Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHRA:scaffold_5615021115125734917670.0
PHSO:scaffold_12799766280080934915930.0
PHPA:scaffold_6325087125192335115330.0
PHIF:NW_003303697.143090543195735115250.0
PHCA:scaffold_8410026710131935115150.0
PHKE:scaffold_98671456819735114480.0
PLHA:NW_020189861.11844377184541134914059e-176
PYUU:scaffold_2037130791813083431455141e-90
PYIR:scaffold_81013741018261514972e-88
PYAP:scaffold_16220074206972206363e-88
PYVX:scaffold_275154722242367508e-88
PYAR:scaffold_2916051165511785533e-76
PYIW:scaffold_96310491114233206545e-75
ALLA:FR82410411308119162094666e-50
ALCA:scaffold_90858989631283861e-40
SADI:scaffold_42040862046702002811e-31
APAS:scaffold_127075497084092933244e-31
SAPA:scaffold_243945633949041212636e-24
APIN:scaffold_203997224000541182393e-21
PYAR:scaffold_2744363539461231516e-09
HYAP:scaffold_842731592734491161445e-08
PHRA:scaffold_13064799650771151427e-08
PYUU:scaffold_20076874176876951151411e-07
PHSO:scaffold_8252771125280011161401e-07
PYIW:scaffold_452134816591291355e-07
PHCA:scaffold_133421653424641221365e-07
PHPA:scaffold_891005741008401071348e-07
PYIR:scaffold_755851188191211339e-07
PHIF:NW_003303587.154941552071071321e-06
SAPA:scaffold_2071671719311081311e-06
PHKE:scaffold_26215984162621151311e-06
PYVX:scaffold_518520355231341312e-06
ALCA:scaffold_7870324706261191292e-06
SADI:scaffold_522150542153141111284e-06
APAS:scaffold_138595408598511221266e-06
ALLA:FR82410366806671501421251e-05
PYAP:scaffold_12339125394241181231e-05
APIN:scaffold_17945697948801221231e-05
PYIW:scaffold_1276264230101301213e-05
PYIR:scaffold_23118901192631271204e-05
PYAP:scaffold_1374095741055351204e-05
PYAR:scaffold_112420072102341186e-05
APIN:scaffold_3780777781046971105e-04
PHCA:scaffold_201298011301451331098e-04
HYAP:scaffold_111953781195479341098e-04
PHPA:scaffold_11460061604051331070.001
PYIR:scaffold_882413124214281060.002
PYUU:scaffold_2023313543313638321060.002
PHRA:scaffold_731851621854551161050.002
PHIF:NW_003303740.1226907322693361111050.002
PYAP:scaffold_21220888212801491050.002
PYIW:scaffold_45225652342291050.002
PHSO:scaffold_49711889714631101040.003
PYUU:scaffold_123951645519891331040.003
PYIR:scaffold_316929896151241040.003
APIN:scaffold_11876520876738791040.003
PHKE:scaffold_206527656471391030.005
ALLA:FR8240754874548849441020.005
ALCA:scaffold_16111539111625291020.006
PYAR:scaffold_22213257135321101010.007
ALLA:FR8240881035491038721261010.007
PYIW:scaffold_388555058431161010.007
SAPA:scaffold_195182765185421051010.008
ALCA:scaffold_121660468791101000.009
SADI:scaffold_273659033661691051000.009
APAS:scaffold_6124062124223611000.009
ALLA:FR8240678356883654291000.009
PHIF:NW_003303669.13702243704991101000.009
SADI:scaffold_37421727424741191000.010
PHKE:scaffold_1295350653580251000.010
PYVX:scaffold_513422137151161000.010
PYVX:scaffold_12542645437145990.013
PLHA:NW_020189964.1739227405645990.014
PHRA:scaffold_27488774894824980.015
PHPA:scaffold_3257848657855724980.016
PHIF:NW_003303691.136411336418424970.021
PHCA:scaffold_21737859173795131970.023
APAS:scaffold_4935978736000579960.025
HYAP:scaffold_79736553999133960.027
SAPA:scaffold_2835917836192110960.031
PYIW:scaffold_649153881549237950.035
PHCA:scaffold_1810753810764237950.035
PHPA:scaffold_71543419154352337950.036
PHSO:scaffold_223100742310424132950.038
APAS:scaffold_5939623939898110950.039
PHRA:scaffold_3837789737800137950.040
PHKE:scaffold_62641234398110950.041
PHIF:NW_003303698.1681509681820119950.041
HYAP:scaffold_7222699922710337950.041
PHPA:scaffold_5694361694672119940.044
ALLA:FR824181258722605162940.044
ALLA:FR824176424594263862940.044
PHIF:NW_003303756.13548762354886637940.047
PHKE:scaffold_69488904899437940.054
APIN:scaffold_8307116307391110940.054
PLHA:NW_020187174.1307045307413141940.055
PHCA:scaffold_1069910899419118930.058
PYUU:scaffold_203526286626303962930.061
ALCA:scaffold_34512775136329930.061
PYUU:scaffold_20341065680106579942930.072
PHPA:scaffold_4230401330415956920.079
PYIR:scaffold_115562515572937920.083
PHRA:scaffold_48511285423118920.083
PYAP:scaffold_610185821868334920.084
PHPA:scaffold_53120919121197112920.089
PHCA:scaffold_984440684455256920.089
PHIF:NW_003303755.113888461389124112920.091
ALCA:scaffold_2659548963429920.094
PLHA:NW_020189293.11002284100240342910.099
ALLA:FR8245027653774531910.10
PLHA:NW_020189809.1779623779901112910.11
PYVX:scaffold_3785146535576900.13
PHKE:scaffold_908597586298126900.13
PYVX:scaffold_291294142951233900.14
HYAP:scaffold_99215392163432900.14
SAPA:scaffold_3710664510675539900.14
PYAP:scaffold_7921667175632900.14
PYAR:scaffold_11163823392737900.14
PYIR:scaffold_3100109429121890.14
ALLA:FR82447157566049112900.16
PHKE:scaffold_269175251767156890.18
PYIW:scaffold_12159088923456890.18
PYUU:scaffold_200680423580436345890.19
SADI:scaffold_1353737853748839890.20
SAPA:scaffold_4677465757840890.21
PHIF:NW_003303710.175602175612234880.23
PYVX:scaffold_119016651958113880.25
PYVX:scaffold_44139871413356880.25
PHPA:scaffold_98619366203132880.27
SAPA:scaffold_2732797294960880.29
SADI:scaffold_72145548145817114880.29
ALCA:scaffold_559261693098180880.29
SAPA:scaffold_716223016238559870.30
PYVX:scaffold_478296845154870.31
PHSO:scaffold_33934544393463932870.32
APIN:scaffold_715344953844137870.34
PYIR:scaffold_12353405361484870.35
PYUU:scaffold_1722480514819756870.36
PHRA:scaffold_66685686866332870.37
HYAP:scaffold_293148631830133870.38
PHKE:scaffold_581977320051112860.40
PHRA:scaffold_16436829437245162860.40
PYUU:scaffold_201131863931884884860.42
APAS:scaffold_41422026142216351860.43
ALCA:scaffold_4641497415537200860.45
PHPA:scaffold_227786802778970112860.51
PLHA:NW_020190023.11843064184315932850.55
SAPA:scaffold_701617816438110850.56
PYIR:scaffold_185321902525127850.57
APAS:scaffold_151066084106618837850.58
PYAP:scaffold_11543505449656850.60
APIN:scaffold_1248991749004244850.60
ALCA:scaffold_1313700313708327850.64
PHCA:scaffold_27527809528087112840.69
HYAP:scaffold_312100531020558840.71
SADI:scaffold_77197803198066104840.76
APAS:scaffold_21220973122109844840.88
APIN:scaffold_141143919114402337840.89
SADI:scaffold_1725322125337057830.90
HYAP:scaffold_46109870110148112830.91
PHCA:scaffold_72709047099932830.94
PYAR:scaffold_951106411080558830.99
PYUU:scaffold_202513873113882632831.0
SADI:scaffold_20296235296570123831.0
SADI:scaffold_120653220672373831.0
PYIW:scaffold_735119471204232821.2
PYAP:scaffold_875436554639821.2
APAS:scaffold_362977830125134821.2
APAS:scaffold_22441093441431121821.3
PYAR:scaffold_79963796741132821.3
PHCA:scaffold_42349768350103130821.5
PHRA:scaffold_366157466172056821.5
PYIR:scaffold_78480794817432821.5
PYIW:scaffold_78499951010841811.5
SADI:scaffold_8755264755653157811.6
PYAR:scaffold_99578648139116811.7
PYIW:scaffold_151132503552116811.7
PHPA:scaffold_258779588196146811.8
PYIR:scaffold_47529445309052811.8
ALLA:FR824107265292663034811.8
PYUU:scaffold_2032628516299149811.8
PYIR:scaffold_12876878782749811.8
APIN:scaffold_2275912276244124811.9
SAPA:scaffold_4023001223020070812.0
PYAR:scaffold_1221998212344812.0
ALCA:scaffold_25249542509756812.0
PHKE:scaffold_2385279546462812.0
PYAP:scaffold_549187991892444802.1
PYIW:scaffold_6511218912473113802.1
SADI:scaffold_66237753238079115802.2
PHKE:scaffold_452204912072797802.2
PYVX:scaffold_1800318022271802.3
PHCA:scaffold_1454787854807568802.5
PHRA:scaffold_22156491573531802.5
PHIF:NW_003303746.131009773101267112802.6
SADI:scaffold_157629876654127802.6
SAPA:scaffold_6503352503738139802.7
PYAP:scaffold_2002223722503108792.7
PYAR:scaffold_1067955110156792.8
PYIR:scaffold_949363953964792.8
PYAP:scaffold_394082641050100792.9
PYAP:scaffold_7471324813541112793.0
SAPA:scaffold_1815688584354793.0
HYAP:scaffold_242559955609032793.0
PYAP:scaffold_9266711680634793.1
PYIW:scaffold_5255010512039793.1
PLHA:NW_020187350.176963876976344793.2
PHRA:scaffold_96295872967331793.3
PHIF:NW_003303749.12457558245764431793.3
ALCA:scaffold_49388373898650793.3
PHPA:scaffold_61884684188477031793.3
HYAP:scaffold_167164671670397793.3
ALLA:FR824348123901248833793.5
APAS:scaffold_18972779739642793.5
PHIF:NW_003303653.118223818244784783.6
PYAR:scaffold_571121931434773.6
HYAP:scaffold_322269942708031783.8
ALCA:scaffold_29171971729534783.8
PHIF:NW_003303741.11387997138812244783.8
SAPA:scaffold_5889578908244783.9
PHRA:scaffold_352361123859112784.0
PYAR:scaffold_2672250235439784.1
SADI:scaffold_25488924901744784.1
PHRA:scaffold_82788067897057784.5
PYVX:scaffold_9128862897239774.7
APAS:scaffold_47420819421157123774.7
PHPA:scaffold_1638270738283244775.2
PHKE:scaffold_2615717315729844775.2
PYVX:scaffold_35561065622541775.6
PHCA:scaffold_8215833915842532775.9
PYIR:scaffold_753115301161027766.1
PLHA:NW_020187532.12611854261194031766.2
PHSO:scaffold_1335679735691038766.4
PYVX:scaffold_158153881551344766.4
APIN:scaffold_59307831308076106766.7
PLHA:NW_020187331.120855120867944767.1
ALCA:scaffold_110676836778434767.3
SAPA:scaffold_1621003821019060767.7
SAPA:scaffold_1922923923180111767.9
PHRA:scaffold_67569535707844758.4
APAS:scaffold_25221782227633758.4
APIN:scaffold_10173152173493122758.5
HYAP:scaffold_152734777358438758.9
ALLA:FR824197236642375330759.0
ALLA:FR824109260982618429759.9
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYRA_81100

