP:scaffold_89 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_89:1:275795:1 
REF
Length=275795

 Score = 127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 115/221 (52%), Gaps = 19/221 (9%)
 Frame = +2

Query  24      HDQVRPFPQPDPVTVSQKT--AVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               HDQ++P+ + +    S  T  A +++P L I  GCHPY AV  +G  SGGLK +G  D  
Sbjct  163829  HDQIQPYAEVEEKNASDSTRAAARYQPSLHISHGCHPYAAVDAEGRTSGGLKATGDDDSG  164008

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRF-FGHRHNWEYVVVWID  140
               C     G+Q+YAR   V   + I+YAW+FPK        D +R   GHR++WE+  VW++
Sbjct  164009  CRQPYQGAQVYARVGKVCGQFGIVYAWFFPK--------DSVRHGIGHRYDWEWATVWLN  164164

Query  141     NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
               +   + + ++GV+   S    +      + + G +VK+ Y  +       + L+ + GEF
Sbjct  164165  SLDDDESKIMGVTTIGSGRPKRTNKLKPENLVGDTVKLDYRDHG--DRHYIALSGNDGEF  164338

Query  201     QDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
               Q LI W Q+   AR +LN   W++         MPL D VF
Sbjct  164339  QPLIMWKQMGKKARCALNTVGWNKDKL------MPLADSVF  164443

 Score = 113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 91/165 (55%), Gaps = 20/165 (12%)
 Frame = -2

Query  88      GSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENA  147
               G Q+YARS+W  D W IMYAWY PK              GHRH+WEYVV+W  N    NA
Sbjct  251023  GDQVYARSSWFKDSWGIMYAWYAPKDGK-----------GHRHDWEYVVLWTGNTEDPNA  250877

Query  148     TVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLT-EDTGEFQDLIQW  206
                +L V+  A+ G  K      +Y  G+S+K+   Y+ +    A+ LT ++ G+ Q LI W
Sbjct  250876  ELLAVTTIAAHGRIKTIGPGDEYRVGSSIKLE--YDFVGERHAIVLT*KEGGKLQKLITW  250703

Query  207     DQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               DQL  + R +LN+  W++         MPL D VFE+ L++ WPF
Sbjct  250702  DQLPDIGRCALNNATWNEDKV------MPLSDAVFEKYLEEAWPF  250586

 Score = 89.4 bits (220),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 91/178 (51%), Gaps = 18/178 (10%)
 Frame = +3

Query  76      GPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYV  135
               G   G+C GSR GSQ+YARS+WV D WAI++A+YFPK    ++P + + +    H WE+ 
Sbjct  238422  GIPHGDCKGSRHGSQVYARSSWVGDKWAIVFAYYFPK----SMPGESVCYL---HAWEFA  238580

Query  136     VVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTE  195
               V+W++        +  V  S   GY K    +   +DG  VK+ Y+ N    +   +LTE
Sbjct  238581  VIWVNRSEEPEKILAVVVYSDGFGYVKHTLIEASEMDGERVKLRYFQN-AGADLNSELTE  238757

Query  196     DTGEFQDLIQWDQLSSLARYSLNHTD--WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                 G+       DQ+ ++ARY  +H    +    +G      PL D  F  LL+  WPF
Sbjct  238758  GGGKNPTP---DQVGAVARYG-SHCA**YQVDRWG*C----PLTDVAFGPLLEAAWPF  238907

 Score = 47.4 bits (111),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
               I H++V+ F +  P+T S+K  V+  P + I  G   YPAV + G  SGGLK SG
Sbjct  238261  IPHNEVKGFAELVPITPSEKADVRLNPNIIITYGSQAYPAVNEFGQTSGGLKPSG  238425

>HYAP:scaffold_10 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_10:1:867112:1 
REF
Length=867112

 Score = 125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 115/234 (49%), Gaps = 24/234 (10%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+ F Q DP T ++K AV+F P + I  GC+PY  V + G  S   K  G  +G 
Sbjct  546131  INHDEVKAFSQLDPETEAEKAAVRFNPTIVITRGCYPYAMVNEVGQTSKVFKPLGSHNGH  545952

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
               C GS  GSQ+YARS    D  AI YA+Y PK      P   +     RH W   VV I+N
Sbjct  545951  CKGSGHGSQVYARSTKHADKLAIAYAYYSPKAH----PHQRVWI---RHVWNIAVVRINN  545793

Query  142     P-GLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLT---EDT  197
                 GLE   V+  + +  IG+ K+   +   + G SVK        LG++ L L     D 
Sbjct  545792  SEGLEKVVVV-TTTNPFIGFVKKTTFEPYEMAG*SVKFH------LGDSDLYLRVTGMDG  545634

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               G    LI W+QL   A  +LN   WD         KMPL D VFE L+   WPF
Sbjct  545633  GTALPLITWEQLPGKAHCALNLITWDD------WQKMPLSDDVFETLITGVWPF  545490

>PYIW:scaffold_2677 piw_scaffold_2677 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2677:1:4419:1 
REF
Length=4419

 Score = 123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 92/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  84    GSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPG  143
             GS  G+Q+Y R A    V+A+MY+WYFPK   +T         GHRH+WE+VVVWIDNP 
Sbjct  2814  GSGWGTQVYGRVAAYKGVYALMYSWYFPKDSPST-------LLGHRHDWEHVVVWIDNPN  2656

Query  144   LENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDL  203
               +  +L VS SA  GY+K AP     VDG S KV  Y + ++ N AL  T   GE Q L
Sbjct  2655  AVSPKILAVSPSAHSGYNKYAPPKSGTVDGNSAKVE-YKSIVVINHALDSTTTGGEQQPL  2479

Query  204   IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVF  241
             I WDQL+  AR  L +TD     FG A   +P+KDG F
Sbjct  2478  IMWDQLTDAARSGLENTD-----FGSA--NVPMKDGNF  2386

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG  55
             I HD V PFPQP PVT+ Q  A+KFKPQ+ I  G
Sbjct  4318  IAHDAVVPFPQPAPVTLEQTVALKFKPQIHIANG  4419

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -2

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCH  57
             I HD V PF QP P T+ QK  V FKPQ+ I  GCH
Sbjct  3167  IAHDAVVPFAQPAPSTMEQKLGVTFKPQIHIANGCH  3060

>PHSO:scaffold_14
Length=1806347

 Score = 123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 106/228 (46%), Gaps = 38/228 (17%)
 Frame = +2

Query  40      QKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWV  98
               ++TA+ FK  L+ + G C PYPAV   G  S GL++       C GS LGSQ+Y R+AW 
Sbjct  922403  RETAINFKTSLEFEDGTCRPYPAVNAAGDTSRGLEYGDTGVESCQGSSLGSQVYGRAAWH  922582

Query  99      NDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI  158
               ND+WAIMY WYFPK    T           RH W   VVW+DNP +E   ++ VS     
Sbjct  922583  NDLWAIMYVWYFPKDSGET---------DSRHKWTAAVVWLDNPAVEKPKIVAVSTIGRG  922735

Query  159     GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNT-------------ALQLTEDT--GEFQDL  203
               G  + A +       T     Y +   L  T              ++LT D   GEFQDL
Sbjct  922736  GVYEVATSGSDEYRNTEC---YTFEDKLNGTHPMLLFTSDYTSSGVELTSDGKWGEFQDL  922906

Query  204     IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               I W+Q++  AR  ++           A    P+ D  F+  L+   P+
Sbjct  922907  IMWEQMTEEAREGISE----------AHFAAPIIDEAFKPNLESASPY  923020

 Score = 114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQVRPF Q DP+TVS+K A+KF PQL +  GCHPYPAVQ+DG++SGGLKWSG QDGE
Sbjct  187129  IPHDQVRPFAQRDPITVSEKAAIKFNPQLTVSEGCHPYPAVQEDGALSGGLKWSGKQDGE  186950

Query  82      CTGSRLG  88
               C GS LG
Sbjct  186949  CKGSALG  186929

 Score = 79.0 bits (193),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = -2

Query  169     KYVDGTSVKVAYYYNHL-LGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLF  227
               +Y++GTS+KVAYYY       TAL+ TE+ GE Q L+ W+QL  +AR +LN+T W    F
Sbjct  175261  QYLNGTSLKVAYYYASFRFHETALKFTEEAGELQALVTWEQLPEVARGALNNTGWKGDTF  175082