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHRA:scaffold_56                                                      685     0.0   
PHSO:scaffold_1                                                       618     0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  595     0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  592     0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     588     0.0   
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  562     0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  545     9e-176
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  202     1e-90 
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  196     2e-88 
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  249     3e-88 
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  293     8e-88 
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  217     3e-76 
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  256     5e-75 
ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:...  184     6e-50 
ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig sup...  153     1e-40 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  112     1e-31 
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  129     4e-31 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  105     6e-24 
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  96.7    3e-21 
PYAR:scaffold_2744 par_scaffold_2744 dna:supercontig supercontig:...  62.8    6e-09 
HYAP:scaffold_84 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  60.1    5e-08 
PHRA:scaffold_130                                                     59.3    7e-08 
PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:p...  58.9    1e-07 
PHSO:scaffold_8                                                       58.5    1e-07 
PYIW:scaffold_452 piw_scaffold_452 dna:supercontig supercontig:pi...  56.6    5e-07 
PHCA:scaffold_13 PHYCAscaffold_13                                     57.0    5e-07 
PHPA:scaffold_89 NW_008649075.1 Phytophthora parasitica INRA-310 ...  56.2    8e-07 
PYIR:scaffold_755 pir_scaffold_755 dna:supercontig supercontig:pi...  55.8    9e-07 
PHIF:NW_003303587.1 Phytophthora infestans T30-4 supercont1.172 g...  55.5    1e-06 
SAPA:scaffold_20 supercont2.20 dna:supercontig supercontig:ASM151...  55.1    1e-06 
PHKE:scaffold_262 scf_22126_262.1 dna:supercontig supercontig:Phy...  55.1    1e-06 
PYVX:scaffold_518 pve_scaffold_518 dna:supercontig supercontig:pv...  55.1    2e-06 
ALCA:scaffold_78 AcNc2_CONTIG_78_length_85802 dna:supercontig sup...  54.3    2e-06 
SADI:scaffold_52 supercont1.52 dna:supercontig supercontig:Sap_di...  53.9    4e-06 
APAS:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_a...  53.1    6e-06 
ALLA:FR824103 dna:supercontig supercontig:ENA1:FR824103:1:105777:...  52.8    1e-05 
PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:p...  52.0    1e-05 
APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inv...  52.0    1e-05 
PYIW:scaffold_1276 piw_scaffold_1276 dna:supercontig supercontig:...  51.2    3e-05 
PYIR:scaffold_231 pir_scaffold_231 dna:supercontig supercontig:pi...  50.8    4e-05 
PYAP:scaffold_137 pag1_scaffold_137 dna:supercontig supercontig:p...  50.8    4e-05 
PYAR:scaffold_1124 par_scaffold_1124 dna:supercontig supercontig:...  50.1    6e-05 
APIN:scaffold_3 supercont1.3 dna:supercontig supercontig:Apha_inv...  47.0    5e-04 
PHCA:scaffold_20 PHYCAscaffold_20                                     46.6    8e-04 
HYAP:scaffold_1 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1:...  46.6    8e-04 
PHPA:scaffold_114 NW_008649100.1 Phytophthora parasitica INRA-310...  45.8    0.001 
PYIR:scaffold_88 pir_scaffold_88 dna:supercontig supercontig:pir_...  45.4    0.002 
PYUU:scaffold_2023 scf1117875582023 dna:supercontig supercontig:p...  45.4    0.002 
PHRA:scaffold_73                                                      45.1    0.002 
PHIF:NW_003303740.1 Phytophthora infestans T30-4 supercont1.19 ge...  45.1    0.002 
PYAP:scaffold_212 pag1_scaffold_212 dna:supercontig supercontig:p...  45.1    0.002 
PYIW:scaffold_4 piw_scaffold_4 dna:supercontig supercontig:piw_sc...  45.1    0.002 
PHSO:scaffold_4                                                       44.7    0.003 
PYUU:scaffold_1239 scf1117875581239 dna:supercontig supercontig:p...  44.7    0.003 
PYIR:scaffold_316 pir_scaffold_316 dna:supercontig supercontig:pi...  44.7    0.003 
APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_i...  44.7    0.003 
PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:Phy...  44.3    0.005 
ALLA:FR824075 dna:supercontig supercontig:ENA1:FR824075:1:147583:...  43.9    0.005 
ALCA:scaffold_16 AcNc2_CONTIG_16_length_171156 dna:supercontig su...  43.9    0.006 
PYAR:scaffold_222 par_scaffold_222 dna:supercontig supercontig:pa...  43.5    0.007 
ALLA:FR824088 dna:supercontig supercontig:ENA1:FR824088:1:131184:...  43.5    0.007 
PYIW:scaffold_388 piw_scaffold_388 dna:supercontig supercontig:pi...  43.5    0.007 
SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM151...  43.5    0.008 
ALCA:scaffold_121 AcNc2_CONTIG_121_length_67320 dna:supercontig s...  43.1    0.009 
SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_di...  43.1    0.009 
APAS:scaffold_6 supercont1.6 dna:supercontig supercontig:Apha_ast...  43.1    0.009 
ALLA:FR824067 dna:supercontig supercontig:ENA1:FR824067:1:183579:...  43.1    0.009 
PHIF:NW_003303669.1 Phytophthora infestans T30-4 supercont1.90 ge...  43.1    0.009 
SADI:scaffold_3 supercont1.3 dna:supercontig supercontig:Sap_dicl...  43.1    0.010 
PHKE:scaffold_129 scf_22126_129.1 dna:supercontig supercontig:Phy...  43.1    0.010 
PYVX:scaffold_5 pve_scaffold_5 dna:supercontig supercontig:pve_sc...  43.1    0.010 
PYVX:scaffold_12 pve_scaffold_12 dna:supercontig supercontig:pve_...  42.7    0.013 
PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig:...  42.7    0.014 
PHRA:scaffold_27                                                      42.4    0.015 
PHPA:scaffold_32 NW_008649018.1 Phytophthora parasitica INRA-310 ...  42.4    0.016 
PHIF:NW_003303691.1 Phytophthora infestans T30-4 supercont1.68 ge...  42.0    0.021 
PHCA:scaffold_2 PHYCAscaffold_2                                       42.0    0.023 
APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_a...  41.6    0.025 
HYAP:scaffold_797 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  41.6    0.027 
SAPA:scaffold_2 supercont2.2 dna:supercontig supercontig:ASM15154...  41.6    0.031 
PYIW:scaffold_649 piw_scaffold_649 dna:supercontig supercontig:pi...  41.2    0.035 
PHCA:scaffold_18 PHYCAscaffold_18                                     41.2    0.035 
PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 u...  41.2    0.036 
PHSO:scaffold_2                                                       41.2    0.038 
APAS:scaffold_5 supercont1.5 dna:supercontig supercontig:Apha_ast...  41.2    0.039 
PHRA:scaffold_38                                                      41.2    0.040 
PHKE:scaffold_626 scf_22126_626.1_contig_1 dna:supercontig superc...  41.2    0.041 
PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 ge...  41.2    0.041 
HYAP:scaffold_72 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  41.2    0.041 
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  40.8    0.044 
ALLA:FR824181 dna:supercontig supercontig:ENA1:FR824181:1:68077:1...  40.8    0.044 
ALLA:FR824176 dna:supercontig supercontig:ENA1:FR824176:1:68905:1...  40.8    0.044 
PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 gen...  40.8    0.047 
PHKE:scaffold_69 scf_22126_69.1 dna:supercontig supercontig:PhyKe...  40.8    0.054 
APIN:scaffold_8 supercont1.8 dna:supercontig supercontig:Apha_inv...  40.8    0.054 
PLHA:NW_020187174.1 Plasmopara halstedii genome assembly, contig:...  40.8    0.055 
PHCA:scaffold_106 PHYCAscaffold_106                                   40.4    0.058 
PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:p...  40.4    0.061 
ALCA:scaffold_34 AcNc2_CONTIG_34_length_127434 dna:supercontig su...  40.4    0.061 
PYUU:scaffold_2034 scf1117875582034 dna:supercontig supercontig:p...  40.4    0.072 
PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 ...  40.0    0.079 
PYIR:scaffold_1 pir_scaffold_1 dna:supercontig supercontig:pir_sc...  40.0    0.083 
PHRA:scaffold_4                                                       40.0    0.083 
PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:p...  40.0    0.084 
PHPA:scaffold_53 NW_008649039.1 Phytophthora parasitica INRA-310 ...  40.0    0.089 
PHCA:scaffold_9 PHYCAscaffold_9                                       40.0    0.089 
PHIF:NW_003303755.1 Phytophthora infestans T30-4 supercont1.4 gen...  40.0    0.091 
ALCA:scaffold_265 AcNc2_CONTIG_265_length_35910 dna:supercontig s...  40.0    0.094 
PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig:...  39.7    0.099 
ALLA:FR824502 dna:supercontig supercontig:ENA1:FR824502:1:15894:1...  39.7    0.10  
PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig:...  39.7    0.11  
PYVX:scaffold_378 pve_scaffold_378 dna:supercontig supercontig:pv...  39.3    0.13  
PHKE:scaffold_90 scf_22126_90.1 dna:supercontig supercontig:PhyKe...  39.3    0.13  
PYVX:scaffold_291 pve_scaffold_291 dna:supercontig supercontig:pv...  39.3    0.14  
HYAP:scaffold_99 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_9...  39.3    0.14  
SAPA:scaffold_37 supercont2.37 dna:supercontig supercontig:ASM151...  39.3    0.14  
PYAP:scaffold_792 pag1_scaffold_792 dna:supercontig supercontig:p...  39.3    0.14  
PYAR:scaffold_1116 par_scaffold_1116 dna:supercontig supercontig:...  39.3    0.14  
PYIR:scaffold_3100 pir_scaffold_3100 dna:supercontig supercontig:...  38.9    0.14  
ALLA:FR824471 dna:supercontig supercontig:ENA1:FR824471:1:18709:1...  39.3    0.16  
PHKE:scaffold_269 scf_22126_269.1_contig_1 dna:supercontig superc...  38.9    0.18  
PYIW:scaffold_1215 piw_scaffold_1215 dna:supercontig supercontig:...  38.9    0.18  
PYUU:scaffold_2006 scf1117875582006 dna:supercontig supercontig:p...  38.9    0.19  
SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_di...  38.9    0.20  
SAPA:scaffold_467 supercont2.467 dna:supercontig supercontig:ASM1...  38.9    0.21  
PHIF:NW_003303710.1 Phytophthora infestans T30-4 supercont1.49 ge...  38.5    0.23  
PYVX:scaffold_1190 pve_scaffold_1190 dna:supercontig supercontig:...  38.5    0.25  
PYVX:scaffold_44 pve_scaffold_44 dna:supercontig supercontig:pve_...  38.5    0.25  
PHPA:scaffold_98 NW_008649084.1 Phytophthora parasitica INRA-310 ...  38.5    0.27  
SAPA:scaffold_273 supercont2.273 dna:supercontig supercontig:ASM1...  38.5    0.29  
SADI:scaffold_72 supercont1.72 dna:supercontig supercontig:Sap_di...  38.5    0.29  
ALCA:scaffold_55 AcNc2_CONTIG_55_length_103441 dna:supercontig su...  38.5    0.29  
SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154...  38.1    0.30  
PYVX:scaffold_47 pve_scaffold_47 dna:supercontig supercontig:pve_...  38.1    0.31  
PHSO:scaffold_3                                                       38.1    0.32  
APIN:scaffold_71 supercont1.71 dna:supercontig supercontig:Apha_i...  38.1    0.34  
PYIR:scaffold_1235 pir_scaffold_1235 dna:supercontig supercontig:...  38.1    0.35  
PYUU:scaffold_1722 scf1117875581722 dna:supercontig supercontig:p...  38.1    0.36  
PHRA:scaffold_66                                                      38.1    0.37  
HYAP:scaffold_29 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_2...  38.1    0.38  
PHKE:scaffold_58 scf_22126_58.1 dna:supercontig supercontig:PhyKe...  37.7    0.40  
PHRA:scaffold_16                                                      37.7    0.40  
PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:p...  37.7    0.42  
APAS:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_ast...  37.7    0.43  
ALCA:scaffold_464 AcNc2_CONTIG_464_length_18313 dna:supercontig s...  37.7    0.45  
PHPA:scaffold_2 NW_008648988.1 Phytophthora parasitica INRA-310 u...  37.7    0.51  
PLHA:NW_020190023.1 Plasmopara halstedii genome assembly, contig:...  37.4    0.55  
SAPA:scaffold_70 supercont2.70 dna:supercontig supercontig:ASM151...  37.4    0.56  
PYIR:scaffold_1853 pir_scaffold_1853 dna:supercontig supercontig:...  37.4    0.57  
APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_a...  37.4    0.58  
PYAP:scaffold_11 pag1_scaffold_11 dna:supercontig supercontig:pag...  37.4    0.60  
APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_i...  37.4    0.60  
ALCA:scaffold_13 AcNc2_CONTIG_13_length_192192 dna:supercontig su...  37.4    0.64  
PHCA:scaffold_27 PHYCAscaffold_27                                     37.0    0.69  
HYAP:scaffold_312 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  37.0    0.71  
SADI:scaffold_77 supercont1.77 dna:supercontig supercontig:Sap_di...  37.0    0.76  
APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_ast...  37.0    0.88  
APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_i...  37.0    0.89  
SADI:scaffold_17 supercont1.17 dna:supercontig supercontig:Sap_di...  36.6    0.90  
HYAP:scaffold_46 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_4...  36.6    0.91  
PHCA:scaffold_72 PHYCAscaffold_72                                     36.6    0.94  
PYAR:scaffold_951 par_scaffold_951 dna:supercontig supercontig:pa...  36.6    0.99  
PYUU:scaffold_2025 scf1117875582025 dna:supercontig supercontig:p...  36.6    1.0   
SADI:scaffold_20 supercont1.20 dna:supercontig supercontig:Sap_di...  36.6    1.0   
SADI:scaffold_1 supercont1.1 dna:supercontig supercontig:Sap_dicl...  36.6    1.0   
PYIW:scaffold_735 piw_scaffold_735 dna:supercontig supercontig:pi...  36.2    1.2   
PYAP:scaffold_87 pag1_scaffold_87 dna:supercontig supercontig:pag...  36.2    1.2   
APAS:scaffold_36 supercont1.36 dna:supercontig supercontig:Apha_a...  36.2    1.2   
APAS:scaffold_22 supercont1.22 dna:supercontig supercontig:Apha_a...  36.2    1.3   
PYAR:scaffold_799 par_scaffold_799 dna:supercontig supercontig:pa...  36.2    1.3   
PHCA:scaffold_42 PHYCAscaffold_42                                     36.2    1.5   
PHRA:scaffold_3                                                       36.2    1.5   
PYIR:scaffold_78 pir_scaffold_78 dna:supercontig supercontig:pir_...  36.2    1.5   
PYIW:scaffold_784 piw_scaffold_784 dna:supercontig supercontig:pi...  35.8    1.5   
SADI:scaffold_8 supercont1.8 dna:supercontig supercontig:Sap_dicl...  35.8    1.6   
PYAR:scaffold_995 par_scaffold_995 dna:supercontig supercontig:pa...  35.8    1.7   
PYIW:scaffold_1511 piw_scaffold_1511 dna:supercontig supercontig:...  35.8    1.7   
PHPA:scaffold_25 NW_008649011.1 Phytophthora parasitica INRA-310 ...  35.8    1.8   
PYIR:scaffold_47 pir_scaffold_47 dna:supercontig supercontig:pir_...  35.8    1.8   
ALLA:FR824107 dna:supercontig supercontig:ENA1:FR824107:1:102118:...  35.8    1.8   
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  35.8    1.8   
PYIR:scaffold_12 pir_scaffold_12 dna:supercontig supercontig:pir_...  35.8    1.8   
APIN:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_inv...  35.8    1.9   
SAPA:scaffold_40 supercont2.40 dna:supercontig supercontig:ASM151...  35.8    2.0   
PYAR:scaffold_122 par_scaffold_122 dna:supercontig supercontig:pa...  35.8    2.0   
ALCA:scaffold_25 AcNc2_CONTIG_25_length_153538 dna:supercontig su...  35.8    2.0   
PHKE:scaffold_238 scf_22126_238.1_contig_1 dna:supercontig superc...  35.8    2.0   
PYAP:scaffold_549 pag1_scaffold_549 dna:supercontig supercontig:p...  35.4    2.1   
PYIW:scaffold_651 piw_scaffold_651 dna:supercontig supercontig:pi...  35.4    2.1   
SADI:scaffold_66 supercont1.66 dna:supercontig supercontig:Sap_di...  35.4    2.2   
PHKE:scaffold_452 scf_22126_452.1_contig_1 dna:supercontig superc...  35.4    2.2   
PYVX:scaffold_1 pve_scaffold_1 dna:supercontig supercontig:pve_sc...  35.4    2.3   
PHCA:scaffold_14 PHYCAscaffold_14                                     35.4    2.5   
PHRA:scaffold_22                                                      35.4    2.5   
PHIF:NW_003303746.1 Phytophthora infestans T30-4 supercont1.13 ge...  35.4    2.6   
SADI:scaffold_15 supercont1.15 dna:supercontig supercontig:Sap_di...  35.4    2.6   
SAPA:scaffold_6 supercont2.6 dna:supercontig supercontig:ASM15154...  35.4    2.7   
PYAP:scaffold_200 pag1_scaffold_200 dna:supercontig supercontig:p...  35.0    2.7   
PYAR:scaffold_1067 par_scaffold_1067 dna:supercontig supercontig:...  35.0    2.8   
PYIR:scaffold_94 pir_scaffold_94 dna:supercontig supercontig:pir_...  35.0    2.8   
PYAP:scaffold_39 pag1_scaffold_39 dna:supercontig supercontig:pag...  35.0    2.9   
PYAP:scaffold_747 pag1_scaffold_747 dna:supercontig supercontig:p...  35.0    3.0   
SAPA:scaffold_181 supercont2.181 dna:supercontig supercontig:ASM1...  35.0    3.0   
HYAP:scaffold_242 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  35.0    3.0   
PYAP:scaffold_926 pag1_scaffold_926 dna:supercontig supercontig:p...  35.0    3.1   
PYIW:scaffold_525 piw_scaffold_525 dna:supercontig supercontig:pi...  35.0    3.1   
PLHA:NW_020187350.1 Plasmopara halstedii genome assembly, contig:...  35.0    3.2   
PHRA:scaffold_96                                                      35.0    3.3   
PHIF:NW_003303749.1 Phytophthora infestans T30-4 supercont1.10 ge...  35.0    3.3   
ALCA:scaffold_49 AcNc2_CONTIG_49_length_115235 dna:supercontig su...  35.0    3.3   
PHPA:scaffold_6 NW_008648992.1 Phytophthora parasitica INRA-310 u...  35.0    3.3   
HYAP:scaffold_167 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  35.0    3.3   
ALLA:FR824348 dna:supercontig supercontig:ENA1:FR824348:1:31264:1...  35.0    3.5   
APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_a...  35.0    3.5   
PHIF:NW_003303653.1 Phytophthora infestans T30-4 supercont1.106 g...  34.7    3.6   
PYAR:scaffold_5711 par_scaffold_5711 dna:supercontig supercontig:...  34.3    3.6   
HYAP:scaffold_322 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  34.7    3.8   
ALCA:scaffold_29 AcNc2_CONTIG_29_length_140563 dna:supercontig su...  34.7    3.8   
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  34.7    3.8   
SAPA:scaffold_5 supercont2.5 dna:supercontig supercontig:ASM15154...  34.7    3.9   
PHRA:scaffold_35                                                      34.7    4.0   
PYAR:scaffold_267 par_scaffold_267 dna:supercontig supercontig:pa...  34.7    4.1   
SADI:scaffold_25 supercont1.25 dna:supercontig supercontig:Sap_di...  34.7    4.1   
PHRA:scaffold_82                                                      34.7    4.5   
PYVX:scaffold_912 pve_scaffold_912 dna:supercontig supercontig:pv...  34.3    4.7   
APAS:scaffold_47 supercont1.47 dna:supercontig supercontig:Apha_a...  34.3    4.7   
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  34.3    5.2   
PHKE:scaffold_26 scf_22126_26.1 dna:supercontig supercontig:PhyKe...  34.3    5.2   
PYVX:scaffold_35 pve_scaffold_35 dna:supercontig supercontig:pve_...  34.3    5.6   
PHCA:scaffold_82 PHYCAscaffold_82                                     34.3    5.9   
PYIR:scaffold_753 pir_scaffold_753 dna:supercontig supercontig:pi...  33.9    6.1   
PLHA:NW_020187532.1 Plasmopara halstedii genome assembly, contig:...  33.9    6.2   
PHSO:scaffold_13                                                      33.9    6.4   
PYVX:scaffold_158 pve_scaffold_158 dna:supercontig supercontig:pv...  33.9    6.4   
APIN:scaffold_59 supercont1.59 dna:supercontig supercontig:Apha_i...  33.9    6.7   
PLHA:NW_020187331.1 Plasmopara halstedii genome assembly, contig:...  33.9    7.1   
ALCA:scaffold_110 AcNc2_CONTIG_110_length_72385 dna:supercontig s...  33.9    7.3   
SAPA:scaffold_16 supercont2.16 dna:supercontig supercontig:ASM151...  33.9    7.7   
SAPA:scaffold_1 supercont2.1 dna:supercontig supercontig:ASM15154...  33.9    7.9   
PHRA:scaffold_67                                                      33.5    8.4   
APAS:scaffold_25 supercont1.25 dna:supercontig supercontig:Apha_a...  33.5    8.4   
APIN:scaffold_10 supercont1.10 dna:supercontig supercontig:Apha_i...  33.5    8.5   
HYAP:scaffold_152 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  33.5    8.9   
ALLA:FR824197 dna:supercontig supercontig:ENA1:FR824197:1:60032:1...  33.5    9.0   
ALLA:FR824109 dna:supercontig supercontig:ENA1:FR824109:1:99844:1...  33.5    9.9   

>PHRA:scaffold_56
Length=334739

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/349 (100%), Positives = 349/349 (100%), Gaps = 0/349 (0%)
 Frame = +1

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC
Sbjct  150211  MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  150390

Query  61      HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
               HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG
Sbjct  150391  HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  150570

Query  121     DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
               DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN
Sbjct  150571  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  150750

Query  181     KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
               KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP
Sbjct  150751  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  150930

Query  241     TLHLFSDDSRPKSTASKGHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGELE  300
               TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE
Sbjct  150931  TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE  151110

Query  301     VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
               VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF
Sbjct  151111  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  151257

>PHSO:scaffold_1
Length=13391543

 Score = 618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/349 (87%), Positives = 323/349 (93%), Gaps = 1/349 (0%)
 Frame = -3

Query  1        MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
                MNILRVPE+GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GSNL +SYYESRAAC
Sbjct  2800809  MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  2800630

Query  61       HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
                HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAP+KGYVELDVFVET  
Sbjct  2800629  HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  2800450

Query  121      DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
                DRNKWLEVARNALSAKRQLTRQAIDQSVS N+KNLFGF +SLSPQP M+PQKQMQTLT++
Sbjct  2800449  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  2800270

Query  181      KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
                +DELLS ALRDIEAAK VGREACNEIV QGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  2800269  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  2800090

Query  241      TLHLFSDDSRPKSTASKGHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGELE  300
                TLHLFSDDSRPK++ASK  S  +  Q  G P RLPPAM++INDAGVSDLERLAQALGELE
Sbjct  2800089  TLHLFSDDSRPKASASKA-SSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELE  2799913

Query  301      VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
                VQAE+LNGEAGR TQQIER+EHQLSNVTARVEKQTKQASA L +GP+LF
Sbjct  2799912  VQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  2799766

 Score = 42.4 bits (98),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
                EGYVTKRGH  ++W++RF  LEG+ +  ++
Sbjct  4067582  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  4067493

 Score = 41.2 bits (95),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21        TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                 T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  10838671  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  10838775

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 1/33 (3%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                G++TK+GH  KSW+ RF VL  S+   +YY+++
Sbjct  5553311  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNK  5553216

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/351 (85%), Positives = 317/351 (90%), Gaps = 2/351 (1%)
 Frame = -1

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  251923  MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  251744

Query  61      HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
               HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  251743  HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  251564

Query  121     DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
               DRNKWLEVARNALS KRQLTRQAIDQSVS NKK LFGF V+LSPQP M+PQKQMQTL ++
Sbjct  251563  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  251384

Query  181     KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
               KDELLS ALR++EAAKLVGREACNEIVIQGEKLD IEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  251383  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  251204

Query  241     TLHLFSDDSRPKST-ASKGHs-pqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGE  298
               TLHLFSDDSRPKST  SKG S  +  Q  G SPSRLPPA +T +DAG SDLERLAQALGE
Sbjct  251203  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  251024

Query  299     LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
               LEVQAE+LNGEA  S+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  251023  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  250871

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/351 (84%), Positives = 318/351 (91%), Gaps = 2/351 (1%)
 Frame = -2

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               MNILRVPE GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  431957  MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  431778

Query  61      HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
               HPP  +PSAPKG FYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  431777  HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  431598

Query  121     DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
               DRNKWLEVARNAL AKRQLTRQAIDQSVS  KKNLFGF VSLSPQP M+PQKQ+QTL+++
Sbjct  431597  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  431418

Query  181     KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
               KDELLS ALR++EAAKLVGREACNEIV+QGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  431417  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  431238

Query  241     TLHLFSDDSRPKSTASKGHspqrsqqsg--gspsrLPPAMETINDAGVSDLERLAQALGE  298
               TLHLFSDDSRPKST S   S  +        SP+RLPPA+E  +DAGVSDLERLAQALGE
Sbjct  431237  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  431058

Query  299     LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
               LEVQAE+LNGEAGRS+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  431057  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  430905

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/351 (83%), Positives = 312/351 (89%), Gaps = 2/351 (1%)
 Frame = -2

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               MNILRVPE+GA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  101319  MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  101140

Query  61      HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
               HP   E S PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKM+GHAPKKGYVELDVFVET G
Sbjct  101139  HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  100960

Query  121     DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
               DRNKWLEVARNALSAKRQLTRQAIDQSVS NKKNLFGF VSLSPQP ++PQKQMQTLT+N
Sbjct  100959  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  100780

Query  181     KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
               KD+LLS ALRDIEAAK +GREACNEIVIQGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  100779  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  100600

Query  241     TLHLFSDDSRPKSTASK--GHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGE  298
               TLH+FS+DSRPKST+S       +  Q  G SP+RL  A E+  D G SDLERLAQALGE
Sbjct  100599  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  100420

Query  299     LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
               LE+QAE+LN EAG STQQI+ +EH LS VT RVEKQTKQASATLRAGP+LF
Sbjct  100419  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  100267

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/351 (77%), Positives = 304/351 (87%), Gaps = 2/351 (1%)
 Frame = -1

Query  1      MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
              MNILRVPE+GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GS+LQ+SY+ESR AC
Sbjct  68197  MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSDLQVSYFESRTAC  68018

Query  61     HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
              HPP  E  A KGSFYLS+I PHEYVVGVMGAA KPFGFKM+GHAP+KGYVELDVFVET  
Sbjct  68017  HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  67838

Query  121    DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
              DRNKWLEVARNAL AKRQ+ RQAIDQSVS  KK +FGFG+SLSPQPL+ PQKQ+Q LT N
Sbjct  67837  DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  67658

Query  181    KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
              K+ELL+ ALR++EAAK+VGREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  67657  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  67478

Query  241    TLHLFSDDSRPKSTASKGHspqrsqqsggsps--rLPPAMETINDAGVSDLERLAQALGE  298
              TLHLFSDD+RPKS A+   S  +        +   LP +M + NDA  SDLERLA ALGE
Sbjct  67477  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  67298

Query  299    LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
              LE+QAE+LNGEAGRSTQQI R+E QLSNVTARVEKQTKQASATL AGP+LF
Sbjct  67297  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  67145

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 545 bits (1405),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 271/349 (78%), Positives = 297/349 (85%), Gaps = 4/349 (1%)
 Frame = +1

Query  1        MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
                MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  1844377  MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  1844556

Query  61       HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
                HPP  E + PKGSFYLS+IEPHEYV+GVMGAA +PFGFKM+GHAP+KG+VELDVFVETQ 
Sbjct  1844557  HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  1844736

Query  121      DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180
                DRNKWLEVA NAL AKRQLTRQAIDQSVS NKK LFGF V  S QP+M+PQKQMQTL  +
Sbjct  1844737  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  1844916

Query  181      KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240
                K+ LL  ALR+IEAAKLVGREACNEIV QGEKLD IEQDL AIDRDLDFGDKLL RLKSP
Sbjct  1844917  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  1845096

Query  241      TLHLFSDDSRPKSTASKGHspqrsqqsggspsrLPPAMETINDAGVSDLERLAQALGELE  300
                TLH FSDD+RPK                 SPSRL PA+E   DAGVSDL+RLAQALGELE
Sbjct  1845097  TLHFFSDDTRPKVPLGD----HPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELE  1845264

Query  301      VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
                VQAE+LN E+G S+QQIER+EH LS+VT RVEKQTKQA ATL AGP+LF
Sbjct  1845265  VQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  1845411

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (47%), Gaps = 19/116 (16%)
 Frame = +1

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
                P +C GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  1586851  PVACAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  1586994

Query  80       EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                     V  V    G+PFGF  + +     Y    V+ +   +R KW+  A N ++A
Sbjct  1586995  --EVLVEDVQKWEGEPFGFMFVTNEQVPYY----VYADNDRERTKWMN-ALNKINA  1587141

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (46%), Gaps = 23/111 (21%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
                CEGY+TKRGH   +W+ R+  L G+ L+  Y+ S         E S   G+         
Sbjct  1586275  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YFSSE--------EKSKKYGAV--------  1586400

Query  83       EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                  V  V   +G+  GF    +  K+  +   V+  ++ +R+KWL   ++ +
Sbjct  1586401  -TVEKVATWSGESHGFMF--YTSKQ--IPYYVYASSEAERSKWLRALKDFM  1586538

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  22       SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
                SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  1586557  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  1586643

 Score = 35.0 bits (79),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 71/184 (39%), Gaps = 49/184 (27%)
 Frame = +2

Query  23       CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA-------CHPPAAEPSAPKGSFY  75
                C G++ K G   KSW+ R+  L GS L  SYY+S+              A PS   G   
Sbjct  1060886  CVGWLKKEGKNVKSWKWRYFTLYGSKL--SYYKSKTKTLLRSVIVENVVAHPSISLG---  1061050

Query  76       LSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                         +V  +G      G K++               E++ + NKWL+  + A++ 
Sbjct  1061051  --------LIVSTVG------GRKLLIRG------------ESKDEFNKWLDAIQAAVTV  1061152

Query  136      KRQ---------LTRQAIDQSVSSNKKNLFGFGVSLSP--QPLMTPQKQMQTLTQNKDEL  184
                +R+         +T   +D   S + K+   F   L    Q   T +K+  T+  N    
Sbjct  1061153  ERRRKSTVVETPMTNMVLDCRSSLDLKSSTSFNGWLEKEGQRFKTWKKRFFTVKNNALIY  1061332

Query  185      LSGA  188
                 SG+
Sbjct  1061333  YSGS  1061344

 Score = 34.3 bits (77),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
                P +  G+V K G   +SW+ RFLV +G+ L  +YY++
Sbjct  1063460  PATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  1063564

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 202 bits (514),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 114/145 (79%), Gaps = 4/145 (3%)
 Frame = -1

Query  1        MNILRVPEIGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
                MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV  G++LQ+SY+ESR A
Sbjct  1308343  MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  1308164

Query  60       CHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQ  119
                 H P    + PKGSFY+SS+E HEY +GVMG   KPFGFK++GHAP KGY+ELD+FVE+ 
Sbjct  1308163  AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  1307993

Query  120      GDRNKWLEVARNALSAKRQLTRQAI  144
                 D NKWLEV +NAL A ++LTR+ +
Sbjct  1307992  PDVNKWLEVVQNALDAAKKLTRKGM  1307918

 Score = 154 bits (390),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 131/223 (59%), Gaps = 36/223 (16%)
 Frame = -3

Query  153      KNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQG--  210
                K++FGFG S+SPQ       Q++ L   K+ELL  ALR+IE AKL+GREA NEIV QG  
Sbjct  1307822  KSMFGFGASISPQL------QVKKLAATKEELLREALREIEGAKLIGREAVNEIVSQGGT  1307661

Query  211      ----------------------EKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDD  248
                                      EKLD +E DLG ++ DLD  DKLLR LKSP LH+FS+D
Sbjct  1307660  SSFHNQLSASAKTKLLVSIGAVEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSND  1307481

Query  249      SRPKSTASKGHspqrsqqsggspsrLP------PAMETINDAGVSDLERLAQALGELEVQ  302
                +R K  A    +   S  +  + S +        A  T     ++DLE LA AL ELE Q
Sbjct  1307480  NRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQ  1307301

Query  303      AEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAG  345
                A ++N EA RST+QI R+E +L++V  RV+ QTK+A+AT++AG
Sbjct  1307300  ANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  1307172

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 196 bits (497),  Expect(3) = 2e-88, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 113/151 (75%), Gaps = 10/151 (7%)
 Frame = +1

Query  1       MNILRVPEIGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
               MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV  G+NLQ++YY
Sbjct  101374  MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  101553

Query  55      ESRAACHPPAAEPS----APKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYV  110
               ESR A    ++        PKGSFY+SS+E HEY VGVMG   KPFGFK++GHAPKKGY+
Sbjct  101554  ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  101733

Query  111     ELDVFVETQGDRNKWLEVARNALSAKRQLTR  141
               ELD+FVE+ GD NKW+EV +NAL A ++ +R
Sbjct  101734  ELDIFVESLGDLNKWVEVVQNALDAAKKRSR  101826

 Score = 112 bits (280),  Expect(3) = 2e-88, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 93/148 (63%), Gaps = 11/148 (7%)
 Frame = +3

Query  211     EKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSR----PKSTASKGHspqrsqq  266
               EKLD +E DLG ++ DLD  DKLLR +K P LHLFS D R    P +  + GH+ + S  
Sbjct  102210  EKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHG  102389

Query  267     sggspsrLPPAMETI-----NDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVE  321
                    +    A         NDA +SDLE+LA ALGELE QA ++N EA +ST+QI RVE
Sbjct  102390  QTPGTTNGGTAGGQQIHGQRNDA-LSDLEKLALALGELEEQANLMNAEAVKSTEQIARVE  102566

Query  322     HQLSNVTARVEKQTKQASATLRAGPKLF  349
                +L+ V  RV+ QTK+A+AT++AG  LF
Sbjct  102567  QRLTAVNDRVQTQTKKANATMKAG-NLF  102647

 Score = 63.2 bits (152),  Expect(3) = 2e-88, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +2

Query  149     SSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVI  208
               +S  K +FGF  S SPQ       Q++ L   K++LL  ALR+IE AKL+GREA NEIV+
Sbjct  101945  NSTTKTMFGFSASASPQ------LQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVV  102106

Query  209     QGEKLDAI  216
               QG  L A 
Sbjct  102107  QGGALLAC  102130

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 249 bits (636),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 157/220 (71%), Gaps = 22/220 (10%)
 Frame = -1

Query  1      MNILRVPEIGATA----------SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              MNILR+P +GAT+               +PTSCEGYVTKRGHFRKSWRVRFLVL G++L 
Sbjct  20697  MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  20521

Query  51     ISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYV  110
              +SYY+S+       A    PKGSFYLSS+E HEY VGV+GA  KPFGFKM+GHAP+KGYV
Sbjct  20520  VSYYDSKEVARTAGA---VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  20350

Query  111    ELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTP  170
              ELD+FVET GD NKWLEV +NAL A ++LTR    ++++   K+LFGF       P  +P
Sbjct  20349  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGF------SPATSP  20194

Query  171    QKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQG  210
              Q+QM+ +T  K+++L  A+ +IE+AKL+GR AC EI IQG
Sbjct  20193  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQG  20074

 Score = 100 bits (248),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = -2

Query  211    EKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKS-----TASKGHspqrsq  265
              E+LD I Q+L  ++ DLD+ DKLLR +K+P LH+FS D+R ++     T         + 
Sbjct  20015  ERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAV  19836

Query  266    qsggspsrLPPAMETINDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLS  325
                    + L  + + +  A +SD+ERLA  LGELE QA +LN EA + T Q+ERV  QL+
Sbjct  19835  SEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLA  19656

Query  326    NVTARVEKQTKQASATL  342
              +V  RV+ QT++A+A++
Sbjct  19655  HVNERVKAQTRKANASI  19605

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 293 bits (750),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 177/236 (75%), Gaps = 14/236 (6%)
 Frame = +2

Query  19    RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
             RPTSCEGYVTKRGHFRKSWRVR+LVL+G++L+++Y+ES+ A    AA     KG FYLSS
Sbjct  1547  RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAAS----KGEFYLSS  1714

Query  79    IEPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
             I+ H YV G MGA G   KPFGFKM+GHAPKKGY ELD+FVET  D  KWLEVA NAL +
Sbjct  1715  IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  1894

Query  136   KRQLTRQAI-DQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEA  194
                ++R+A  D   S+  K+LFGF  + SPQ      +Q++ ++ +KDELL  ALR++E 
Sbjct  1895  AAAMSRKAAGDGGGSATTKSLFGFSTTTSPQ------QQLKAMSVSKDELLKDALRELEG  2056

Query  195   AKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSR  250
             AKL+GREAC E+V+QGEKLD IE +LG I+ DLD+GDKLLRRLKSP LHL + D R
Sbjct  2057  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR  2224