Query  228     GLAGLKMPLKDGVFEELLDKTWPF  251
                   + +PL D  F + L K WPF
Sbjct  175081  SCISVTVPLIDSAFTKHLKKAWPF  175010

 Score = 55.1 bits (131),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 34/64 (53%), Gaps = 4/64 (6%)
 Frame = -3

Query  88      GSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENA  147
               GSQ+Y+RS W NDVWAIMY WYFPKG  +    D      HRH           PG+E +
Sbjct  175497  GSQVYSRSTWYNDVWAIMYTWYFPKGSES----DRGIGISHRHKLGIRHCLDRQPGVEQS  175330

Query  148     TVLG  151
                  G
Sbjct  175329  DYQG  175318

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 91/175 (52%), Gaps = 19/175 (11%)
 Frame = +1

Query  67      SMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF  126
               S  GGL+WSG  DGEC  S  GSQ+Y+R+   +  +AIM+AW FPKG+A           
Sbjct  632716  SAGGGLEWSGDDDGECKRSPWGSQVYSRTHSYDRKYAIMHAWCFPKGKARA----HKHHD  632883

Query  127     GHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDV----KYVDGTSVKVAYYY  182
               GHRH W + +VW+  P    +T++GV+ S   G S + P+      ++ + T  ++    
Sbjct  632884  GHRHAWGFAIVWLSRPSANGSTIVGVTTSIG-GDSPRGPSRTGACRRFKNSTPTQLTGEP  633060

Query  183     NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLK  237
               +        +      +FQDLIQW+QL+  AR +  + D      G   +KMPLK
Sbjct  633061  SR-----GFESHRKLAKFQDLIQWEQLTDAAREADFNID-----GGKPAVKMPLK  633195

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = -1

Query  131     NWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYV  171
               NWEYV+ WIDNP L N T+  V++S   GY  QAP   + V
Sbjct  175379  NWEYVIAWIDNPELNNPTIKAVTVSEKTGYKSQAPPVARSV  175257

>PHIF:NW_003303719.1 Phytophthora infestans T30-4 supercont1.40 
genomic scaffold, whole genome shotgun sequence
Length=1445775

 Score = 122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V+PFP+P+PVT+S+K  VKFKPQ++I  GC P+PAV + G  SGGL  SG   G 
Sbjct  332157  IDHDKVKPFPEPEPVTISEKAGVKFKPQIQIRTGCVPHPAVSEFGETSGGL*TSGSPRGG  331978

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYF  110
               C GS  GSQ+Y RSAW+N VWAIMY+WYF
Sbjct  331977  CRGSTYGSQVYGRSAWLNGVWAIMYSWYF  331891

>PHRA:scaffold_512
Length=11141

 Score = 121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -1

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
            I HD+V+PFPQPDPVT+++K+ VKFKP+L ID   GC  YPAV   G  SGGLK +    
Sbjct  311  IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  132

Query  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG  113
              CTG  LGSQ+Y R+ W NDVWAIMYAWYFPKG
Sbjct  131  A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKG  33

>PHKE:scaffold_993 scf_22126_993.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_993.1:1:4606:1 
REF
Length=4606

 Score = 121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 89/162 (55%), Gaps = 19/162 (12%)
 Frame = +3

Query  91    IYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVL  150
             +YARS W +D WAIMYAW+ PKG +  +        GH   W Y +VWIDNP L N+ +L
Sbjct  2820  VYARSTWCSDYWAIMYAWFSPKGLSYGI--------GHDTEW*YAIVWIDNPDLANSAIL  2975

Query  151   GVSMS-ASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQL  209
             G+++        +  P D +Y DGTSVK+ Y Y  + G T L+L +D G +QDLI WDQL
Sbjct  2976  GLTVQPEEWSVKRYTPMDPEYTDGTSVKINYDYKFIAGETYLKLMDDKGGYQDLITWDQL  3155

Query  210   SSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               + + +LN T              PL D ++ + L   WPF
Sbjct  3156  PEVVKPALNSTK----------FYSPLADEIYVKALFDGWPF  3251

>PHSO:scaffold_21
Length=320622

 Score = 121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 95/157 (61%), Gaps = 8/157 (5%)
 Frame = -3

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYP  60
               M+FR + V   A+        I HD+V+P  QP+PVT+++K  VKFKP++ I  GC  YP
Sbjct  294622  MHFRMLVVVFTATFLAVDGISIDHDKVKPHAQPEPVTIAEKAGVKFKPRMSIREGCASYP  294443

Query  61      AVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPP  120
               AV + G  SGGLK SG     C GS  GSQ+Y R+AW ND++AI+YAWYFPKG +   P 
Sbjct  294442  AVNEAGETSGGLKGSG-GSPGCEGSPFGSQVYGRAAWHNDLYAIVYAWYFPKGFSGPSP-  294269

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS  157
                       RHNW   VV +DNP +    ++G+ +S S
Sbjct  294268  ------SRRHNWSSAVVGLDNPDVATPKIMGLLLSNS  294176

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 7/83 (8%)
 Frame = +1

Query  87      LGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLEN  146
                GSQ+Y R+AW ND++AI+YAWYFPKG +   P          HNW   VV +DNP +  
Sbjct  276013  FGSQVYGRAAWHNDLYAIVYAWYFPKGFSGPSP-------SRPHNWSSAVVGLDNPDVAT  276171

Query  147     ATVLGVSMSASIGYSKQAPTDVK  169
                 ++G+ +S S   +   P++ K
Sbjct  276172  PKIMGLLLSNSANSNVGEPSNSK  276240

>PHCA:scaffold_11 PHYCAscaffold_11
Length=1076090

 Score = 120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 77/135 (57%), Gaps = 15/135 (11%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HDQV PF +P PVT+SQK  VKFKPQ  I   CH YPAV + G     L  +G   G+
Sbjct  503884  ISHDQVAPFLKPVPVTISQKAGVKFKPQFHISNVCHTYPAVNEAGDTGADLSNTGAPSGK  503705

Query  82      CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKG----RAATVPPDFLRFFGHRHNWEYVVV  137
                 GS LGSQIY R+ W NDVW IM    FP+G    R+   PP            E+ V+
Sbjct  503704  SKGSGLGSQIYGRAGWHNDVWVIMVRLVFPQGHGVLRSRPPPPR-----------EHAVI  503558

Query  138     WIDNPGLENATVLGV  152
               WI+NP + N T+LGV
Sbjct  503557  WINNPDVPNPTILGV  503513

>HYAP:scaffold_63 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_63:1:358873:1 
REF
Length=358873

 Score = 116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 112/230 (49%), Gaps = 22/230 (10%)
 Frame = -1

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
              +GHD+V  F Q DPVT ++K A++F P + +  GC PYPAV K G ++ GLK +G  +  
Sbjct  72016  MGHDKVDAFLQQDPVTEAEKAAIQFNPIISVAYGCWPYPAVNKLGQLNAGLKPTGSHNSY  71837

Query  82     CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
              C G   GSQ+Y RS  +   WAIMYA+  PK          +   G R  W Y ++W+  
Sbjct  71836  CKGCGCGSQVYVRSTELCGKWAIMYAY*SPKQ---------VERMGRRRGWNYAIIWLAT  71684

Query  142    PGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQ  201
              P    ++   +  +A+  Y  +     + V G S+K+ +     L    L   E  G   
Sbjct  71683  P----SSTEILWATATYNYEGRLIKPTEKV-GDSIKLVFVECERL--IYLTFGERKGSHT  71525

Query  202    -DLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
                LI  +Q   +AR +LN +DW          KMPL D VF + L K  P
Sbjct  71524  LPLIM*EQHPEVARCALNKSDW-----AYRDEKMPLSDHVFLKHLQKHLP  71390

>PHCA:scaffold_17 PHYCAscaffold_17
Length=985188

 Score = 115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 113/216 (52%), Gaps = 10/216 (5%)
 Frame = +1

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPY  59
               MN   + V   A+LA   +  + HD++ PF QP+PVTVS+K A+KFKPQL      C P+
Sbjct  205720  MNLHLLVVTVFATLAAGASSTVDHDKIEPFRQPEPVTVSEKAAIKFKPQLYTQTNVCVPF  205899