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  297   GELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349
             GELE QA +LNGEA RSTQQI R+E +L+ V  RV++QTKQA++ ++ G  +F
Sbjct  2415  GELEAQATLLNGEAVRSTQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  2573

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 217 bits (553),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +1

Query  33     FRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAA  92
              FRKSWRVR+LVL G++L +SY++S+     P A   +PKGSFYLSS+E HEYVVGV+GA 
Sbjct  16051  FRKSWRVRYLVLNGADLCVSYFDSKDVARTPGA---SPKGSFYLSSVEKHEYVVGVLGAQ  16221

Query  93     GKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNK  152
               KPFGFKM+GHAP+KGYVELD+FVE++GD  KWLEV ++AL+A ++LTR  +  + S+  
Sbjct  16222  KKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--  16395

Query  153    KNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQG  210
              K+LFGF       P  +PQKQ+Q L+ +K+ELL  A+ +IE+AKL+GREAC EIV+QG
Sbjct  16396  KSLFGF------SPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQG  16551

 Score = 92.0 bits (227),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = +3

Query  208    IQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTASKGHspqrsqqs  267
              +  EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++AS  HSP +S+QS
Sbjct  16614  LHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKSKQS  16793

Query  268    ggspsrLPPAM-ETINDAG--VSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQL  324
                S +    A+ + +  A   +SD+ERLA  LGELE QA +LN EA R T Q+ERV   L
Sbjct  16794  ALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDAL  16973

Query  325    SNVTARVEKQTKQASATLR  343
              +++  RV+ QTK+A    R
Sbjct  16974  AHINERVQNQTKKADVANR  17030

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 256 bits (654),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 197/320 (62%), Gaps = 48/320 (15%)
 Frame = -3

Query  65     AEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNK  124
              A P+ PKGSF++SS+E HEY VGVMG   KPFGFK++GHAPKKGY+ELD+FVET GD NK
Sbjct  11423  ASPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK  11244

Query  125    WLEVARNALSAKRQLTRQ--AIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKD  182
              W+EV +NAL A ++ TR   A D   SS  KN+FGF  ++SPQ       Q++ L   K+
Sbjct  11243  WVEVVQNALDAAKKHTRTPGAAD---SSTTKNMFGFSATVSPQL------QVKKLAATKE  11091

Query  183    ELLSGALRDIEAAKLVGREACNEIVIQG--------------------------EKLDAI  216
              ELL  ALR+IE AKL+GREA ++I  QG                           KL+ I
Sbjct  11090  ELLRDALREIEGAKLIGREAVSDIKGQGGLWS*VAVVCGGYPGSRLITSCW*CPGKLNMI  10911

Query  217    EQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTA--SKGHspqrsqqsggspsrL  274
              E DLG ++ DLD G KLL  +K P LHLFS+D+R K  A  S  HS  +   SG  PS  
Sbjct  10910  EDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSG  10731

Query  275    PPAMETINDAG---------VSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLS  325
                + ET   A          +SDLERL  ALGELE QA  +N EA +ST+QI RVE +L+
Sbjct  10730  GSSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLT  10551

Query  326    NVTARVEKQTKQASATLRAG  345
               V  RV+ QTK+A+AT++AG
Sbjct  10550  AVNDRVQAQTKKATATMKAG  10491

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = -2

Query  1      MNILRVPEIGATAS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
              MNILRVP++    S    GDK + TSCEGYVTKRGHFRKSWRVR+LV  G++LQ +Y
Sbjct  11802  MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAY  11632

>ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:1 
REF
Length=105594

 Score = 184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 129/209 (62%), Gaps = 24/209 (11%)
 Frame = +1

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
              PTSCEGYVTKRGHFRKSWRVR+LV+ G N+Q+SYYES+ +     ++ + PKGSF L S 
Sbjct  11308  PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDS---SKSKNATPKGSFILQSA  11478

Query  80     EPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
              E HEY +  M       KPFGFKM+GHAPK+GY+ELDVFV++  D ++WL+V  N L A 
Sbjct  11479  EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  11658

Query  137    RQLTRQAIDQSVSSNKK-------NLFGFGVSLSPQPLM--------TPQKQMQTLTQNK  181
              + + R+A    ++ NK        +L  F V +     +        T ++Q+Q L   K
Sbjct  11659  KCMAREAF---MAGNKIFSLLRQ*DLTSFFVEMDTTKSVLGFSYIGTTSKQQIQVLKSKK  11829

Query  182    DELLSGALRDIEAAKLVGREACNEIVIQG  210
               + +  AL+ IE AK  G  AC+EIV QG
Sbjct  11830  CDYIHEALQQIEMAKSAGNAACDEIVSQG  11916

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  287    SDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQ  337
              +D+E+LA AL +LEVQA+++N EA +S +QI R+E QLS +  R++ QT Q
Sbjct  12266  NDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQ  12418

>ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_90_length_79489:1:79489:1 
REF
Length=79489

 Score = 153 bits (386),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 6/128 (5%)
 Frame = +3

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
             PTSCEGYVTKRGHFRKSWRVR+LV+ G  +Q+SYYES+ +     A    PKGSF L ++
Sbjct  8589  PTSCEGYVTKRGHFRKSWRVRYLVICGVTMQVSYYESKDSYKNRNA---TPKGSFILQNV  8759

Query  80    EPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
             E HEY +  M       +PFGFKM+GHAPK+GYVELDVFV++  + ++WL+V  N L A 
Sbjct  8760  EKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQWLDVINNGLKAN  8939

Query  137   RQLTRQAI  144
             +++ R+A 
Sbjct  8940  KRMAREAF  8963

 Score = 37.4 bits (85),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 5/60 (8%)
 Frame = +1

Query  153   KNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEK  212
             K + GF  + +     T ++Q++ L   K + +  AL+ IE AK  G  AC+EIV QG K
Sbjct  9040  KGVLGFSFAGT-----TSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGGK  9204

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  287   SDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASAT  341
             +DLE+LA AL ELEVQA+++N EA +S  QI R+E QLS +  R++ QT Q  A+
Sbjct  9552  NDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS  9716

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 112 bits (281),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 17/200 (9%)
 Frame = +2

Query  19      RPTSCEGYVTKR--GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76
               RP +    +  R  GH  KSWR R++VL+G  L++SY++S+       ++    KGSF L
Sbjct  204086  RPVAMTDTIAIRMIGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFIL  204256

Query  77      SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL---  133
               + IE H+Y     G   KP+GFK++GHAP  GY E  V+VET  D+ +WLEVA NAL   
Sbjct  204257  AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN  204430

Query  134     -----SAKRQLTR--QAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLS  186
                    SA ++ T    A  QS    K+  +  G   +   L +   Q++ + + K+ELL 
Sbjct  204431  VAPQASADQRATALLGAKLQSFM*RKE*RYLLGHRAASGFLTSAPVQLRNVNKTKEELLR  204610

Query  187     GALRDIEAAKLVGREACNEI  206
                A+  +E A+ VG    +E+
Sbjct  204611  KAIVTLEHARTVGDNTVSEM  204670

 Score = 47.8 bits (112),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 75/155 (48%), Gaps = 25/155 (16%)
 Frame = +1

Query  211     EKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSR-------PKSTASKGHspqr  263
               E LD  E ++  +  +LD GD +++++ SP  + FS           PKS +++ H PQ 
Sbjct  204727  EMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARSHLPQT  204906

Query  264     sqqsggspsrLP---------------PAMET---INDAGVSDLERLAQALGELEVQAEI  305
                  +  + + L                P  +T     DAG  +L++L++ L  LEV A  
Sbjct  204907  PMATILAMTLLRAHCL*NSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANT  205086

Query  306     LNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASA  340
               ++ E  R+T+QI+R++ ++     RV +Q+ +  A
Sbjct  205087  ISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  205191

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = -2

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
                G++ K+G   K+W+ RF+VL+  +L   Y+E+      P  +   PKGSF + +IE
Sbjct  1371042  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---PKGSFQVLAIE  1370896

 Score = 33.9 bits (76),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 7/42 (17%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE-----SRAAC  60
                EGY+ K+GH  K+WR R+  L  ++L  +YY+     SRA C
Sbjct  1238308  EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDVRTTSSRAFC  1238189

 Score = 33.9 bits (76),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
               G +TK+G F ++WR R+ +L      + YY S
Sbjct  394482  GNLTKQGSFWRTWRKRYFILRRDRPMLCYYSS  394387

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 134/293 (46%), Gaps = 69/293 (24%)
 Frame = -1

Query  17      KARPTSCEGYVTKRG--------------------HFRKSWRVRFLVLEGSNLQISYYES  56
               K   TSCEGYVTKRG                    H  KSW+ R++VL G  L +SYY+S
Sbjct  708409  KIHQTSCEGYVTKRGMLVHAVESSVWANKATTTLGHLMKSWKRRYMVLNGDTLLVSYYDS  708230

Query  57      RAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFV  116
               +            PKGSF LS  E  +  +   GA+ KPFGFK IGH P +GY E  V+V
Sbjct  708229  KEI----YTSKGHPKGSFVLSECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYV  708068

Query  117     ETQGDRNKWLEVARNAL---SAKRQLTRQAIDQ---------SVSSN--KKNLF---GFG  159
               E+Q D+ KWL VA NAL   S+ ++   Q I++         SV  N  ++++      G
Sbjct  708067  ESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLG  707888

Query  160     VSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQ----------  209
                  S   + + + QM+ + +   ELL  A+ D + A  +G    NE+V Q          
Sbjct  707887  HKESAGLMQSLEAQMKNVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEGRLYHVNMG  707708

Query  210     ---------GEKLDAIEQDLGAID---RDLDFGDKLLRRLKSPTL----HLFS  246
                        G   D +    G +D   R +D  + L R LK P L    HLF+
Sbjct  707707  MECTSVHMMGRPADVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILYKLTHLFT  707549

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 105 bits (263),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 8/121 (7%)
 Frame = -2

Query  31      GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMG  90
               GH  KSWR R++VL+G  L++SYY+S+       ++    KGSF L+ IE H+Y     G
Sbjct  394904  GHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAEIEKHDY--SDEG  394740

Query  91      AAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQA-IDQSVS  149
                  KP+GFK++GHAP  GY E  V+VET  D+ +WLEVA NAL   + +T QA +DQ  S
Sbjct  394739  GGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KNVTPQASVDQRAS  394566

Query  150     S  150
               +
Sbjct  394565  A  394563

 Score = 28.5 bits (62),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
 Frame = -1

Query  21      TSCEGYVTKRG  31
               TSCEGYVTKRG
Sbjct  394983  TSCEGYVTKRG  394951

 Score = 40.0 bits (92),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  282     NDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASA  340
                DAG  +L++L++ L  LEV A  ++ E  R+T+QI+R++ ++     R+ +Q+ +  A
Sbjct  394016  TDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  393840

 Score = 33.9 bits (76),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +3

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
               G +TK+G F ++WR R+ +L      + YY S
Sbjct  228981  GELTKQGSFWRTWRKRYFILRRDRPMLCYYSS  229076

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 96.7 bits (239),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 7/118 (6%)
 Frame = +2

Query  31      GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMG  90
               GH  K+W+ R++VL G  L ++YY+S+            PKGSF LS  E  +  +   G
Sbjct  399722  GHMMKTWKRRYMVLHGDTLLVAYYDSKEI----YKSNGPPKGSFVLSECEKQD--LSDEG  399883

Query  91      AAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSV  148
                + KPFGFK IGH P +GY E  VFVETQ D+ KWL VA NAL  K    +++I Q +
Sbjct  399884  GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL-GKTTSPQKSISQRI  400054

 Score = 28.5 bits (62),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +1

Query  17      KARPTSCEGYVTKRG  31
               K   TSCEGYVTKRG
Sbjct  399631  KIHQTSCEGYVTKRG  399675

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +2

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               M++L V +   T+S +  R TSC GY+ KRG    + + R+++L+ + L   YY++    
Sbjct  941441  MDVL-VLDTTNTSSQNNKR-TSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPEL  941608

Query  61      HPPAAEPSAPKGSFYLSSI  79
               +        P+GS +L ++
Sbjct  941609  NKGWFGKEKPRGSLHLGNV  941665

>PYAR:scaffold_2744 par_scaffold_2744 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2744:1:4396:1 
REF
Length=4396

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 20/123 (16%)
 Frame = +2

Query  13    ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
             A+ +   P +C GY+TK+GH RKSW+ R+ VL GS+  +SYY      + P  +P A   
Sbjct  3635  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLA---  3799

Query  73    SFYLSSIEPHEYVV-GVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARN  131
                       E V+  V    G+PFGF  +       Y    V+ + + +R KW+   R 
Sbjct  3800  ----------EVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALRK  3937

Query  132   ALS  134
               S
Sbjct  3938  LTS  3946

 Score = 42.0 bits (97),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 51/104 (49%), Gaps = 23/104 (22%)
 Frame = +2

Query  23    CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
             CEG++TKRGH   +W++R+ VL G+ L+  Y+         A E  + +   Y S +   
Sbjct  3080  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YF---------AGEDKSKR---YGSVV---  3208

Query  83    EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
               V  V   +G+  GF M   A +  Y    V+  ++ +R KWL
Sbjct  3209  --VEKVAAWSGEAHGF-MFYTAKQVPYY---VYASSESERAKWL  3322

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +2

Query  22    SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
             +CEGY+T+RGH   S R  + VL G++L+
Sbjct  3362  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  3448

>HYAP:scaffold_84 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_84:1:283758:1 
REF
Length=283758

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 55/116 (47%), Gaps = 19/116 (16%)
 Frame = -2

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ +L G NL ISYY      +     P A          
Sbjct  273449  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLA----------  273306

Query  80      EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                    V  V    G+PFGF  + +     Y    V+ +   +RNKW+  A N L+A
Sbjct  273305  --EVLVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWMN-ALNKLNA  273159

 Score = 42.7 bits (99),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 2/32 (6%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
               CEGY+TKRGH   +W+ R+  L G+ L+  YY
Sbjct  274025  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  273936

 Score = 40.8 bits (94),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 5/43 (12%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAA  59
               SCEGY+TKRGH   S R+ + VL G++L     Q +Y E+++A
Sbjct  273743  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  273615

>PHRA:scaffold_130
Length=94934

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 54/115 (47%), Gaps = 22/115 (19%)
 Frame = +2

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
              P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  64799  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLA----------  64942

Query  80     EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                   V  V    G+PFGF  + +     Y    V+ +   +RNKW+    NAL+
Sbjct  64943  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  65077

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 50/104 (48%), Gaps = 23/104 (22%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
              CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  64223  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  64372

Query  83     EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                       +G+  GF    +  K+  +   V+  ++G+R++WL
Sbjct  64373  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEGERSRWL  64465

 Score = 40.0 bits (92),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  64505  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  64591

>PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:pug:scf1117875582007:1:931704:1 
REF
Length=931704

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 56/115 (49%), Gaps = 22/115 (19%)
 Frame = -2

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ +L G NL ISYY      +    +P        L+ +
Sbjct  687695  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKP--------LAEV  687546

Query  80      EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                    V  V    G+PFGF  +        V   V+ +   +RNKW+    NALS
Sbjct  687545  A----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NALS  687417

 Score = 42.7 bits (99),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 23/104 (22%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               CEG++TKRGH   +W+ R+ VL G  L+  Y+           E +   GS  ++ + P 
Sbjct  688271  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFSGE--------EKNKKYGSVTVAKVAPW  688122

Query  83      EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                        +G+  GF    +  K+  +   V+  ++ +R+KWL
Sbjct  688121  ---------SGEAHGFMF--YTTKQ--IPYYVYAASEAERSKWL  688029

 Score = 38.9 bits (89),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (44%), Gaps = 29/114 (25%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAACHPPAAEPSAPKGSFYL  76
               SCEGY+T+RGH   S R+ + VL G++L     Q +Y ++++A                +
Sbjct  687989  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA----------------I  687858

Query  77      SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
               + +E    V  V    G+P G           Y   D    T G++ KWL+  +
Sbjct  687857  AEVE----VRSVAPWDGEPNGLMFQTSTGNVFYASTD----TVGEQQKWLQTVK  687720

>PHSO:scaffold_8
Length=3549547

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 54/116 (47%), Gaps = 19/116 (16%)
 Frame = +1

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
                P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  2527711  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLA----------  2527854

Query  80       EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                     V  V    G+PFGF  +        V   V+ +   +RNKW+  A N L+A
Sbjct  2527855  --EVLVEDVQKWDGEPFGFMFM----TTEQVPYYVYADNDRERNKWMN-ALNKLNA  2528001

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 51/111 (46%), Gaps = 23/111 (21%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
                CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+         
Sbjct  2527135  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAV--------  2527260

Query  83       EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                  V  V   +G+  GF    +  K+  +   V+  ++ +R++WL V +  +
Sbjct  2527261  -TVEKVATWSGEAHGFMF--YTTKQ--IPYYVYASSESERSRWLRVLKEYM  2527398

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  22       SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
                SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  2527417  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  2527503

>PYIW:scaffold_452 piw_scaffold_452 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_452:1:18197:1 
REF
Length=18197

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (49%), Gaps = 25/129 (19%)
 Frame = -3

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
             P SC GY+TK+GH RKSW+ R+ +L G NL I+Y+      +    +P        L+ +
Sbjct  1659  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKP--------LAEV  1510

Query  80    EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
                  V  V    G+PFGF  +        V   V+ +   +RNKW+    NAL   R+L
Sbjct  1509  T----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM----NAL---RKL  1375

Query  140   TRQAIDQSV  148
             T  A + +V
Sbjct  1374  TTVAEEPTV  1348

 Score = 44.3 bits (103),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 23/104 (22%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
             CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  2235  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFSGEDKGKRY----------GSVTVAKVAPW  2086

Query  83    EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                      +G+  GF    +  K+  V   V+  ++ +R+KWL
Sbjct  2085  ---------SGEAHGFMF--YTTKQ--VPYYVYASSEAERSKWL  1993

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 29/113 (26%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAACHPPAAEPSAPKGSFYLS  77
             CEGY+T+RGH   S R+ + VL G++L     Q +Y E+++A                + 
Sbjct  1950  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSAI-----------AEVDVK  1804

Query  78    SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
             SI P E         G+P G           Y   D    T G++ KW++  +
Sbjct  1803  SIAPWE---------GEPNGLMFQTSTGNVFYASAD----TLGEQQKWIQTVK  1684

>PHCA:scaffold_13 PHYCAscaffold_13
Length=1060349

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 55/122 (45%), Gaps = 22/122 (18%)
 Frame = +3

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ +L G    ISYY      +    +P A          
Sbjct  342165  PVSCAGYLTKQGHKRKSWKKRYFILRGHT--ISYYSDYDMANNAKGKPLA----------  342308

Query  80      EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
                    V  V    G+PFGF  + +      V   V+ +   +R+KW+    NAL+   Q 
Sbjct  342309  --EVMVEDVQKWDGEPFGFMFMTNEQ----VPYYVYADNDRERSKWM----NALNKLMQW  342458

Query  140     TR  141
                R
Sbjct  342459  RR  342464

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 51/104 (49%), Gaps = 23/104 (22%)
 Frame = +3

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+    ++E  
Sbjct  341589  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAV---TVEK-  341726

Query  83      EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                    V   +G+  GF  + +  K+  +   V+  ++ +R++WL
Sbjct  341727  -----VATWSGEAHGF--MFYTTKQ--IPYYVYASSESERSRWL  341831

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
               SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  341871  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341957

>PHPA:scaffold_89 NW_008649075.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.89, whole genome shotgun 
sequence
Length=179567

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 18/107 (17%)
 Frame = +2

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
               P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  100574  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  100717

Query  80      EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                    V  V    G+PFGF  + +      V   V+ +   +R KW+
Sbjct  100718  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERTKWM  100840

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (47%), Gaps = 23/111 (21%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  99998   CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  100147

Query  83      EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                        +G+  GF    +  K+  +   V+  ++ +R++WL   ++ +
Sbjct  100148  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFM  100261

 Score = 40.0 bits (92),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
               SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  100280  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  100366

>PYIR:scaffold_755 pir_scaffold_755 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_755:1:16342:1 
REF
Length=16342

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 18/121 (15%)
 Frame = -3

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
             P SC GY+TK+GH RKSW+ R+ +L G NL I+YY       P     ++ KG   L+ +
Sbjct  8819  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYY-------PDYDLANSAKGR-ALAEV  8670

Query  80    EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
                  V  V    G+PFGF  +       Y    V+ +   +RNKW+   R   +   + 
Sbjct  8669  T----VEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEP  8514

Query  140   T  140
             T
Sbjct  8513  T  8511

 Score = 43.5 bits (101),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 49/104 (47%), Gaps = 23/104 (22%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
             CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  9395  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFAGEDKGKRY----------GSVTVAKVAPW  9246

Query  83    EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                      +G+  GF    +  K+  +   V+  ++ +R+KWL
Sbjct  9245  ---------SGEAHGFMF--YTTKQ--IPYYVYAASEAERSKWL  9153

 Score = 38.5 bits (88),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -3

Query  22    SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
             SCEGY+T+RGH   S R+ + VL G++L+
Sbjct  9113  SCEGYLTRRGHLVPSQRMAYYVLNGTSLR  9027

>PHIF:NW_003303587.1 Phytophthora infestans T30-4 supercont1.172 
genomic scaffold, whole genome shotgun sequence
Length=191572

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 18/107 (17%)
 Frame = -1

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
              P SC GY+TK+GH RKSW+ R+ +L G+   ISYY      +    +P A          
Sbjct  55207  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  55064

Query  80     EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                   V  V    G+PFGF  + +      V   V+ +   +R KW+
Sbjct  55063  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERTKWM  54941

 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (47%), Gaps = 23/111 (21%)
 Frame = -1

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
              CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  55783  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  55634

Query  83     EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                       +G+  GF    +  K+  +   V+  ++ +R++WL   ++ +
Sbjct  55633  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFM  55520

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  55501  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  55415

>SAPA:scaffold_20 supercont2.20 dna:supercontig supercontig:ASM15154v2:supercont2.20:1:492046:1 
REF
Length=492046

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 50/108 (46%), Gaps = 21/108 (19%)
 Frame = +1

Query  19     RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
              +P SC GY+TK+GH RKSW+ R+ VL G  L  +YY         A   S  K S     
Sbjct  71671  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY---------ADYDSMNKQSLAEVG  71817

Query  79     IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
              +E       V    G+ FGF+ I       Y    VF E+  +R KW+
Sbjct  71818  VE------DVALWDGEQFGFQFITTEQVPYY----VFAESDRERQKWM  71931

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 19/130 (15%)
 Frame = +3

Query  17     KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76
              K  P +C G++TK+GH RKSW+ R+ VL G+ L  SYY    A +  A +         L
Sbjct  67059  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  67208

Query  77     SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
              S +   +  VG        F F  + + P        VF + + D+ KW+   + A+ A 
Sbjct  67209  SDVSLKD--VGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGAD  67364

Query  137    RQLTRQAIDQ  146
                L  + ID+
Sbjct  67365  -TLAIETIDE  67391

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 60/151 (40%), Gaps = 31/151 (21%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK-GSFYLSSIEP  81
              C GY+TKRGH   +W+ RF VL    + + YY         A E  A K G  +L  + P
Sbjct  70994  CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY---------ADESMAKKLGQVHLVKVAP  71143

Query  82     HEYVVGVM---------GAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL------  126
               EYV             G+    FGF M     +  Y    V+     +R KWL      
Sbjct  71144  WEYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDL  71311

Query  127    -EVARNALSAKRQLTRQAIDQSVSSNKKNLF  156
                V  NA   +  LT++    S  S++   F
Sbjct  71312  YVVTSNATDCEGYLTKRTPGFSFLSSRPK*F  71404

 Score = 37.4 bits (85),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
               GY+TKRGH   +W+ RF  L  S  ++SYY 
Sbjct  66433  SGYLTKRGHVITNWKTRFFALR-SQGRLSYYN  66525

 Score = 36.6 bits (83),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 20/60 (33%)
 Frame = +3

Query  18     ARPTSCEGY------------------VTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
              ARP  CEGY                  +TKRGH   S+R+R+ V+ GS   + YY    A
Sbjct  66702  ARPVDCEGYTAPSTTHPPHYSCTSSRYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  66875

>PHKE:scaffold_262 scf_22126_262.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_262.1:1:50665:1 
REF
Length=50665

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 53/115 (46%), Gaps = 22/115 (19%)
 Frame = +3

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
              P +C GY+TK+GH RKSW+ R+ +L GS   ISYY      +         KG      +
Sbjct  15984  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMAN-------NSKGKALAEVL  16136

Query  80     EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                   V  V    G+PFGF  +       Y    V+ +   +RNKW+    NAL+
Sbjct  16137  -----VEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  16262

 Score = 45.1 bits (105),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 48/104 (46%), Gaps = 23/104 (22%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
              CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+         
Sbjct  15408  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAV--------  15533

Query  83     EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                V  V   +G+  GF    +  K+  +   V+  ++ +R+KWL
Sbjct  15534  -MVEKVATWSGEAHGFMF--YTTKQ--IPYYVYASSEAERSKWL  15650

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              SCEGY+TKRGH   S R+ + VL G++L+
Sbjct  15690  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  15776

>PYVX:scaffold_518 pve_scaffold_518 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_518:1:21302:1 
REF
Length=21302

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 27/134 (20%)
 Frame = +1

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
             P +C GY+TK+GH RKSW+ R+ +L G++  ISY+      +      SA   +    ++
Sbjct  5203  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMAN------SAKGKALAEVTV  5358

Query  80    EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQL  139
             E       V    G+PFGF  +       Y    V+ +   +RNKW+    NAL   R+L
Sbjct  5359  E------DVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NAL---RKL  5487

Query  140   TRQAIDQSVSSNKK  153
                A+D+   + KK
Sbjct  5488  --NAVDEEPEAEKK  5523

 Score = 42.4 bits (98),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 51/118 (43%), Gaps = 29/118 (25%)
 Frame = +1

Query  22    SCEGYVTKRGHFRKSWRVRFLVLEGSNL-----QISYYESRAACHPPAAEPSAPKGSFYL  76
             SCEGY+TKRGH   S R+ + VL G+ L     Q +Y E+++A                +
Sbjct  4909  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA----------------M  5040

Query  77    SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
             + +E    V  V    G+P G           Y   D    TQG++ KWL   + + +
Sbjct  5041  AEVE----VRSVATWDGEPHGLMFQTVTGNVFYASAD----TQGEQQKWLATVKKSTA  5190

 Score = 42.4 bits (98),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 23/104 (22%)
 Frame = +1

Query  23    CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
             CEGY+TKRGH   +W+ R+  L G+ L+  Y+ S         + S   G+  ++ + P 
Sbjct  4624  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFASD--------DKSKKYGAVTVAKVAPW  4773

Query  83    EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                      +G+  GF    +  K+  +   V+  ++ +R KWL
Sbjct  4774  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEVERAKWL  4866

>ALCA:scaffold_78 AcNc2_CONTIG_78_length_85802 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_78_length_85802:1:85802:1 
REF
Length=85802

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 18/119 (15%)
 Frame = +1

Query  12     TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
              T + +   P +C GY+TK+GH RKSW+ R+ +L G N+ ISYY+     +    +     
Sbjct  70324  TTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYDLANNAKGKA----  70485

Query  72     GSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                  L+ ++    V  V    G+ FGF  +       Y    V+ + + +R KW+   R
Sbjct  70486  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKWMSALR  70626

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 49/107 (46%), Gaps = 23/107 (21%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
              EGY+TKRGH   +W+ RF VL G+ L+  YY S         E +   GS  ++ + P  
Sbjct  69772  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPW-  69918

Query  84     YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                      +G+  GF M     +  Y    V+  ++ ++ KWL   R
Sbjct  69919  --------SGEAHGF-MFYTTKQIPYY---VYAASEAEKTKWLRALR  70023

 Score = 37.4 bits (85),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              +CEGY+T+RGH   S RV + VL G+ L+
Sbjct  70051  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  70137

>SADI:scaffold_52 supercont1.52 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.52:1:383575:1 
REF
Length=383575

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 52/111 (47%), Gaps = 27/111 (24%)
 Frame = +2

Query  19      RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
               +P SC GY+TK+GH RKSW+ R+ VL G+ L  SYY                  S Y S 
Sbjct  215054  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY------------------SDYDSM  215173

Query  79      IEPHEYVVGVMGAA---GKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                +     VGV   A   G+ FGF+ I       Y    VF E+  +R KW+
Sbjct  215174  NKQSLAEVGVEDVALWDGEQFGFQFITTEQVPYY----VFAESDRERQKWM  215314

 Score = 45.1 bits (105),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = +1

Query  17      KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
               K  P +C G++TK+GH RKSW+ R+ VL G+ L  SY+
Sbjct  210508  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYF  210615

 Score = 44.3 bits (103),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 55/138 (40%), Gaps = 33/138 (24%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK--GSFYLSSIE  80
               C GY+TKRGH   +W+ RF VL    + + YY          A+ S  K  G  +L  + 
Sbjct  214379  CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY----------ADDSMVKKLGQVHLVKVA  214525

Query  81      PHEYVVGVMG------AAGK---PFGFKMIGHAPKKGYVELDVFVETQGDRNKWL-----  126
               P EY     G      A G     FGF M     +  Y    V+     +R +WL     
Sbjct  214526  PWEYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQD  214693

Query  127     --EVARNALSAKRQLTRQ  142
                  V  NA   +  LT++
Sbjct  214694  LYVVTSNATDCEGYLTKR  214747

 Score = 41.2 bits (95),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 6/53 (11%)
 Frame = +1

Query  11      ATASGDKA---RPTSCEG-YVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
               +TA G +A   RP+SC   Y+TKRGH   S+R+R+ V+ GS   + YY    A
Sbjct  210172  STAKGKRACYHRPSSCSCRYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  210324

 Score = 37.0 bits (84),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
                GY+TKRGH   +W+ RF  L  S  ++SYY 
Sbjct  209892  SGYLTKRGHVITNWKTRFFALR-SQGRLSYYN  209984

 Score = 33.9 bits (76),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
               EGY+ K+G    +W+  + VLEG  L +  YESR
Sbjct  255013  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YESR  255108

>APAS:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.13:1:1183921:1 
REF
Length=1183921

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 18/122 (15%)
 Frame = -2

Query  9       IGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS  68
               +   A+    +P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +    +P 
Sbjct  859851  LARVATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKP-  859681

Query  69      APKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
                      L  +   E    V    G+P GF  I +     Y    VF +   D+ KWL  
Sbjct  859680  -------LGEVTVRE----VSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAA  859546

Query  129     AR  130
                R
Sbjct  859545  LR  859540

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -3

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
               G   +P +C GY+TK+GH RKSW+ R+ VL GS L  SYY
Sbjct  855170  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  855057

 Score = 42.0 bits (97),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 11/63 (17%)
 Frame = -1

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK-GSFYLSSIEP  81
               C GY+TKRGH   +W++R+ VL   +  +SYYE          E  A K G  +L+ + P
Sbjct  855844  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYED---------ESMAKKLGQVHLAKVAP  855695

Query  82      HEY  84
                EY
Sbjct  855694  WEY  855686

 Score = 38.9 bits (89),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 3/44 (7%)
 Frame = -3

Query  13      ASGDKARPTS--CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
               AS D + P+     GY+TKRGH   +W+ RF VL     ++SYY
Sbjct  860504  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  860376

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -2

Query  26      YVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
               Y+TKRGH   S+R+R+ VL GS   I YY    A
Sbjct  860103  YLTKRGHLVPSYRMRYFVLCGST--IKYYADETA  860008

>ALLA:FR824103 dna:supercontig supercontig:ENA1:FR824103:1:105777:1 
REF
Length=105777

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 67/142 (47%), Gaps = 27/142 (19%)
 Frame = -3

Query  12     TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
              T + +   P +C GY+TK+GH RKSW+ R+ +L G N+ ISYY+     +    +     
Sbjct  67150  TLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYDLANHVKGKA----  66989

Query  72     GSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARN  131
                  L+ ++    V  V    G+ FGF  +       Y    V+ + + +R KW      
Sbjct  66988  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW------  66863

Query  132    ALSAKRQLTRQAIDQSVSSNKK  153
               +SA R+L+   +D+   + KK
Sbjct  66862  -MSALRKLS--TLDEDTETEKK  66806

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 49/107 (46%), Gaps = 23/107 (21%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
              EGY+TKRGH   +W+ RF VL G+ L+  YY S         E +   GS  ++ + P  
Sbjct  67702  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPW-  67556

Query  84     YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                      +G+  GF M     +  Y    V+  ++ ++ KWL   R
Sbjct  67555  --------SGEAHGF-MFYTTKQIPYY---VYAASETEKAKWLRALR  67451

 Score = 37.0 bits (84),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -3

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              +CEGY+T+RGH   S RV + VL G+ L+
Sbjct  67423  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  67337

>PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_123:1:61624:1 
REF
Length=61624

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 55/118 (47%), Gaps = 18/118 (15%)
 Frame = -1