Query  60      PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
               PAV   G ++GGLK +   D  C  +  G+Q+Y R+ W  D+WAIMYAWYFP     T  
Sbjct  205900  PAVNAAGEVTGGLKGTNGNDA-CKYAPKGAQVYGRAGWYKDLWAIMYAWYFPNTSCTTPV  206076

Query  120     PDFLRFFGHRHNWEYVVV-WIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKV  178
               P  + ++     W + +   +++P  +  +      S+S G  K  P       G+ + V
Sbjct  206077  PSGISYW----TWTWRLQ*SLESPRQDCQSTQ--RHSSSRGGLKGIPAS*TLFVGSQLAV  206238

Query  179     -AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLA  213
                + YY        L L    G++QDLI W+QL+  A
Sbjct  206239  TSRYYRTYTVAGDLFLASRDGDYQDLIMWEQLTDAA  206346

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  121     DFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS  157
               ++L F  +RH+W+ VVVWIDNP LE   ++GV+MS S
Sbjct  206206  NWLGFPSNRHDWKSVVVWIDNPALETPKIIGVAMSKS  206096

>PLHA:NW_020189786.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2881, whole genome shotgun sequence
Length=924714

 Score = 114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 117/237 (49%), Gaps = 28/237 (12%)
 Frame = +3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               I HD+++P  + + V V++K A ++KP L +    C  YPAV  DG+ SGGLK +   +G
Sbjct  801756  IDHDKIKPIEEHEAVNVTEKLAFRYKPSLAVTIILCAGYPAVDSDGNFSGGLKPTNGNNG  801935

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
                CT   LGSQ+Y R     D+WAIMY WYFPK   +  P         RH+WE VV+WID
Sbjct  801936  -CTNPPLGSQVYVRIRKYKDLWAIMYVWYFPKRFTSLWP-------KARHDWEQVVIWID  802091

Query  141     NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEF  200
                   E   V  VS S    YSK  P   K VD     +        G  +L +T    ++
Sbjct  802092  E-LTETPNVKLVSASYGDDYSKFVPK--KSVDSGPTFLLRV--ETFGPPSLTITFFPEDY  802256

Query  201     QDL--------IQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                 L        I W+QL   AR +L+    D   FG A  K PL+D   ++ L+K +
Sbjct  802257  NLLDYSSPYYIILWEQLPEPARAALS----DDNNFGDA--KFPLRDDQIDQHLEKAY  802409

>PYAR:scaffold_5083 par_scaffold_5083 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_5083:1:1788:1 
REF
Length=1788

 Score = 112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 100/183 (55%), Gaps = 19/183 (10%)
 Frame = -2

Query  69    SGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGH  128
             S GL+ +G  DG C+    G Q+Y R+A   D +AIMY+WY PK   ++         GH
Sbjct  1679  SSGLRQTGAPDGSCSDKSKG-QVYGRTANYRDAFAIMYSWYMPKDSPSSS-------LGH  1524

Query  129   RHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVD--GTSVKVAYYYNHLL  186
             RH+WE VVVW+D+    +A ++ V+ SA   Y K  P + KYV   G S K+  Y +   
Sbjct  1523  RHDWENVVVWLDSDNPASARIIAVAASAHGDYRKSYPINSKYVSDGGVSAKIG-YRSIWP  1347

Query  187   GNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLD  246
              N AL+LT  +G  Q LI WDQL+  AR +L +TD     FG A   +P + G FE  L 
Sbjct  1346  ANHALELTTSSGSMQPLILWDQLTQAARDALENTD-----FGSA--HVPFRSG-FENYLA  1191

Query  247   KTW  249
             + +
Sbjct  1190  EAY  1182

>PHRA:scaffold_214
Length=39087

 Score = 112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 86/159 (54%), Gaps = 15/159 (9%)
 Frame = +1

Query  93     ARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGV  152
               RS W N VWAIMY+WYFPK   +          GHRH+WE+ V++IDNP +    +L  
Sbjct  35584  GRSTWHNQVWAIMYSWYFPKDSPSPG-------MGHRHDWEHAVMFIDNPDVPEPKILAC  35742

Query  153    SMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSL  212
              S+S+  GY K  P     +DGTS+KV Y ++  L N  L  T D G FQDLI W Q++  
Sbjct  35743  SVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPL-NHDLDTTGDGGIFQDLIMWGQMTDN  35919

Query  213    ARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              AR +LN  +     FG A    P+ D  F   +   WPF
Sbjct  35920  ARRALNEAN-----FGSA--NTPMNDWNFPNKVQAAWPF  36015

>PHKE:scaffold_183 scf_22126_183.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_183.1_contig_1:1:67272:1 
REF
Length=67272

 Score = 80.1 bits (196),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 50/89 (56%), Gaps = 11/89 (12%)
 Frame = +1

Query  49     QLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAW  108
              QL++     P PAV   G+ SGGLK +G     C GS +GSQ+Y RS W N VWAIMY+ 
Sbjct  55150  QLRLS----PLPAVDVAGNTSGGLKPTGSASAGCKGSDVGSQVYRRSTWYNGVWAIMYSR  55317

Query  109    YFPKGRAATVPPDFLRFFGHRHNWEYVVV  137
              YFP     T        FGHRHNW  ++ 
Sbjct  55318  YFPNDCPVTC-------FGHRHNWSTLLC  55383

 Score = 43.5 bits (101),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  133    EYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKV  178
              E++ VWIDNP      +L V+ SA  GYS  AP +   ++GTS KV
Sbjct  55368  EHITVWIDNPTNLPEKILAVTPSAHRGYSTYAPLNADMLNGTSFKV  55505

 Score = 39.3 bits (90),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (51%), Gaps = 7/61 (11%)
 Frame = +2

Query  191    LQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              L+ T  +GEFQ LI W+ L+   +Y+LN+TD            +P+ DG F   L   +P
Sbjct  55547  LEGTTTSGEFQALIMWEDLTDATQYALNNTDH-------GSANVPMSDGHFLPKLQNAYP  55705

Query  251    F  251
               
Sbjct  55706  L  55708

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
              I HDQV PFP   P +++      ++P   I+ GCHPYPAV   GS  GGLK +G
Sbjct  62600  IDHDQVAPFPMS*PTSITNVAEGIYQPTHFINNGCHPYPAVDAAGSTDGGLKPTG  62764

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPY  59
              + HDQV PF   DP +++    V ++PQ+ I+ GCHPY
Sbjct  55058  VNHDQVAPFSASDPTSITNVAGVIYQPQIFINYGCHPY  55171

>PHIF:NW_003303717.1 Phytophthora infestans T30-4 supercont1.42 
genomic scaffold, whole genome shotgun sequence
Length=1446276

 Score = 110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  123     LRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYY  182
               L F GH   WEY +VW D P +++ T+LGVS+SA++G++K++P   KY+DGTS+ VAYY 
Sbjct  864428  LCFLGHIDGWEYAIVWQDRPNVDSVTILGVSLSAAVGWAKESPPPGKYLDGTSLNVAYYN  864607

Query  183     NHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSL  217
               NH+  NT ++ TE+ GEFQDLI W QL  LA  SL
Sbjct  864608  NHIYDNTTVKYTEEAGEFQDLITWSQLKDLALGSL  864712

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  49      QLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDV  101
               Q+KI+  CHPYPAVQKDG++S GL  SGP+DGEC G+ LGS++YAR+ W  DV
Sbjct  859777  QIKIEDDCHPYPAVQKDGAISSGLS*SGPRDGECKGTPLGSKVYARTTWGKDV  859935

>PHRA:scaffold_2309
Length=3569

 Score = 109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 64/96 (67%), Gaps = 8/96 (8%)
 Frame = -1

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QP+PVT S+K AV+FKP L+ID GCHPYPAV   G  S GLK +GP  G+
Sbjct  596  IDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIDTGCHPYPAVNAAGETSAGLKGTGPSSGD  417

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAAT  117
            C GS LGSQ+YARS W        Y  +  KGR A 
Sbjct  416  CKGSGLGSQVYARSVW--------YTEFPGKGRIAC  333

>PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 
genomic scaffold, whole genome shotgun sequence
Length=5928454

 Score = 75.1 bits (183),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = +1

Query  82       CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG     P         RH+W+ VVV IDN
Sbjct  5833015  CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKGFWRDFP-------TRRHDWKNVVVLIDN  5833173