Query  13     ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
              A+ +   P +C GY+TK+GH RKSW+ R+ VL G++  I+Y+      +       + KG
Sbjct  39424  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTAN-------SNKG  39272

Query  73     SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
                    I     V  V    G+PFGF  +        V   V+ + + +R KW+   R
Sbjct  39271  KALAEVI-----VEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  39125

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 23/119 (19%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
              +CEG++TKRGH   +W++R+ VL G+ L+  Y+           + S   GS  +  + P
Sbjct  39982  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFS--------GDDKSKRYGSVIVEKVAP  39833

Query  82     HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLT  140
                        +G+  GF    +  K+  V   V+  ++ +R KWL   R+ +    ++T
Sbjct  39832  W---------SGEAHGFMF--YTTKQ--VPYYVYASSEAERAKWLRALRDFMVEPEEVT  39695

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              +CEG++T+RGH   S R  + VL G++L+
Sbjct  39697  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  39611

>APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.1:1:2817317:1 
REF
Length=2817317

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 55/122 (45%), Gaps = 18/122 (15%)
 Frame = -3

Query  9       IGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS  68
               +G        +P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +      S
Sbjct  794880  LGKVTVDKPVQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASN---MRHS  794716

Query  69      APKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
                P G   +  +   +         G+P GF  + +      V   VF + + D+ KWL  
Sbjct  794715  RPLGEVTVREVSTWD---------GEPGGFMFVTN----DNVPYYVFADNERDQAKWLTA  794575

Query  129     AR  130
                R
Sbjct  794574  LR  794569

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 55/122 (45%), Gaps = 21/122 (17%)
 Frame = -2

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
               G   +P +C GY+TK+GH RKSW+ R+ VL G+ L  SYY             SA K   
Sbjct  790123  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYYTDYE---------SANKQCL  789977

Query  75      YLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                   IE       V    G+  GF M     +  Y    V+ +T+ +R KWL   +  L 
Sbjct  789976  AEVGIE------DVQVWDGEMHGF-MFTTTEQVMYY---VYADTERERQKWLVALKALLD  789827

Query  135     AK  136
               A+
Sbjct  789826  AQ  789821

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 9/62 (15%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               C GY+TKRGH   +W++RF VL   +  +SYYE  +         S   G  +L+ + P 
Sbjct  790792  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESM--------SKKLGQVHLAKVAPW  790640

Query  83      EY  84
               EY
Sbjct  790639  EY  790634

 Score = 39.7 bits (91),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 46/104 (44%), Gaps = 24/104 (23%)
 Frame = -3

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK-GSFYLSSIEPHE  83
               GY+TKRGH   +W+ RF VL     ++SYY         A E    K G  +L  + P  
Sbjct  795474  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY---------ADEGMKKKLGEVHLEKVSPW-  795328

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE  127
                       +G+  GF M   + +  Y    V+  T  +R +WLE
Sbjct  795327  --------SGEANGF-MFYTSKQIAYY---VYASTNSERRRWLE  795232

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  26      YVTKRGHFRKSWRVRFLVLEGSNLQ  50
               Y+TKRGH   S+R+R+ VL G++++
Sbjct  795132  YLTKRGHLVPSYRMRYFVLSGASMK  795058

 Score = 34.3 bits (77),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 48/117 (41%), Gaps = 19/117 (16%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGY++K+G    +W+  + VLEG  L I  Y+SR      A              ++   
Sbjct  728251  EGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADAG-------------LKVRV  728117

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLT  140
                +V V     +P GF +      +G+  L +   T  ++ +W+   R      R+L 
Sbjct  728116  ILVDVNDDVARPHGFAI----KTEGHKTLHLASRTAFEQEQWVRAIRVRCPRNRKLC  727958

>PYIW:scaffold_1276 piw_scaffold_1276 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1276:1:9914:1 
REF
Length=9914

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 8/130 (6%)
 Frame = -2

Query  6     VPEIGATASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPA  64
             + +   ++ G  A+    EGYV  R HF  + WR RF VLEG+ L + Y +S AA     
Sbjct  3010  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDR  2834

Query  65    AEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNK  124
                +  K    L ++E           +G  FGF++   A   GY+E    V T+ ++ K
Sbjct  2833  ERTALEKHD--LIAVEKWHPTYSANLGSGSRFGFRVENEA--GGYLECT--VTTEDEQTK  2672

Query  125   WLEVARNALS  134
             WL V  +A+S
Sbjct  2671  WLAVVSDAVS  2642

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (45%), Gaps = 4/65 (6%)
 Frame = -2

Query  10    GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSA  69
             G +  G   R    EGY+ KRGH   S R R+ VL   N  + Y+ +      PA     
Sbjct  5767  GDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVLL-KNASLEYFATHEDSRNPAIR---  5600

Query  70    PKGSF  74
             P GSF
Sbjct  5599  PHGSF  5585

>PYIR:scaffold_231 pir_scaffold_231 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_231:1:38748:1 
REF
Length=38748

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 57/127 (45%), Gaps = 7/127 (6%)
 Frame = -1

Query  9      IGATASGDKARPTSCEGYVTKRGHFR-KSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              IG ++         CEGYV  R HF   +WR RF VLE + L +  Y   +A      E 
Sbjct  19263  IGVSSKDGSGICHRCEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQ  19090

Query  68     SAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE  127
               A +    ++  + H      +G     FGF++   A   GY+E  V +E +  + KWL 
Sbjct  19089  KALEKHDLIAVKKWHPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIEDE--QTKWLA  18922

Query  128    VARNALS  134
                 NA+S
Sbjct  18921  AITNAVS  18901

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 32/68 (47%), Gaps = 8/68 (12%)
 Frame = -1

Query  10     GATASGDKA---RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAE  66
              G   SG +A   R    EGY+ KRGH   S R R+ VL  + L+  Y+ +      PA  
Sbjct  22086  GDDDSGSEAGSNRQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNPAIR  21913

Query  67     PSAPKGSF  74
                 P GSF
Sbjct  21912  ---PHGSF  21898

>PYAP:scaffold_137 pag1_scaffold_137 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_137:1:57116:1 
REF
Length=57116

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
              EGYVTKRGH  ++W++RF  LEG+NL  SYYE++ 
Sbjct  40957  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  41055

>PYAR:scaffold_1124 par_scaffold_1124 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1124:1:10220:1 
REF
Length=10220

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 2/34 (6%)
 Frame = -1

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
             EGYVTKRGH  ++W+ RF  LEG+NL  SYYE++
Sbjct  2102  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK  2007

>APIN:scaffold_3 supercont1.3 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.3:1:3119476:1 
REF
Length=3119476

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (52%), Gaps = 11/97 (11%)
 Frame = -3

Query  2       NILRVPEIGATASGDK-ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               NI RV      A+  K +      G++ K+G    SW+ RFLVL G N  ISYY+ +   
Sbjct  781046  NINRVGRRAGAATMQKDSSVNEWRGWIQKQGSVVPSWKKRFLVLSGQN--ISYYD-KDVS  780876

Query  61      HPPAAEPSAPKGSFYLSSIEP---HEYVVGVMGAAGK  94
               +P A E    KGSF L+ ++P   H+  + +M   GK
Sbjct  780875  NPRAKE----KGSFVLAGVQPNKSHDNCMILMSNEGK  780777

 Score = 34.3 bits (77),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 4/51 (8%)
 Frame = +3

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAP  70
                P   EGY+ KRG +   W    +VL+G  L++SY++      P  A P  P
Sbjct  1509012  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRLSYFDQLEGSTP--ARPHTP  1509152

>PHCA:scaffold_20 PHYCAscaffold_20
Length=899172

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 58/133 (44%), Gaps = 18/133 (14%)
 Frame = -2

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               M+ L V    A+           EGYV K+G +   W  R+L+L+G+ L  +YY S+   
Sbjct  130145  MDDLLVDSSSASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSK---  129981

Query  61      HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
                  A      +G   +S + P  Y        GK  GF +      +G+    +   T+ 
Sbjct  129980  -EEARSARNLRGRMIISKVRPENY--------GKAHGFLL----ETQGHKHFHLCCSTEL  129840

Query  121     DRNKWLEVARNAL  133
               +++ W+E+ + A+
Sbjct  129839  EKDMWVEMMQAAI  129801

>HYAP:scaffold_1 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1:1:1234263:1 
REF
Length=1234263

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                EGYVTKRGH  ++W++RF  LEG+ L  + Y  R
Sbjct  1195378  EGYVTKRGHLVRNWKMRFFTLEGNLLSCT*YRDR  1195479

>PHPA:scaffold_114 NW_008649100.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.114, whole genome 
shotgun sequence
Length=97882

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 58/133 (44%), Gaps = 18/133 (14%)
 Frame = +1

Query  1      MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
              M+ L V    A+           EGYV K+G +   W  R+L+L+G+ L  +YY S+   
Sbjct  60061  MDDLLVDSSTASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE-  60231

Query  61     HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
                 A      +G   +S + P  Y        GK  GF +      +G+    +   T+ 
Sbjct  60232  ---ARSARNLRGRMIISKVRPENY--------GKAHGFLI----ETQGHKHFHLCCTTEL  60366

Query  121    DRNKWLEVARNAL  133
              +++ W+E+ + A+
Sbjct  60367  EKDMWVEMMQAAI  60405

>PYIR:scaffold_88 pir_scaffold_88 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_88:1:55984:1 
REF
Length=55984

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
               EGYVTKRGH  ++W+ RF  LEG+NL 
Sbjct  24131  WEGYVTKRGHLVRNWKNRFFTLEGNNLS  24214

>PYUU:scaffold_2023 scf1117875582023 dna:supercontig supercontig:pug:scf1117875582023:1:1683196:1 
REF
Length=1683196

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +1

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
                EGYVTKRGH  ++W+ RF  LEG+NL    +
Sbjct  313543  WEGYVTKRGHLVRNWKNRFFTLEGTNLSCKQW  313638

>PHRA:scaffold_73
Length=254763

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 53/116 (46%), Gaps = 18/116 (16%)
 Frame = +2

Query  18      ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
               A     EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +S
Sbjct  185162  AHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNLRGRMIIS  185323

Query  78      SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                + P  Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  185324  KVRPENY--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAI  185455

>PHIF:NW_003303740.1 Phytophthora infestans T30-4 supercont1.19 
genomic scaffold, whole genome shotgun sequence
Length=2398068

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (47%), Gaps = 23/111 (21%)
 Frame = +2

Query  23       CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
                CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E S   G+  +  + P 
Sbjct  2269073  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  2269222

Query  83       EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                         +G+  GF    +  K+  +   V+  ++ +R++WL   ++ +
Sbjct  2269223  ---------SGEAHGFMF--YTTKQ--IPYYVYASSEAERSRWLRALKDFM  2269336

>PYAP:scaffold_212 pag1_scaffold_212 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_212:1:44434:1 
REF
Length=44434

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 65/149 (44%), Gaps = 26/149 (17%)
 Frame = +2

Query  13     ASGDKARPTSC------EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAE  66
              ASG    PT        EGYV K+G +   W  R+LVL+G+ L  +YY ++      A  
Sbjct  20888  ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEE----ARS  21049

Query  67     PSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWL  126
                  +G   +S + P  Y        GK  GF +       G+    +   T+ +++ W+
Sbjct  21050  GRNLRGRMIISKVRPENY--------GKAHGFLL----ETMGHKHFHLCCSTELEKDMWV  21193

Query  127    EVARNALS--AKRQLTRQAIDQSVSSNKK  153
              E+ + A+    K +L R  I  +  +N +
Sbjct  21194  EMMQAAIDEGVKHKLERSLISSADVANAQ  21280

>PYIW:scaffold_4 piw_scaffold_4 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_4:1:82745:1 
REF
Length=82745

 Score = 45.1 bits (105),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
              EGYVTKRGH  ++W+ RF  LEG+NL  +
Sbjct  52256  EGYVTKRGHLVRNWKNRFFTLEGNNLSCT  52342

>PHSO:scaffold_4
Length=7609242

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +S + P  
Sbjct  971188  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEE----ARSARNLRGRMIISKVRPEN  971349

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  971350  Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  971463

>PYUU:scaffold_1239 scf1117875581239 dna:supercontig supercontig:pug:scf1117875581239:1:719819:1 
REF
Length=719819

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 59/133 (44%), Gaps = 20/133 (15%)
 Frame = -1

Query  18     ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
              A     EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +S
Sbjct  51989  AHEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEE----ARSARNLRGRMIIS  51828

Query  78     SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS--A  135
               + P  Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+    
Sbjct  51827  KVRPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGV  51684

Query  136    KRQLTRQAIDQSV  148
              K  +   ++D  V
Sbjct  51683  KHSVNGNSMDSDV  51645

>PYIR:scaffold_316 pir_scaffold_316 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_316:1:31968:1 
REF
Length=31968

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 57/124 (46%), Gaps = 20/124 (16%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
             EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +S + P  
Sbjct  9298  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEE----ARSARNLRGRMIISKVRPEN  9459

Query  84    YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS--AKRQLTR  141
             Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+    K  L  
Sbjct  9460  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNG  9603

Query  142   QAID  145
              ++D
Sbjct  9604  SSVD  9615

>APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.11:1:1510989:1 
REF
Length=1510989

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI----  79
               EG+V K+GH  ++W+VR+  LEG NL +SYYE++      A +    KG  +L+++    
Sbjct  876520  EGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYETK----EDARKRRFLKGRVHLTTVMLVE  876681

Query  80      --EPHEYVVGVMGAAGKPF  96
                   H Y +       KPF
Sbjct  876682  GRSAHGYDLTFTTQESKPF  876738

>PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_206.1:1:61978:1 
REF
Length=61978

 Score = 44.3 bits (103),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 16/139 (12%)
 Frame = -1

Query  10    GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSA  69
             G +++ D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       + 
Sbjct  5647  GTSSAFDDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSC-------AK  5498

Query  70    PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEV  128
              KG   L   +   + V V  A+G+   F + +G  P+  Y  L    + + DR  W+  
Sbjct  5497  LKGEVLLFHPQTRVHYVDVHVASGRDASFAVQVG--PE--YTLLLQAAQLR-DRENWIYC  5333

Query  129   ARNALSAKRQLTRQAIDQS  147
               +AL  +     Q ++++
Sbjct  5332  IEDALLCRDSYHPQGVNRN  5276

>ALLA:FR824075 dna:supercontig supercontig:ENA1:FR824075:1:147583:1 
REF
Length=147583

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 9/44 (20%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              EGYV KRGH  ++W++RF  LEG         +R +C  P A+P
Sbjct  48745  EGYVIKRGHLVRNWKMRFFTLEG---------NRLSCTSPLADP  48849

>ALCA:scaffold_16 AcNc2_CONTIG_16_length_171156 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_16_length_171156:1:171156:1 
REF
Length=171156

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
               EGYVTKRGH  ++W++RF  LEG+ L  +
Sbjct  111625  EGYVTKRGHLVRNWKMRFFTLEGNRLSCT  111539

>PYAR:scaffold_222 par_scaffold_222 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_222:1:24584:1 
REF
Length=24584

 Score = 43.5 bits (101),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
              EGYV K+G +   W  R+LVL+G+ L  +YY S+      A      +G   +S + P  
Sbjct  13257  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEE----ARSGRNLRGRMIISKVRPEN  13418

Query  84     YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  13419  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  13532

>ALLA:FR824088 dna:supercontig supercontig:ENA1:FR824088:1:131184:1 
REF
Length=131184

 Score = 43.5 bits (101),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (44%), Gaps = 18/126 (14%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +  + P  
Sbjct  103872  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEE----ARSARNLRGKMMIVKVRPEN  103711

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQA  143
               Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+      +  A
Sbjct  103710  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNA  103567

Query  144     IDQSVS  149
                   VS
Sbjct  103566  SHSFVS  103549

>PYIW:scaffold_388 piw_scaffold_388 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_388:1:19611:1 
REF
Length=19611

 Score = 43.5 bits (101),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 53/116 (46%), Gaps = 18/116 (16%)
 Frame = -2

Query  18    ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
             A     EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +S
Sbjct  5843  AHEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEE----ARSARNLRGRMIIS  5682

Query  78    SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              + P  Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  5681  KVRPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  5550

>SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM15154v2:supercont2.19:1:569072:1 
REF
Length=569072

 Score = 43.5 bits (101),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 16/105 (15%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EG+V+K+GH  ++W++R+  LE SNL +SYYES+      A +    KG  +L+ ++   
Sbjct  518276  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESKED----ARKRRHLKGRVHLTRVQ---  518428