Query  142      PGLENATVLGVSMS  155
                P  E   ++GVSMS
Sbjct  5833174  PDFETPKIVGVSMS  5833215

 Score = 63.2 bits (152),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  1        MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA-GCHPY  59
                MN R +    +A+L    +  + H+++ PFPQP+P T+S+K A+KFKPQL      C  Y
Sbjct  5832771  MNIRTLTATLLAALVACASATVDHNKIEPFPQPEPATISKKAAIKFKPQLYTSKIVCVSY  5832950

Query  60       PAVQKDGSMSGGLK  73
                PAV   G ++GGLK
Sbjct  5832951  PAVNAAGEVTGGLK  5832992

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = +1

Query  159      GYSKQAPT-DVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSL  217
                GY  + P  D  Y+ G++  + +     LG+  +   +  GE+QDLI W+QL+  AR +L
Sbjct  5843605  GYRMEGPRFDRTYIYGSNTSLRFQCQTDLGSPYINFADWDGEYQDLIMWEQLTDAARVAL  5843784

Query  218      NHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                N    D   FG A  ++P  D  +E+ LDK WP 
Sbjct  5843785  N----DSNNFGRA--EVPFSDEHYEDHLDKAWPL  5843868

 Score = 40.0 bits (92),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (52%), Gaps = 7/62 (11%)
 Frame = +3

Query  190      ALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                AL  +   G++ DLI W+QL+  AR +LN  D+ +        K+P  D  F+  L   W
Sbjct  5893071  ALSNSYSDGQYPDLIMWEQLTDEARAALNTADFGEP-------KVPFNDANFQSTLRLAW  5893229

Query  250      PF  251
                PF
Sbjct  5893230  PF  5893235

>PHRA:scaffold_1828
Length=3762

 Score = 108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD+V+PF QPDPVTVS+K AV+FKP L+ID+GCHPYPAV   G  S GLK +GP  G+
Sbjct  444  IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  623

Query  82   CTGSRLGSQIYARS  95
            C GS LGSQ+Y ++
Sbjct  624  CKGSGLGSQVYRKT  665

 Score = 105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 87/145 (60%), Gaps = 15/145 (10%)
 Frame = +3

Query  82    CTGSRLGSQI-YARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
             C G  L   + YAR+ W +D+WAIMYAWYFPK +     P F +  G RH+W  VVVW+D
Sbjct  1341  CKGCLLIRVLRYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVWLD  1499

Query  141   NPGLENATVLGVSMSASI-GYSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLTED  196
             NP LE  T++GVS S+ +  YSK  P     ++GT+  + Y     NH  G  ++  T  
Sbjct  1500  NPALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTTWK  1673

Query  197   T-GEFQDLIQWDQLSSLARYSLNHT  220
             T GEFQDLI W+QL+  AR +LN T
Sbjct  1674  TGGEFQDLIMWEQLTDEARAALNDT  1748

>PHIF:NW_003305543.1 Phytophthora infestans T30-4 supercont1.3127 
genomic scaffold, whole genome shotgun sequence
Length=2643

 Score = 107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = -3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLK-WSGPQD  79
             + HD+V PFPQP+PVT+S+K A+KFKPQL I  G C  YPAV   G + GGL  W    D
Sbjct  1606  VDHDKVEPFPQPEPVTISEKAAIKFKPQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  1427

Query  80    GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPK  112
               C  + LGSQ+Y R+ W  D WAIMYAWYFPK
Sbjct  1426  A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPK  1331

>PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.8, whole genome shotgun 
sequence
Length=1889443

 Score = 107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 96/182 (53%), Gaps = 26/182 (14%)
 Frame = -2

Query  80      GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139
                 C  +  GSQ+Y R+ W  D+WAIMY WYFPKG        ++ F   RH+W+ VVVWI
Sbjct  860790  AACKYAPKGSQVYGRARWHKDLWAIMYTWYFPKGF-------WMGFPTRRHDWKSVVVWI  860632

Query  140     DNPGLENATVLGVSMSAS-IGYSKQA---PTD--VKYVDGTSVKVAYYYNHLLGNTAL--  191
               DNP LE   ++GVSMS S   Y+K+    P++  V  ++G+     Y       NT+   
Sbjct  860631  DNPSLEEPKIVGVSMSESDTKYNKETRIWPSNFVVTEMEGSRSHRTYING---SNTSFRF  860461

Query  192     --QLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
                 Q+       QDLI W+QL+  AR +LN    D   FG A  ++P  D  +E+ LD  W
Sbjct  860460  QNQMPMSLKLAQDLITWEQLTDAARVALN----DNAKFGTA--EVPFSDTHYEDHLDNAW  860299

Query  250     PF  251
               P 
Sbjct  860298  PL  860293

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQL---KI--DAGCHPYPAVQKDGSMSGGLKWSG  76
               + HD++ PFPQP+ VT+S+K A+KFKPQL   KI  +  C PYPAV   G ++GGLK + 
Sbjct  861231  VDHDKIEPFPQPEQVTISEKAAIKFKPQLGSTKIVSEKVCVPYPAVNAAGEVTGGLKETN  861052

>PHIF:NW_003303513.1 Phytophthora infestans T30-4 supercont1.246 
genomic scaffold, whole genome shotgun sequence
Length=90049

 Score = 107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 95/174 (55%), Gaps = 16/174 (9%)
 Frame = -2

Query  44     VKFKPQLKI-DAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVW  102
              +KFKPQL   D  C PYPA    G+ +GGLK +   D  C  + L  Q+Y R+ W  D W
Sbjct  55617  IKFKPQLITPDIVCLPYPAGNAAGNATGGLKGTNGNDA-CEDAPLVHQVYGRARWYQDQW  55441

Query  103    AIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMS-ASIGYS  161
              AIMYAWYFPK         F+ F    H+W+ VVVWI N  +E   ++GVSMS A   + 
Sbjct  55440  AIMYAWYFPKSV-------FMNFPTRLHDWKSVVVWIYNSDVEAPQIIGVSMSKADT*FF  55282

Query  162    KQAPTDVKYVDG-----TSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLS  210
              K+      Y  G     T+++  Y+ + +L  ++L  ++  G  QDLI W++L+
Sbjct  55281  KEVNMQPAYFAGSQGSSTTLRFKYHVD-VLAPSSLYFSQLYGNSQDLIVWERLA  55123

>PHKE:scaffold_753 scf_22126_753.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_753.1_contig_1:1:9573:1 
REF
Length=9573

 Score = 106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = -3

Query  44    VKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWA  103
             ++FKP L + +GCHPYPAV   G +SGGLK SG   GE   S LGSQIY R+AW +D+W 
Sbjct  8554  LRFKPSLTVYSGCHPYPAVNVAGEISGGLKPSGLASGEYKKSELGSQIYGRAAWYSDLWV  8375

Query  104   IMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM  154
             IM +WYFPK        D     G RH+W+ +VVWIDN      T+  +S+
Sbjct  8374  IMCSWYFPKD-------DSPARSGRRHDWKNIVVWIDNADANPPTIKVISV  8243

>PYAR:scaffold_1934 par_scaffold_1934 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1934:1:6534:1 
REF
Length=6534

 Score = 106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 102/201 (51%), Gaps = 27/201 (13%)
 Frame = -2

Query  55    GCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGR  114
             GC PYPAV   G+ SGGL  +G     C  +   +Q+Y+RS   N  +AIMYAWY PK  
Sbjct  5300  GCQPYPAVDSSGNTSGGLNPTGSPSAGCADTSK-AQVYSRSGTYNGAYAIMYAWYMPKDS  5124

Query  115   AATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVD--  172
              +++        GHRH WE  VVW+D+     A ++  + SA   Y K  P +  Y++  
Sbjct  5123  PSSL-------LGHRHEWENAVVWLDSTNPATAKIVAAAASAHGNYKKSYPINTNYLENS  4965

Query  173   GTSVKVAYY----YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFG  228
             G S K+ Y      NH +G      T   G+ Q LIQW+QL+  AR +L  TD     FG
Sbjct  4964  GVSTKIDYKSTWPVNHEMG-----FTSTPGKTQPLIQWEQLTDAARTALETTD-----FG  4815