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
                ++    A G  F F      P        V   T+ D+  W++V
Sbjct  518429  -IIEGKSAHGYDFTFDTQEGKP------FHVSTTTELDQIAWVKV  518542

>ALCA:scaffold_121 AcNc2_CONTIG_121_length_67320 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_121_length_67320:1:67320:1 
REF
Length=67320

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 18/110 (16%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
             EGYV K+G +   W  R+LVL+G+ L  +YY ++      A      +G   +  + P  
Sbjct  6604  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEE----ARSARNLRGKMMIVKVRPEN  6765

Query  84    YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  6766  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  6879

>SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.27:1:696964:1 
REF
Length=696964

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 16/105 (15%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EG+V+K+GH  ++W++R+  LE SNL +SYYES+      A +    KG  +L+ +    
Sbjct  365903  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK----EDARKRRHLKGRVHLTRV----  366052

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
               +++    A G  F F      P        V   T+ D+  W++V
Sbjct  366053  HIIEGKSAHGYDFTFDTQEGKP------FHVSTTTELDQIAWVKV  366169

>APAS:scaffold_6 supercont1.6 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.6:1:1791376:1 
REF
Length=1791376

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 38/61 (62%), Gaps = 7/61 (11%)
 Frame = -3

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
                +G++ K+G    SW+ R+LVL G N  ISY++ +   +P A E    KGSF L+ ++P+
Sbjct  124223  WQGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKE----KGSFVLAGVQPN  124065

Query  83      E  83
               +
Sbjct  124064  K  124062

>ALLA:FR824067 dna:supercontig supercontig:ENA1:FR824067:1:183579:1 
REF
Length=183579

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
              EGYVTKRGH  ++W++RF  LEG+ L  +
Sbjct  83568  EGYVTKRGHLVRNWKMRFFTLEGNRLSCT  83654

>PHIF:NW_003303669.1 Phytophthora infestans T30-4 supercont1.90 
genomic scaffold, whole genome shotgun sequence
Length=500880

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   ++ + P  
Sbjct  370499  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSK----EEARSARNLRGRMIINKVRPEN  370338

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  370337  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAI  370224

>SADI:scaffold_3 supercont1.3 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.3:1:1523884:1 
REF
Length=1523884

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 18/119 (15%)
 Frame = -1

Query  15      GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSF  74
               G  A     EGYV K+G +   W  R+LVL+G++L  +YY ++      A      +G  
Sbjct  742474  GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDE----ARSGRNLRGRM  742313

Query  75      YLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                ++ + P  Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  742312  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  742172

 Score = 34.3 bits (77),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (45%), Gaps = 17/110 (15%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EG+V K+G +   W  R+LVL+G+ L  +YY  +      A      +G   L+ + P  
Sbjct  746154  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQH----DARSGKNLRGRMVLTYVGPDF  745993

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                         K  GF +      KG+    +   T+ +++ W+E+ + AL
Sbjct  745992  -------KGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  745876

>PHKE:scaffold_129 scf_22126_129.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_129.1:1:86867:1 
REF
Length=86867

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGS  47
               EGYVTKRGH  ++W++RF  LEG+
Sbjct  53506  WEGYVTKRGHLVRNWKMRFFTLEGN  53580

>PYVX:scaffold_5 pve_scaffold_5 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_5:1:126063:1 
REF
Length=126063

 Score = 43.1 bits (100),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 53/116 (46%), Gaps = 18/116 (16%)
 Frame = -2

Query  18     ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLS  77
              A     EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   LS
Sbjct  13715  AHEVHWEGYVRKKGDWLPRWEERYLILDGAAL--TYYNSK----DEARSGRNLRGRMQLS  13554

Query  78     SIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               + P  Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  13553  RVRPENY--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  13422

>PYVX:scaffold_12 pve_scaffold_12 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_12:1:106792:1 
REF
Length=106792

 Score = 42.7 bits (99),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 9/45 (20%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS  68
              EGYVTKRGH  ++W++RF  LEG NL         +C P   +P+
Sbjct  54264  EGYVTKRGHLVRNWKMRFFTLEG-NL--------VSCTPVRVDPA  54371

>PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3060, whole genome shotgun sequence
Length=3267112

 Score = 42.7 bits (99),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 6/45 (13%)
 Frame = +2

Query  9      IGATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLEGS  47
              +  T  GD+A  +        EGYVTKRGH  ++W++RF  LEG+
Sbjct  73922  MSVTMGGDQAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEGN  74056

 Score = 40.0 bits (92),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 55/134 (41%), Gaps = 16/134 (12%)
 Frame = -3

Query  12      TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
               T++ D A   S  G++ KRGH  K+W+ R+ VL  S L+   Y S A C       +  K
Sbjct  880679  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACC-------TKLK  880530

Query  72      GSFYLSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVAR  130
               G   L   +   + V V    G+   F + +G         L +  E   DR  W+    
Sbjct  880529  GEVLLFHPQTCVHYVDVHVTGGRDASFAIQVG-----SEYTLLLQAERLSDRENWMYCIE  880365

Query  131     NALSAKRQLTRQAI  144
               +AL  +     Q +
Sbjct  880364  DALLCRDSYQNQQV  880323

>PHRA:scaffold_27
Length=538834

 Score = 42.4 bits (98),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  24     EGYVTKRGHFRKSWRVRFLVLEGS  47
              EGYVTKRGH  ++W++RF  LEG+
Sbjct  48948  EGYVTKRGHLVRNWKMRFFTLEGN  48877

>PHPA:scaffold_32 NW_008649018.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.32, whole genome shotgun 
sequence
Length=687390

 Score = 42.4 bits (98),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEG  46
                EGYVTKRGH  ++W++RF  LEG
Sbjct  578486  WEGYVTKRGHLVRNWKMRFFTLEG  578557

>PHIF:NW_003303691.1 Phytophthora infestans T30-4 supercont1.68 
genomic scaffold, whole genome shotgun sequence
Length=714584

 Score = 42.0 bits (97),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGS  47
               EGYVTKRGH  ++W++RF  LEG+
Sbjct  364184  EGYVTKRGHLVRNWKMRFFTLEGN  364113

>PHCA:scaffold_2 PHYCAscaffold_2
Length=1925921

 Score = 42.0 bits (97),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
                 EGYVTKRGH  ++W+ RF  LEG+ +  ++
Sbjct  1737859  WEGYVTKRGHLVRNWKSRFFTLEGNLVSCTW  1737951

>APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.49:1:457786:1 
REF
Length=457786

 Score = 41.6 bits (96),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI----  79
               EG+V K+GH  ++W+VR+  LEG NL +SYYE++      A +    KG  +++++    
Sbjct  359787  EGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYETK----EDARKRRFLKGRVHVTTVVLVE  359948

Query  80      --EPHEYVVGVMGAAGKPF  96
                   H Y +       KPF
Sbjct  359949  GRSHHGYDLTFTTQESKPF  360005

>HYAP:scaffold_797 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_797:1:5354:1 
REF
Length=5354

 Score = 41.6 bits (96),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 55/133 (41%), Gaps = 22/133 (17%)
 Frame = +1

Query  16    DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
             D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C       +  KG   
Sbjct  3655  DDAFLDSMSGWLRKRGHVRKNWKARYFVLDKSILR---YYTDSSC-------TKLKGEVL  3804

Query  76    LSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG----DRNKWLEVARN  131
             L   +   + V V  A G+   F +         V LD  +        DR  W+    +
Sbjct  3805  LFHPQTRVHYVDVHVAGGRDASFAI--------QVGLDYTLLLHAAQLCDRENWMYCIED  3960

Query  132   ALSAKRQLTRQAI  144
             AL  +     Q +
Sbjct  3961  ALLCRDSYYTQGL  3999

>SAPA:scaffold_2 supercont2.2 dna:supercontig supercontig:ASM15154v2:supercont2.2:1:1567649:1 
REF
Length=1567649

 Score = 41.6 bits (96),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 18/110 (16%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LVL+G++L  +YY ++      A      +G   ++ + P  
Sbjct  835917  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDE----ARSGRNLRGRMIITRVLPEN  836078

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               Y        GK  GF +      KG+    +   T+ +++ W+E+ + A+
Sbjct  836079  Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  836192

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 17/110 (15%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EG+V K+G +   W  R+LVL+G+ L  +YY  +      A      +G   L+ + P  
Sbjct  832309  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQH----DARSGKNLRGRMVLTYVGPDF  832470

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                       + K  GF +      KG+    +   T+ +++ W+E+ + AL
Sbjct  832471  -------KSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  832587

>PYIW:scaffold_649 piw_scaffold_649 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_649:1:15641:1 
REF
Length=15641

 Score = 41.2 bits (95),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              T  EGYV K+GH  +SWR R+ +L G+    SYY S+
Sbjct  15492  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  15388

>PHCA:scaffold_18 PHYCAscaffold_18
Length=984210

 Score = 41.2 bits (95),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
               T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  107642  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  107538

>PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.7, whole genome shotgun 
sequence
Length=2078921

 Score = 41.2 bits (95),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  1543523  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  1543419

>PHSO:scaffold_2
Length=11587142

 Score = 41.2 bits (95),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 58/132 (44%), Gaps = 16/132 (12%)
 Frame = +2

Query  16       DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
                D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       S  KG   
Sbjct  2310074  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSC-------SKLKGEVL  2310223

Query  76       LSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                L   +   + V V  A G+   F + +G      Y  L    + + DR  W+    +AL 
Sbjct  2310224  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLLLQAAQLR-DRENWMYCIEDALL  2310388

Query  135      AKRQLTRQAIDQ  146
                 +     Q + +
Sbjct  2310389  CRDSYHPQGMTE  2310424

 Score = 37.4 bits (85),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 42/97 (43%), Gaps = 18/97 (19%)
 Frame = -2

Query  37       WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
                W+ R+ V+    LQI Y+ S         E  A +G    SS+   +         GKP 
Sbjct  9494341  WKKRYCVVYKDELQIVYFLSLEDF-----EKRAIRGKIPFSSVHAWD---------GKPN  9494204

Query  97       GFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                GF+   + P        V+ ET  D+ KWLEV + AL
Sbjct  9494203  GFQF--YTPSNNCFR--VYTETPEDQLKWLEVMQKAL  9494105

 Score = 37.4 bits (85),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +2

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
                G+V K+G   K+W+ RF+VL G   Q++YY++ A   P        KGSF + ++E
Sbjct  5990327  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  5990473

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 24/122 (20%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
                C G++ K G   KSW+ R+  L GS L  SYY++              KGS  L S++  
Sbjct  5984776  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKT-------------DKGSL-LRSVK--  5984901

Query  83       EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQ  142
                  VV +       FG  +     +K  ++ D    ++ D   WL   R A++A  +  + 
Sbjct  5984902  --VVNIAANPSVAFGLTVSTAGGRKLVIQAD----SKEDFEMWLGAVREAVAAGEKERKS  5985063

Query  143      AI  144
                ++
Sbjct  5985064  SV  5985069

>APAS:scaffold_5 supercont1.5 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.5:1:1915940:1 
REF
Length=1915940

 Score = 41.2 bits (95),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 18/110 (16%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LVL+G++L  +YY S+      A   +  +G   ++ + P  
Sbjct  939623  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDE----ARTGTNLRGRMIITKVLPEN  939784

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               Y        GK  GF +       G+    +   T+ +++ W+E+ + A+
Sbjct  939785  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  939898

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 56/132 (42%), Gaps = 33/132 (25%)
 Frame = -1

Query  9       IGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS  68
               I AT+ G  A     EG V K+G +   W  R+LVL+G+ L+  YY      H  A    
Sbjct  947162  IAATSGGMHA--VHWEGQVRKKGDWLPRWESRYLVLDGTVLR--YYSK----HEDARMGK  947007

Query  69      APKGSFYLSSIEP-------HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGD  121
                 +G   L+ + P       H +VV  +G               K  Y+  D    T+ +
Sbjct  947006  NLRGKMTLTHVSPEFHKKKEHTFVVETVGR--------------KVFYMSCD----TELE  946881

Query  122     RNKWLEVARNAL  133
               ++ W+E+ + A+
Sbjct  946880  KDMWVEMMQAAI  946845

>PHRA:scaffold_38
Length=442185

 Score = 41.2 bits (95),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
               T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  378001  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  377897

>PHKE:scaffold_626 scf_22126_626.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_626.1_contig_1:1:14504:1 
REF
Length=14504

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 51/110 (46%), Gaps = 18/110 (16%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
             EG+V K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +  + P  
Sbjct  4123  EGFVRKKGDWLPRWEERYLILDGATL--TYYNSK----EEARSARNLRGRMIIVKVRPEN  4284

Query  84    YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
             Y        GK  GF +      +G+    +   T+ +++ W+E+ + A+
Sbjct  4285  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  4398

>PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 
genomic scaffold, whole genome shotgun sequence
Length=734189

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 16/119 (13%)
 Frame = +2

Query  16      DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
               D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       +  KG   
Sbjct  681509  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSC-------AKLKGEVL  681658

Query  76      LSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               L   +   + V V  A G+   F + +G      Y  L    + + DR  W+    +AL
Sbjct  681659  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLLLQAAQLR-DRENWMYCIEDAL  681820

>HYAP:scaffold_72 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_72:1:329297:1 
REF
Length=329297

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
               T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  226999  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  227103

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 40.8 bits (94),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 16/119 (13%)
 Frame = -2

Query  16      DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
               D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       +  KG   
Sbjct  694672  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSC-------TKLKGEVL  694523

Query  76      LSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               L   +   + V V  A G+   F + +G      Y  L    + + DR  W+    +AL
Sbjct  694522  LFHPQTRVHYVDVHVAGGRDASFAIQVG----PDYTLLLQAAQLR-DRENWMYCIEDAL  694361

>ALLA:FR824181 dna:supercontig supercontig:ENA1:FR824181:1:68077:1 
REF
Length=68077

 Score = 40.8 bits (94),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 5/62 (8%)
 Frame = +3

Query  7      PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA---CHPP  63
              PE+  T   ++   T  EGY+ K+GH  +SWR R+ VL G+     Y  S      C  P
Sbjct  25872  PEVSHTF--EELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCKYSSSHHVYERCDNP  26045

Query  64     AA  65
               A
Sbjct  26046  CA  26051

>ALLA:FR824176 dna:supercontig supercontig:ENA1:FR824176:1:68905:1 
REF
Length=68905

 Score = 40.8 bits (94),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 5/62 (8%)
 Frame = -3

Query  7      PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA---CHPP  63
              PE+  T   ++   T  EGY+ K+GH  +SWR R+ VL G+     Y  S      C  P
Sbjct  42638  PEVSHTF--EELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCKYSSSHHVYERCDNP  42465

Query  64     AA  65
               A
Sbjct  42464  CA  42459

>PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 
genomic scaffold, whole genome shotgun sequence
Length=5458067

 Score = 40.8 bits (94),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  3548866  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  3548762

 Score = 40.0 bits (92),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
               G+V K+G   K+W+ RF+VL G   Q++YY++ +  +P       PKGSF + ++E
Sbjct  238426  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNPTV----KPKGSFQVITVE  238572

 Score = 37.7 bits (86),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 26/120 (22%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               C G++ K G   KSW+ R+  L GS L  SYY+S         E  +   S  + SIEPH
Sbjct  233927  CVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS---------EKGSLLRSVSVVSIEPH  234073

Query  83      EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA--KRQLT  140
                 V           G  +  H+ +K  ++ D    +  + ++WL   + A++   +R+LT
Sbjct  234074  PTV---------SLGLVVSTHSGRKLIMQAD----SNEEFDRWLSAIQGAVAGENERKLT  234214

>PHKE:scaffold_69 scf_22126_69.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_69.1:1:116444:1 
REF
Length=116444

 Score = 40.8 bits (94),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              T  EGY+ K+GH  +SWR R+ VL G  +  SYY S+
Sbjct  48994  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSK  48890

>APIN:scaffold_8 supercont1.8 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.8:1:1936381:1 
REF
Length=1936381

 Score = 40.8 bits (94),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+LVL+G++L  +YY S+      A      +G   ++ + P  
Sbjct  307391  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEE----ARTGKNLRGRMIITRVLPEN  307230

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               Y        GK  GF +       G+    +   T+ +++ W+E+ + A+
Sbjct  307229  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  307116

>PLHA:NW_020187174.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_253, whole genome shotgun sequence
Length=912309

 Score = 40.8 bits (94),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 66/141 (47%), Gaps = 24/141 (17%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGYV K+G +   W  R+L+L+G+ L  +YY S+      A      +G   +  + P  
Sbjct  307413  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSK----EEARSARNMRGRMTVYKVRPEN  307252