Query  229   LAGLKMPLKDGVFEELLDKTW  249
              A   +P K   F++ L K +
Sbjct  4814  SA--TVPFKSN-FQQNLAKAY  4761

>PHKE:scaffold_890 scf_22126_890.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_890.1_contig_1:1:6236:1 
REF
Length=6236

 Score = 105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP+P T S+K  +KFKPQL I  GC  YPAV   G ++GGL+ +G   G 
Sbjct  4305  IDHDKVQPFAQPEPTTNSEKAGIKFKPQLNIVRGCDSYPAVNDAGEITGGLRGTGYTSG-  4481

Query  82    CTGSRLGSQIYARSAWVNDVWAIMY  106
             C G RLGSQ+Y R+ W ND+WAIMY
Sbjct  4482  CEGPRLGSQVYGRATWHNDIWAIMY  4556

 Score = 40.4 bits (93),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (54%), Gaps = 7/54 (13%)
 Frame = -2

Query  198   GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
             G FQDLI W+QL+  AR +LN  D     FG A  K+      F + LD  WPF
Sbjct  6058  GGFQDLIMWEQLTDAARVALNTVD-----FGNA--KVMFNGANFADKLDNAWPF  5918

>PHIF:NW_003303706.1 Phytophthora infestans T30-4 supercont1.53 
genomic scaffold, whole genome shotgun sequence
Length=932874

 Score = 105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 132/270 (49%), Gaps = 33/270 (12%)
 Frame = -3

Query  1       MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLK-IDAGCHPY  59
               MN RA+    +ASL V  A VI HD+ +PF QP+ VT  +K A+KFKPQL  ++  C PY
Sbjct  349933  MNHRALVTLFIASLCVCAAAVIDHDKDQPF*QPERVTRLEKAAIKFKPQLSTLENVCVPY  349754

Query  60      PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119
               PAV   G ++GG      +  E T + +       +  +            P     T  
Sbjct  349753  PAVNAAGDVTGG---GSSELTETTRASIPPLPLRSTVGLGGTRTCG-----PYCTLGTFL  349598

Query  120     PDFLRFF-GHRHNWEYVVVWIDNPGLENATVLGVSMSAS---------------IGY-SK  162
                DF       RH+W+ VVVWIDNP LE   ++GVSMS S                G+ ++
Sbjct  349597  KDFCEMSPSRRHDWKSVVVWIDNPALETPKIVGVSMSKSDTKYNNEIKLWPASFAGFRTE  349418

Query  163     QAPTDVKYVDGTSVKVAYYYN-HLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
               +      YV G++  + + Y   + G+  L  +E  G +QDLI W+QL++ +R +LN   
Sbjct  349417  RRRFHHTYVYGSNTSLRFQYQITVTGSPFLSFSEWDGVYQDLIMWEQLTNTSRAALN---  349247

Query  222     WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
                ++  FG A  K+P  D  +E  L+  WP 
Sbjct  349246  -NEGNFGNA--KVPFSDEHYENHLEDAWPL  349166

>PHCA:scaffold_38 PHYCAscaffold_38
Length=550336

 Score = 103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 81/159 (51%), Gaps = 16/159 (10%)
 Frame = -2

Query  95      SAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSM  154
               + W ND WAIMYAWYFPKG        F+     R++W   VVWIDNP      +LG+S 
Sbjct  450135  AGWYNDKWAIMYAWYFPKGF-------FMGIASRRYDWASAVVWIDNPDFATPAILGLST  449977

Query  155     S-ASIGYSKQAPT-DVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSL  212
               S A   Y  +AP  D   +DG +  +    + + G   L  +  TG+ Q LI W+QL+  
Sbjct  449976  STADDEYQNKAPAPDFGILDGVTPLLYRSISEVAGQPMLDYSSRTGDAQPLIMWEQLTDA  449797

Query  213     ARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               AR +LN        F    + +P+ D  FEE L K WPF
Sbjct  449796  ARETLNT-------FDFGDVVVPVNDANFEEKLKKAWPF  449701

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = -1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               I HD+V P PQPDPVT+S+K AVKFKPQL I  GC  +PAV   G +SGGLK SG  +  
Sbjct  451549  IDHDKVEPIPQPDPVTISEKAAVKFKPQLNIADGCVSFPAVNGAGDVSGGLKGSG-GNSA  451373

Query  82      CTGSRLGSQIYARSA  96
               C  + LGSQ+Y R+ 
Sbjct  451372  CDSAPLGSQVYGRAG  451328

>PHCA:scaffold_77 PHYCAscaffold_77
Length=232015

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 74/137 (54%), Gaps = 12/137 (9%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDG  80
               + H +  PF QP+P T+S+K A+KFKP +    G C P  AV   G ++           
Sbjct  207229  VDHGKFEPFHQPEPATISEKAAIKFKPAMVSPLGFCVPLTAVNAAGEINSERIGVPIPPF  207408

Query  81      ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWID  140
               +C   + G Q+Y R+ W  D+WAIMY+WYFP             F    H+W+ VVVWID
Sbjct  207409  QC--EKKGGQVYGRAGWHKDLWAIMYSWYFPIAS---------DFQSRPHDWKNVVVWID  207555

Query  141     NPGLENATVLGVSMSAS  157
               NP LE   ++GV+MS S
Sbjct  207556  NPDLETPKIVGVAMSKS  207606

 Score = 37.0 bits (84),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 5/54 (9%)
 Frame = +1

Query  198     GEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               G +QDLI W+QL+  AR +LN++   +        ++P  D  F++ LD  WP 
Sbjct  209581  GGYQDLIMWEQLTEAARLALNNSKSFKR-----KAEVPFSDEHFKDHLDAAWPL  209727

>PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.4, whole genome shotgun 
sequence
Length=2787191

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 81/169 (48%), Gaps = 12/169 (7%)
 Frame = +1

Query  38       VSQKTAVKFKPQ----LKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYA  93
                 S + A ++ P+    +  + GC PYP V KDG+    L  SGP    C G  + SQ+Y 
Sbjct  1065931  TSTQWAAQYTPEQVQVVHTNGGCFPYPVVDKDGNTGDDLASSGPDSKSCNGPSVESQVYG  1066110

Query  94       RSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVS  153
                R+    D WAIMYAWY PK                RH W   +VW+D+  LE+ T+L V+
Sbjct  1066111  RAKRFTDKWAIMYAWYLPKNSNG-------WGIESRHLWLETIVWLDSFVLESPTILAVT  1066269

Query  154      MSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQD  202
                      Y K  P     ++GTSVK+    N L     L +T+  GE QD
Sbjct  1066270  TWHQGKYQKYLPPVADTLNGTSVKLD-CTNTLEYGYMLDVTKRIGETQD  1066413

>PHRA:scaffold_159
Length=54555

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 86/155 (55%), Gaps = 20/155 (13%)
 Frame = +1

Query  101    VWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI-G  159
              +WAIMYAWYFPK ++      F +  G RH+W  VVV +DNP LE  T++GVS S+ +  
Sbjct  36262  LWAIMYAWYFPKDQST-----FRK--GERHDWVNVVVCLDNPALERPTIIGVSSSSYVTT  36420

Query  160    YSKQAPTDVKYVDGTSVKVAYYY---NHLLGNTALQLTEDT-GEFQDLIQWDQLSSLARY  215
              Y K  P     + GT+  + Y     NH  G  ++  T  T GEFQDLI W+QL+  AR 
Sbjct  36421  YFKYTPPPADMLSGTTSMINYLADANNH--GFHSVDTTWKTGGEFQDLIMWEQLTDEARG  36594

Query  216    SLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWP  250
              +LN TD     FG     +P  D  F+  L+K WP
Sbjct  36595  ALNDTD-----FGEHA-PVPFIDPNFKANLEKAWP  36681

>PYAR:scaffold_8034 par_scaffold_8034 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_8034:1:820:1 
REF
Length=820

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 62/109 (57%), Gaps = 8/109 (7%)
 Frame = -3

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V  +P+P P   +QK A+KFKPQ+K +  C  YPAV + G+ +GGLK  G     
Sbjct  305  INHDAVPVWPEPAPWGGNQKLALKFKPQIKYENSCTAYPAVDQWGNTNGGLKPKGSPSAG  126

Query  82   CTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRH  130
            C   R   QIYAR+ W N+ + IMYAWY PK   +T         GHRH
Sbjct  125  CK-DRAKQQIYARTGWFNNHFVIMYAWYMPKDSPSTG-------LGHRH  3

>HYAP:scaffold_18 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_18:1:647099:1 
REF
Length=647099

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +1

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
               + H+ V P+P+P+PV  S+K  V++KP L I  GCHPY AV  +G  S GL+ +G  DG 
Sbjct  222532  VPHEHVEPYPEPEPVKKSEKAGVRYKPSLHISRGCHPYAAVDANGGTSTGLEPTGKDDGH  222711

Query  82      CTGSRLGSQIYARSAWVNDVWAIM  105
               C  S  GSQ+YAR  W    +AI+
Sbjct  222712  CKLSDRGSQVYARQKWFKKHYAII  222783

 Score = 45.4 bits (106),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +2

Query  169     KYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
               KY  G SVK+  YYN   G   + L+E+ GEFQ LI W+Q+++ +R +LN   W++
Sbjct  230966  KYRVGDSVKL--YYNSDDGRLYIDLSEEEGEFQPLIMWNQMTNESRCALNTFGWNE  231127

 Score = 25.8 bits (55),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 9/35 (26%)
 Frame = +3

Query  109     YFPKGRAATVPPDFLRF-FGHRHNWEYVVVWIDNP  142
               YFPK        D +R   GH H+WE+V + +  P
Sbjct  230808  YFPK--------DSVRSGIGHHHDWEWVTI*LSKP  230888

>PHIF:NW_003303458.1 Phytophthora infestans T30-4 supercont1.301 
genomic scaffold, whole genome shotgun sequence
Length=99585

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 75/150 (50%), Gaps = 21/150 (14%)
 Frame = -2

Query  113    GRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSAS-----------IGYS  161
              G    +P     F  HRH+W+ VVVWIDNP LE   + GVSMS S             Y 
Sbjct  50066  GTPPCLPHTTTGFPTHRHDWKSVVVWIDNPALEIPKIEGVSMSKSDTKYKKKLKLKESYF  49887

Query  162    KQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
                APT     +G++  + + Y    G+T +  T   GE+Q+LI W+QL+  AR +LN   
Sbjct  49886  SGAPT-----NGSNTSLRFEYEAGFGSTFMGFTRWDGEYQNLIMWEQLTDAARATLN---  49731

Query  222    WDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
               D   FG     +P  D  FE+ LD+ WPF
Sbjct  49730  -DGNNFGKEA-SVPFSDEHFEDRLDEAWPF  49647

>PHIF:NW_003303555.1 Phytophthora infestans T30-4 supercont1.204 
genomic scaffold, whole genome shotgun sequence
Length=150214

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = -3

Query  149    VLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQ  208
              +LG S S   GY+K AP     +DG+SVKV Y ++  L N AL +T+D GEFQDLI WDQ
Sbjct  80324  ILGCSPSWHSGYTKYAPCPGNVIDGSSVKVKYEHSWPL-NHALDITKDAGEFQDLIMWDQ  80148

Query  209    LSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251
              +S LAR +LN      T FG A    P+ D  F   ++K+WPF
Sbjct  80147  MSDLARRALN-----DTKFGKAN--TPMNDWNFRGKIEKSWPF  80040

>PHRA:scaffold_227
Length=11683

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDA--GCHPYPAVQKDGSMSGGLKWSGPQD  79
             I HD+V+PFPQPDPVT+++K+ VKFKP+LKID   GC  YPAV   G  SGGLK +    
Sbjct  1716  IDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEDGCVSYPAVNSAGETSGGLKGTKGTS  1895

Query  80    GECTGSRLGSQI  91
               CTG   GSQ+
Sbjct  1896  A-CTGPIFGSQV  1928

>PHKE:scaffold_656 scf_22126_656.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_656.1:1:13201:1 
REF
Length=13201

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = -1

Query  127   GHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAY--YYNH  184
             G+RH W YV+V IDNP LEN T+LGVS+  S+   KQ P D KY+D +SVKV Y    + 
Sbjct  9133  GYRHFW*YVIV*IDNPALENPTILGVSLPDSV-VVKQTPLDAKYIDRSSVKVLYSTVQDE  8957

Query  185   LLGNTALQLTEDTGEFQDLIQWDQL  209
              L +  + LT++ G+ QDLI WDQL
Sbjct  8956  DLVDGDMVLTKEAGKLQDLITWDQL  8882

>PHPA:scaffold_330 NW_008649316.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.330, whole genome 
shotgun sequence
Length=10465

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +3

Query  22    IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
             I HD+V+PF QP PVT+++K AV FKPQL I  GC  +PAV   G +SGGLK +   +G 
Sbjct  5739  IDHDKVQPFAQPVPVTIAEKAAVMFKPQLHISQGCVSFPAVNAAGEISGGLKGTKNTEG-  5915

Query  82    CTGSRLGSQI  91
             CT + LGSQ+
Sbjct  5916  CTEAPLGSQV  5945

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 7/77 (9%)
 Frame = +1

Query  175  SVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKM  234
            S++V   Y +     AL  +E  G+FQDLI W+QL+  AR +LN  D+ ++       K+
Sbjct  220  SIRVTPTYWNSFEYLALHFSETDGQFQDLIMWEQLTDEARLALNSADFGES-------KV  378

Query  235  PLKDGVFEELLDKTWPF  251
            P  D   EE L+  W F
Sbjct  379  PFNDENIEETLELAWAF  429

>PHPA:scaffold_324 NW_008649310.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.324, whole genome 
shotgun sequence
Length=8854

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +3

Query  36    VTVSQKTAVKFKPQLKIDAG--CHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYA  93
             V +S+K A KFKP L I  G  C  +P V     +SG LK     +  C  + LGSQ+Y 
Sbjct  7581  VHISEKAAAKFKPMLLIREGDGCVSFPVVNAAREISGRLK-EARGNSACDDAPLGSQVYD  7757

Query  94    RSAWVNDVWAIMYAWYFPKG  113
             R+ W ND WAIMYAWYFPKG
Sbjct  7758  RAGWHNDKWAIMYAWYFPKG  7817

>PHIF:NW_003303733.1 Phytophthora infestans T30-4 supercont1.26 
genomic scaffold, whole genome shotgun sequence
Length=2229580

 Score = 71.2 bits (173),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 82/178 (46%), Gaps = 23/178 (13%)
 Frame = -2

Query  39      SQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWV  98
               S+K  V FKPQL I  GC  +      G +SGGLK +   +  C  + LGSQ+  R+ W 
Sbjct  987321  SEKAGVGFKPQLNIADGCVSFLTDNGTGDVSGGLKGTN-GNSACDNASLGSQLLGRADWY  987145

Query  99      NDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASI  158
               ++  AIM  W+F KG    V       +    +    VVWIDNP             A++
Sbjct  987144  SNQSAIMRVWFFRKGVLIGVA------WRQDKD*ASAVVWIDNP-----------EPANL  987016

Query  159     GYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTAL---QLTEDTGEFQDLIQWDQLSSLA  213
                 S  +  DV  +   S  + ++ N ++   A     L   TG+F  LI W+QL+ L+
Sbjct  987015  ELSTSSLDDV--LQNKSPFLDFFLNDVIA*LAK*LGNLCWVTGDFLPLIMWEQLTRLS  986848

 Score = 27.7 bits (60),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQK  41
               I H++V+PF QPD  T+ ++
Sbjct  987371  IDHNKVKPFAQPDSATILRR  987312

>PHPA:scaffold_343 NW_008649329.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.343, whole genome 
shotgun sequence
Length=6988

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 79/163 (48%), Gaps = 10/163 (6%)
 Frame = -3

Query  68    MSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFL--RF  125
             ++GGLK +   DG C  S   SQ+Y R+ W  DVWAIMYAWYF KG   T   D +  R 
Sbjct  1565  VTGGLKGTNGNDG-CRYSIKDSQVYGRAGWHKDVWAIMYAWYFQKGFG*TCRVDAMIGRA  1389

Query  126   FGHRHN---WEYVVVWIDNPGLENATVLGVSM---SASIGYSKQAPT-DVKYVDGTSVKV  178
             F        W  + +   +    +   L  +    S   G+    P+    YV G+S  +
Sbjct  1388  FLCGLTIPCWRLLRL*EFSTSKSDTEYLKTTKTYPSEYAGHGVNGPSFGPAYVGGSSTSL  1209

Query  179   AYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
              + Y     +  L  TE  G++Q+LI W+QL+  +R +LN +D
Sbjct  1208  RFQYETSWTSPVLVFTELDGDYQELIMWEQLTDASRAALNSSD  1080

>PHKE:scaffold_219 scf_22126_219.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_219.1:1:59035:1 
REF
Length=59035

 Score = 50.4 bits (119),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  81     ECTGSRLGSQIYARSAWVNDVWAIMYAWYFP  111
               C GS LGSQIYARS   +DVWAIMY WYFP
Sbjct  36605  SCRGSDLGSQIYARSK*HSDVWAIMYTWYFP  36697

 Score = 42.4 bits (98),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = +1

Query  36     VTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGP  77
              V  + K AVKFKPQ KI   CHPY  +  +G +  GL+ S P
Sbjct  36472  VATTDKPAVKFKPQRKISGACHPYHIIASNGYVRTGLEPS*P  36597

>PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3060, whole genome shotgun sequence
Length=3267112

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 12/94 (13%)
 Frame = -3

Query  81       ECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLR---FFGHRHNWEYVVV  137
                +C+GS  GSQ+Y R+       AIMY+WYFP+        DF+    + GHRH WE+ ++
Sbjct  2338499  DCSGSPEGSQVYGRAHVYKGYLAIMYSWYFPR--------DFMTTPFYVGHRHGWEHAIL  2338344

Query  138      WIDNPGLENATVLGVSMSASIGYSKQAPTDVKYV  171
                WI     E+A +L  S+ +++ Y   AP   KY+
Sbjct  2338343  WIGGS-TEDAVLLAASVESTLSYDTYAPVPSKYM  2338245

>PHPA:scaffold_38 NW_008649024.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.38, whole genome shotgun 
sequence
Length=690105

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 76/187 (41%), Gaps = 61/187 (33%)
 Frame = -2

Query  108   WYFPKGRAATVPPDFLRFFGH----RHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQ  163
             +YFPKG           FF      RH+W  +V+W+DNP LE   +LG S+S  +  S++
Sbjct  2144  FYFPKG-----------FFSSQARIRHDWASMVLWLDNPALEAPKILGASLSQQLLESRR  1998

Query  164   A-------------------------------------PTDVKYVDGTSV--KVAYYYNH  184
                                                     +  YV G++V  +V++ Y  
Sbjct  1997  ILGFKMASEKEPYKKMTEIPPMGFVGTQEIRQNRISRWSYNYTYVGGSNVSTRVSHTYVD  1818

Query  185   LLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEEL  244
                  AL      G++QDLI W+QL+  AR +L+  D+ ++       K+P  D   +  
Sbjct  1817  KFDWLALDFARQDGQYQDLIMWEQLTDEARAALDTADFGES-------KIPFNDKSLDTT  1659

Query  245   LDKTWPF  251
             L   WPF
Sbjct  1658  LGLAWPF  1638

>PHRA:scaffold_375
Length=14997

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 61/122 (50%), Gaps = 16/122 (13%)
 Frame = +2

Query  135    VVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVK---VAYYYNHLLGNTAL  191
               VVWID+P LEN  VLG+S+S S           KYV   +++       Y  +      
Sbjct  12581  AVVWIDDPALENPKVLGLSLSTSENKYGH-----KYVPAEALRNGTTPSLYRMMPSYKCA  12745

Query  192    QLTE--DTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTW  249
              +L     +G+ QDLI WDQL+  AR +LN    DQ  FG    ++P+ D  F + L+K W
Sbjct  12746  ELVPYYASGDAQDLIMWDQLTDAARAALN----DQDNFGRT--EVPINDDHFLKHLEKAW  12907

Query  250    PF  251
              P 
Sbjct  12908  PL  12913

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 52.4 bits (124),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 15/91 (16%)
 Frame = +1

Query  127     GHRHNWEYVVVWIDNPGLENATVLGVSMSA-SIGYSKQAPTDVK-YVDGTSVKVA-----  179
               G RHNW  ++VW+ NP + N T+L +S S    GY    P      ++GT  KVA     
Sbjct  352126  GIRHNWANLIVWLSNPAVANPTILAISASTFGGGYFVSIPIKTSDILNGTMAKVAGGRAG  352305

Query  180     YYYNHLLGNTALQLTEDTGEFQDLIQWDQLS  210
               +Y       T  Q  E+ GEF++LI+W QL+
Sbjct  352306  WY-------TIFQFGEE-GEFRNLIKWSQLT  352374

 Score = 30.4 bits (67),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +2

Query  84      GSRLGSQIYARSAWVNDVWAIMYAWYFPKGR  114
               GS LGSQ+Y+RS  +   W I+YA+     R
Sbjct  352034  GSALGSQVYSRSTRLGGKWVIVYAYRVKAKR  352126

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  32      QPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
               +PDP+T ++K AVKFK  L + +GCHPYP V   G  S GL  +G
Sbjct  349629  KPDPITDAEKAAVKFKSSLAVKSGCHPYPVVNAPGDTSAGLSGTG  349763

>PHIF:NW_003303606.1 Phytophthora infestans T30-4 supercont1.153 
genomic scaffold, whole genome shotgun sequence
Length=153281

 Score = 53.9 bits (128),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAV  62
               I  +QV+ F QP PVT+S++TAVK KPQL ID GC  +PAV
Sbjct  100644  IDLNQVQSFKQPKPVTISERTAVKHKPQLLIDGGCVSFPAV  100522

 Score = 28.5 bits (62),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 23/58 (40%), Gaps = 7/58 (12%)
 Frame = -2

Query  76      GPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWE  133
               GP        RLGSQIY  SAW  D+         PK    T P  ++ +     +W 
Sbjct  100501  GPTQTGAARKRLGSQIYGLSAWFVDI-------SLPKIAQQTSPICYIMYAALDLDWN  100349

 Score = 38.9 bits (89),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 43/82 (52%), Gaps = 10/82 (12%)
 Frame = -3

Query  173    GTSVKVAYYYNHLLGNTALQLT-EDTGEF--QDLIQWDQLSSLARYSLNHTDWDQTLFGL  229
              GTSV+V +       +  + L+  D G++  QDL+ W+QL+  AR +LN TD+ ++    
Sbjct  98004  GTSVRVVHTIRKNFRSAYVVLSFADNGDYMYQDLVMWEQLTEKARAALNTTDFGKS----  97837

Query  230    AGLKMPLKDGVFEELLDKTWPF  251
                 K+P  D  F   L +  PF
Sbjct  97836  ---KVPFNDDNFLITLAEGSPF  97780

>PHPA:scaffold_134 NW_008649120.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.134, whole genome 
shotgun sequence
Length=62820

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = -2

Query  1      MNFRavfvaamaslavaqaqvIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPY  59
              MN + +     A++       + H ++ PFPQP+PVT+S+  A+KFKPQL + A  C  +
Sbjct  61772  MNLQIIIATLFATVVTCGTATVDHGKIEPFPQPEPVTISENAAIKFKPQLFVSASVCASF  61593

Query  60     PAVQKDGSMSGGLKWS  75
               AV   G  + GLK S
Sbjct  61592  LAVNAAGETTDGLKGS  61545

>PYAR:scaffold_8483 par_scaffold_8483 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_8483:1:751:1 
REF
Length=751

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -1

Query  22   IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGE  81
            I HD V  +P+P P   +Q+ A++FKP L +  GC PYPAV   G  SGGLK  G     
Sbjct  208  INHDAVPVWPEPAPTDATQQLALRFKPFLDVVNGCQPYPAVDPAGDTSGGLKPKGGSSAN  29

Query  82   C  82
            C
Sbjct  28   C  26

>PYIW:scaffold_4003 piw_scaffold_4003 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_4003:1:2431:1 
REF
Length=2431

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = -2

Query  162   KQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTD  221
             K AP     VDGTS KV Y  N ++ N AL  T D GE Q LI WDQ++  AR +L +TD
Sbjct  2430  KYAPPKSGTVDGTSAKVDYSSNVVI-NHALDSTSDGGEKQPLIMWDQMTDAARAALENTD  2254

Query  222   WDQTLFGLAGLKMPLKDGVF  241
                  FG A +  P+KDG F
Sbjct  2253  -----FGDANV--PMKDGNF  2215

>PHIF:NW_003303696.1 Phytophthora infestans T30-4 supercont1.63 
genomic scaffold, whole genome shotgun sequence
Length=711656

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  36      VTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSG  76
               VT +QK A+K K QLKI+ GCH YP V KDG++S GLKW G
Sbjct  107687  VTDAQKAALKCKLQLKIEDGCHLYPVVPKDGAISSGLKWFG  107809

>PHKE:scaffold_1065 scf_22126_1065.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_1065.1:1:3927:1 
REF
Length=3927

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  41    KTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARS  95
             K+A++FKPQL I +GCH YPAV  +G +SGGL   G     C G  + SQ+YARS
Sbjct  3763  KSALRFKPQLHIGSGCHSYPAVNVEGQISGGLAPRGSSSSGCGGFLVTSQVYARS  3927

>PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 
genomic scaffold, whole genome shotgun sequence
Length=182585

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  22      IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG  55
               I HDQV+PF QP PVT++++ AVKFKPQL I  G
Sbjct  179764  INHDQVQPFAQPVPVTIAERAAVKFKPQLYITQG  179663

>PHKE:scaffold_162 scf_22126_162.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_162.1:1:73111:1 
REF
Length=73111

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGS  67
              I HDQV+PF QP+PVT +++ AV+FKP + +   C  YPAV   G 
Sbjct  22937  ICHDQVQPFKQPEPVTATKEVAVQFKPAISVYDECKQYPAVNTVGE  23074

>PHRA:scaffold_66
Length=301783

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  78     QDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFP  111
              Q G C GS L SQ+Y+RS    DVWAIMYA YFP
Sbjct  63796  QSGGCKGSELDSQVYSRSTLYRDVWAIMYA*YFP  63897

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 70/252 (28%), Positives = 94/252 (37%), Gaps = 62/252 (25%)
 Frame = +2

Query  22     IGHDQVRPFPQPDPVTVSQKTAVK-FKPQLKIDAGCHPYPAVQKDGSMS---------GG  71
              I HD V+PF  P+  TVS+  + + F P   I   C PYPAV   G  S          G
Sbjct  63620  IDHDNVQPFAWPESATVSETGSSRNFVP--GILNRCLPYPAVNAAGDTSWGGGGG*KEPG  63793

Query  72     LKWSGPQ----------DGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPD  121
               K    +          D  CTG+   S     S W    W   +A      R       
Sbjct  63794  FKVEAARALN*TLKSTADPRCTGTSGPSCTLDISHWT---WI*RWA----SSRLGKC---  63943

Query  122    FLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSA-SIGYSKQAPTDVKYVDGTSVKVAY  180
                    +R        W+D P      +LGV  S     Y    P     +DGTS K+ Y
Sbjct  63944  ------NR--------WLDYPEAVKPKILGVLTSIYDAEYFIYYPALEGSIDGTSPKLDY  64081

Query  181    Y-------YNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTL---FGLA  230
              +       Y+ +  NT  +      +FQDLIQW+QL+  AR  L   ++       F  A
Sbjct  64082  FGDFDCSGYHSIYMNTLKK-----SDFQDLIQWEQLTDAARSGLETGEFGGNFPVPFIDA  64246

Query  231    GLKMPLKDGVFE  242
                K+ L+ G  E
Sbjct  64247  NFKLNLERGRLE  64282

>PHIF:NW_003303724.1 Phytophthora infestans T30-4 supercont1.35 
genomic scaffold, whole genome shotgun sequence
Length=1599985

 Score = 47.4 bits (111),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 41/87 (47%), Gaps = 17/87 (20%)
 Frame = +2

Query  24       HDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAG-CHPYPAVQKDGSMSGGLKWSGPQDGEC  82
                HD V P PQ  P+T  +K+AV  KPQL      C PY AV  DG ++G            
Sbjct  1213802  HD*V*P-PQSRPITTFEKSAVMLKPQLYTPKHVCGPYAAVGADGEVTG------------  1213942

Query  83       TGSRLGSQIYARSAWVNDVWAIMYAWY  109
                    +G+  Y R+ W  D  AIM A Y
Sbjct  1213943  ---IIGNSAYGRAGWYKDTTAIM*ACY  1214014

 Score = 21.2 bits (43),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  130      HNWEYVVVWIDNPGLE  145
                  W+ VVVW  NP +E
Sbjct  1214044  QGWKSVVVWRGNPAIE  1214091

>PYIW:scaffold_158 piw_scaffold_158 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_158:1:26995:1 
REF
Length=26995

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 8/70 (11%)
 Frame = +1

Query  176    VKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMP  235
               KVAY  N ++ N AL  T D GE Q LI WDQL+  AR +L +T+     FG A +  P
Sbjct  12181  AKVAYSSNVVI-NHALDSTPDAGEKQPLIMWDQLTDAARAALENTN-----FGDANV--P  12336

Query  236    LKDGVFEELL  245
              +KDG F+  L
Sbjct  12337  MKDGNFKNKL  12366

>PYIR:scaffold_4917 pir_scaffold_4917 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4917:1:745:1 
REF
Length=745

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +1

Query  126  FGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVK  177
             GHRH+W+++ VWIDNP   N  +L VS SA   Y K A   +  +  T+ +
Sbjct  73   LGHRHDWKHIAVWIDNPKAANPKILVVSPSAHSSYVKYAHQRLTRLMATASR  228

 Score = 33.1 bits (74),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 32/64 (50%), Gaps = 1/64 (2%)
 Frame = +3

Query  165  PTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQ  224
            P+    VDG SVKV  Y + +  N AL  T   GE   LI   QL+++ R +L +T +  
Sbjct  189  PSKADTVDGNSVKV-DYTSKVAINHALDSTTAAGEQ*PLIMRSQLTAVTRSALENTSFGD  365

Query  225  TLFG  228
               G
Sbjct  366  INLG  377

>PYVX:scaffold_144 pve_scaffold_144 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_144:1:45345:1 
REF
Length=45345

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 62/161 (39%), Gaps = 14/161 (9%)
 Frame = -3

Query  26     QVRPFPQPDPVTVSQKTAVKFKPQLKIDA-GCHPYPAVQKDGSMSGGLKWSGPQDGECTG  84
              Q   F + D    S        P    D+ GC P   + + G  +GGLK +G   G C  
Sbjct  41032  QADDFAKLDEALPSGIDISAIAPVFDYDSDGCFPSAGISRSGDQNGGLKPTGSLTGGCRN  40853

Query  85     SRLG--SQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFF--GHRHNWEYVVVWID  140
                    S  Y R A V D   + Y  +F       +    L     GHRH+WE  +VW  
Sbjct  40852  GNFMDLSNTYHRYACV-DSNNVKYCGHFFS--VYMLKDQILAGVKSGHRHDWEKAIVWT-  40685

Query  141    NPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYY  181
                  EN  V   S SA  G    A +++   DG  +K  Y+
Sbjct  40684  ----ENGVVTYGSYSAHSGVGTAAASEIPQQDG-HLKFVYH  40577

 Score = 37.7 bits (86),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 44/115 (38%), Gaps = 4/115 (3%)
 Frame = -2

Query  30     FPQPDPVTVSQKTAVKFKPQLKIDA-GCHPYPAVQKDGSMSGGLKWSGPQDGECTGSRLG  88
              F + D    S        P   ID   C     + ++G  + GLK +G   G C      
Sbjct  42665  FAKLDEAQPSDVDLSSIYPVFDIDTDSCLFSAGISRNGDQNEGLKPTGTVTGSCRSDDFL  42486

Query  89     --SQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWIDN  141
                S +Y R A +          +F          D++   GHRH+WE V++W +N
Sbjct  42485  NLSNLYHRYACLEASNVSYCGHFFSVYTLKDQIVDYIES-GHRHDWEKVILWTEN  42324

>PHKE:scaffold_482 scf_22126_482.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_482.1:1:25093:1 
REF
Length=25093

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  31     PQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSM  68
              P+  P+T+S+K A+KFKPQLK+  GC PY A  +   M
Sbjct  18550  PEAYPITISEKAAIKFKPQLKVSHGCQPYAAANEAQIM  18437

Lambda      K        H        a         alpha
   0.319    0.137    0.445    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 54351116544

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40