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL--SAKRQLTR  141
               Y        GK  GF +   + K    +  +   T+ +++ W+E+   A+   A+++ +R
Sbjct  307251  Y--------GKAHGFLLETQSHK----QFHLCCATELEKDMWVEMMHAAVEEGARQRNSR  307108

Query  142     QAID----QSVSSNKKNLFGF  158
                +++      +S  + +L GF
Sbjct  307107  LSVEGMEILQISPTQVDLRGF  307045

>PHCA:scaffold_106 PHYCAscaffold_106
Length=144267

 Score = 40.4 bits (93),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 54/118 (46%), Gaps = 14/118 (12%)
 Frame = +3

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y + ++C       +  KG   
Sbjct  99108  DDAFLDSMSGWLRKRGHVRKNWKARYFVLERSVLR---YYTDSSC-------TKLKGEVL  99257

Query  76     LSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              L   +   + V V  A G+   F  I   P+  Y  L    + + DR  W+    +AL
Sbjct  99258  LFHPQTRVHYVDVHVAGGRDASFA-IQVGPE--YTLLLQAAQLR-DRENWMYCIEDAL  99419

>PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:pug:scf1117875582035:1:696189:1 
REF
Length=696189

 Score = 40.4 bits (93),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 5/62 (8%)
 Frame = -2

Query  19      RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS-APKGSFYLS  77
               R    EGY+ KRGH   S R R+ VL      + YY    A H  +  PS AP GSF + 
Sbjct  263039  RQILLEGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVD  262872

Query  78      SI  79
               ++
Sbjct  262871  TV  262866

 Score = 38.5 bits (88),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 59/124 (48%), Gaps = 14/124 (11%)
 Frame = -2

Query  25      GYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPAA--EPSAPKGSFYLSSIEP  81
               GYV  R HF  + WR RF+VL G++  + Y +S AA           A +    ++  + 
Sbjct  260258  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKKALEKHNLVAIAKW  260082

Query  82      HEYVVGVMGAA---GKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV---ARNALSA  135
               H   V   G+A      +GF++   A   GY+E    V T+ ++ +W++    A  ALSA
Sbjct  260081  HPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTISDAVTALSA  259914

Query  136     KRQL  139
                 QL
Sbjct  259913  SSQL  259902

>ALCA:scaffold_34 AcNc2_CONTIG_34_length_127434 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_34_length_127434:1:127434:1 
REF
Length=127434

 Score = 40.4 bits (93),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
              EGYV KRGH  ++W++RF  LEG+ +  +
Sbjct  51363  EGYVIKRGHLVRNWKMRFFTLEGNRVSCT  51277

>PYUU:scaffold_2034 scf1117875582034 dna:supercontig supercontig:pug:scf1117875582034:1:1169325:1 
REF
Length=1169325

 Score = 40.4 bits (93),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = +2

Query  16       DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                D    T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  1065680  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  1065799

>PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.42, whole genome shotgun 
sequence
Length=594358

 Score = 40.0 bits (92),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
               G+V K+G   K+W+ RF+VL G   Q++YY++      P  +   PKGSF + ++E
Sbjct  304013  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDTSKLV--PTVK---PKGSFQVITVE  304159

 Score = 37.7 bits (86),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 51/117 (44%), Gaps = 34/117 (29%)
 Frame = +3

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               C G++ K G   KSW+ R+  L GS L  SYY+S         E  +   S  + ++EPH
Sbjct  298488  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKS---------EKGSLLRSVSVINVEPH  298634

Query  83      EYV-----VGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                 V     V  +G      G K+I  A            E+ G+ NKWL   + A++
Sbjct  298635  PSVSLGLTVSTVG------GRKLIVQA------------ESNGEFNKWLNAIQEAVA  298751

>PYIR:scaffold_1 pir_scaffold_1 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1:1:175201:1 
REF
Length=175201

 Score = 40.0 bits (92),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
               T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  155625  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  155729

>PHRA:scaffold_4
Length=963095

 Score = 40.0 bits (92),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 53/118 (45%), Gaps = 14/118 (12%)
 Frame = +2

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y +  +C       +  KG   
Sbjct  85112  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSC-------AKLKGEVL  85261

Query  76     LSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              L   +   + V V  A G+   F  I   P+  Y  L    + + DR  W+    +AL
Sbjct  85262  LFHPQTRVHYVDVHVAGGRDASFA-IQVGPE--YTLLLQAAQLR-DRENWMYCIEDAL  85423

 Score = 40.0 bits (92),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 53/118 (45%), Gaps = 14/118 (12%)
 Frame = +3

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ VLE S L+   Y +  +C       +  KG   
Sbjct  79806  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSC-------AKLKGEVL  79955

Query  76     LSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              L   +   + V V  A G+   F  I   P+  Y  L    + + DR  W+    +AL
Sbjct  79956  LFHPQTRVHYVDVHVAGGRDASFA-IQVGPE--YTLLLQAAQLR-DRENWMYCIEDAL  80117

>PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_610:1:19546:1 
REF
Length=19546

 Score = 40.0 bits (92),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
              T  EGY+ K+GH  +SWR R+ +L G+     ++
Sbjct  18683  TDWEGYIWKQGHVVRSWRYRYAILSGTTFSCKWW  18582

>PHPA:scaffold_53 NW_008649039.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.53, whole genome shotgun 
sequence
Length=442537

 Score = 40.0 bits (92),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 23/112 (21%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  120919  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKG--------RKKIKGCMQLN-----DG  121056

Query  85      VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
               VV V    +  AGK + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  121057  VVSVQHVDIRVAGKAYVFQI-----QKGFYKLLCYCCSQFEAELWVAALRSV  121197

>PHCA:scaffold_9 PHYCAscaffold_9
Length=1114135

 Score = 40.0 bits (92),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
               G+V K+G   K+W+ RF+VL G   Q++YY++ A  +P     +  KGSF + ++E
Sbjct  844406  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNP----TTKAKGSFQVITVE  844552

>PHIF:NW_003303755.1 Phytophthora infestans T30-4 supercont1.4 
genomic scaffold, whole genome shotgun sequence
Length=5137561

 Score = 40.0 bits (92),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 23/112 (21%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
                G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  1389124  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  1388987

Query  85       VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
                VV V    +  AGK + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  1388986  VVSVQHVDIRVAGKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALRSV  1388846

>ALCA:scaffold_265 AcNc2_CONTIG_265_length_35910 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_265_length_35910:1:35910:1 
REF
Length=35910

 Score = 40.0 bits (92),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +2

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLEGSNL  49
             T  EGY+ KRGH  +SWR RF VL G+ L
Sbjct  9548  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL  9634

>PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2386, whole genome shotgun sequence
Length=2296535

 Score = 39.7 bits (91),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = -2

Query  16       DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                D    T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  1002403  DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGT--IFSYYVSK  1002284

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = -3

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
               CEG++ KRG     W+ R+ +L+G  LQ
Sbjct  480819  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  480736

>ALLA:FR824502 dna:supercontig supercontig:ENA1:FR824502:1:15894:1 
REF
Length=15894

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQI  51
             T  EGY+ KRGH  +SWR RF VL G+ L  
Sbjct  7745  TDWEGYIWKRGHVVRSWRHRFAVLSGTCLSC  7653

>PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2904, whole genome shotgun sequence
Length=1431973

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 53/112 (47%), Gaps = 23/112 (21%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G++ K+GH  KSW+ RF VL  S+  + YY++++            KG  +L+     + 
Sbjct  779623  GWLKKQGHMWKSWKARFFVL-FSDGTVVYYKNKSR--------KKIKGYMHLN-----DG  779760

Query  85      VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
               VV V    +  AGK + F++     +KG+  L     +Q D   W+   R+ 
Sbjct  779761  VVSVQHVDIRVAGKAYVFQI-----EKGFYRLLCHCSSQIDAELWVTALRSV  779901

>PYVX:scaffold_378 pve_scaffold_378 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_378:1:27273:1 
REF
Length=27273

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 8/76 (11%)
 Frame = +1

Query  6     VPEIGATASGDKA-RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPA  64
             + E   T +GD A      EGY+ KRGH   S R R+ VL G+  +++Y+    A    +
Sbjct  5146  MAENAVTPAGDDAGSAVLMEGYLVKRGHLMPSMRKRYCVLVGN--KVTYF----ATQDDS  5307

Query  65    AEPSAP-KGSFYLSSI  79
               P+AP  GSF ++++
Sbjct  5308  RNPNAPSNGSFNVATV  5355

>PHKE:scaffold_90 scf_22126_90.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_90.1:1:106827:1 
REF
Length=106827

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 56/126 (44%), Gaps = 21/126 (17%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
              GY+ K+G F KSWR RF +L      + YY S        AE  A  G     SI+ H  
Sbjct  86298  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS--------AEELAKLGEI---SIDEHT-  86155

Query  85     VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDR--NKWLEVARNALSAK-RQLTR  141
               V      G PF F MI +  +K    L +F E QG+     W+      ++ + R  +R
Sbjct  86154  TVQPTPKEGFPFRF-MIENEGRK----LTLFAE-QGEEAMEAWISCINGCITQRVRATSR  85993

Query  142    QAIDQS  147
               +I+ S
Sbjct  85992  ASINGS  85975

>PYVX:scaffold_291 pve_scaffold_291 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_291:1:31219:1 
REF
Length=31219

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = -1

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISY  53
              T  EGY+ K+GH  +SWR R+ VL G+     +
Sbjct  29512  TDWEGYIWKQGHVVRSWRYRYAVLSGTTFSCKW  29414

>HYAP:scaffold_99 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_99:1:256057:1 
REF
Length=256057

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              GY+ K+G F KSWR RF +L      +SYY S
Sbjct  21634  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  21539

>SAPA:scaffold_37 supercont2.37 dna:supercontig supercontig:ASM15154v2:supercont2.37:1:335642:1 
REF
Length=335642

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +1

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
               T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  106645  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  106755

>PYAP:scaffold_792 pag1_scaffold_792 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_792:1:13422:1 
REF
Length=13422

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (69%), Gaps = 2/32 (6%)
 Frame = +2

Query  25    GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
             G++ K G   KSWR R+ VLEGS LQ  YYES
Sbjct  1667  GWLRKEGQRMKSWRRRYFVLEGSKLQ--YYES  1756

>PYAR:scaffold_1116 par_scaffold_1116 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1116:1:10258:1 
REF
Length=10258

 Score = 39.3 bits (90),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
             T  EGY+ K+GH  ++WR R+ +L G+    SYY S+
Sbjct  3823  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  3927

>PYIR:scaffold_3100 pir_scaffold_3100 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_3100:1:1877:1 
REF
Length=1877

 Score = 38.9 bits (89),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 52/121 (43%), Gaps = 18/121 (15%)
 Frame = +1

Query  4    LRVPEIGATASGDKARPTSCEGYVTKRGHFRKS--WRVRFLVLEGSNLQISYY--ESRAA  59
            +R   + ATA   ++R T+CE ++ +R    +S  W +RF     + +Q++++  ++ +A
Sbjct  109  VRTSSVVATAQNTRSRRTNCETFLAERSRTTRSDFWCLRFCTASTTAIQMAWHS*KTTSA  288

Query  60   CHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQ  119
              PP      P+    L      E +               + H P++ +V L  FV   
Sbjct  289  LPPPTQRMRLPRSQRQLHQRLRDERL--------------RLPHLPRQNFVALGEFVAVM  426

Query  120  G  120
            G
Sbjct  427  G  429

>ALLA:FR824471 dna:supercontig supercontig:ENA1:FR824471:1:18709:1 
REF
Length=18709

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 17/112 (15%)
 Frame = +2

Query  25    GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL---SSIEP  81
             GY+ KRG   KS+R R++ L G+ L  SYY+ + +        + P+GS  L   +S++P
Sbjct  5756  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTSLQP  5929

Query  82    HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              E       +  + +G  ++  +        ++  E + + ++WL+   NA+
Sbjct  5930  LE-------SKTEKYGIVLVTTSRT-----WELVAENESEYHRWLKELCNAV  6049

>PHKE:scaffold_269 scf_22126_269.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_269.1_contig_1:1:49737:1 
REF
Length=49737

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = +2

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
              G+V K+G   K+W+ RF+VL G   Q++YY++ A   P        KGSF + ++E
Sbjct  17525  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVSPTV----KAKGSFQVITVE  17671

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 5/50 (10%)
 Frame = +2

Query  7      PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              P  GA    D   P +  G+V K G   +SW+ RFLV +G+ L  +YY++
Sbjct  15527  PGTGAMGRTD---PVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  15661

>PYIW:scaffold_1215 piw_scaffold_1215 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1215:1:10379:1 
REF
Length=10379

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = -3

Query  25    GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
             G+V K+G   ++W+ RFLVL G   Q++YY++ A+  P   E    KGSF + ++E
Sbjct  9234  GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPKTKE----KGSFQVITVE  9088

>PYUU:scaffold_2006 scf1117875582006 dna:supercontig supercontig:pug:scf1117875582006:1:1270039:1 
REF
Length=1270039

 Score = 38.9 bits (89),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
 Frame = -2

Query  11      ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
               AT +      T   G++ K+GH  KSW+ RF V+EGS   I+Y+E
Sbjct  804363  ATVTSGSDSGTRKTGWLNKQGHRMKSWKRRFFVVEGST--ITYFE  804235

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 61/129 (47%), Gaps = 25/129 (19%)
 Frame = -2

Query  13      ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
               AS D + P  C G++ K G   K+W++R+  L+G+ L  +Y++S              KG
Sbjct  803448  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS-------------DKG  803317

Query  73      SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
                  L +++    V  V+    K F  ++     +K    L +  +TQ + ++WL     A
Sbjct  803316  PL-LKALK----VCYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQA  803164

Query  133     LSAKRQLTR  141
               +SA+++  R
Sbjct  803163  VSAEKEKDR  803137

 Score = 34.7 bits (78),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
               CEG++ KRG    +W+ RF  L G  LQ
Sbjct  804747  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  804664

>SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.13:1:908568:1 
REF
Length=908568

 Score = 38.9 bits (89),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
               T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  537378  TDWEGYIWKQGHVVRNWRNRYAVLSGT--CFTYYASKEA  537488

>SAPA:scaffold_467 supercont2.467 dna:supercontig supercontig:ASM15154v2:supercont2.467:1:7718:1 
REF
Length=7718

 Score = 38.9 bits (89),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +1

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
             T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A 
Sbjct  7465  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAA  7578

>PHIF:NW_003303710.1 Phytophthora infestans T30-4 supercont1.49 
genomic scaffold, whole genome shotgun sequence
Length=1170383

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = -1

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
                 GY+ K+G F KSWR RF +L      + YY S
Sbjct  756122  TSGYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  756021

>PYVX:scaffold_1190 pve_scaffold_1190 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1190:1:6005:1 
REF
Length=6005

 Score = 38.5 bits (88),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 16/113 (14%)
 Frame = -1

Query  22    SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
             S  G++ K GH RK+W+ R+ VLE S L+    ESR+            KG   L     
Sbjct  1958  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL----------KGEVLLFHPAT  1809

Query  82    HEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
               + V +  + G+   F + +G      Y  L +  E   DR  W+    +AL
Sbjct  1808  RVHYVDIHLSGGRDNTFAIQVG----SDYTLL-LQAERLSDRENWMYCIEDAL  1665

>PYVX:scaffold_44 pve_scaffold_44 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_44:1:74626:1 
REF
Length=74626

 Score = 38.5 bits (88),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
              G+V K+G   ++W+ RF+VL G   Q++YY++  A   P+ +    KGSF L ++E
Sbjct  13987  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT--ARLTPSVK---AKGSFTLITVE  14133

>PHPA:scaffold_98 NW_008649084.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.98, whole genome shotgun 
sequence
Length=151830

 Score = 38.5 bits (88),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              GY+ K+G F KSWR RF +L      + YY S
Sbjct  62031  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  61936

>SAPA:scaffold_273 supercont2.273 dna:supercontig supercontig:ASM15154v2:supercont2.273:1:15865:1 
REF
Length=15865

 Score = 38.5 bits (88),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 31/60 (52%), Gaps = 9/60 (15%)
 Frame = -2

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
             P    GYV K+G F K+W+ RF+VL    L   YY S  A        + P+G F ++S+
Sbjct  2949  PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTSV  2797

>SADI:scaffold_72 supercont1.72 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.72:1:302499:1 
REF
Length=302499

 Score = 38.5 bits (88),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 24/114 (21%)
 Frame = +3

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
               + EG++ K+G    +W+ R++VL+G    I+YY+ +   +P A E    KG+F L+++E 
Sbjct  145548  AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVSNPRAKE----KGTFTLAAVER  145706

Query  82      HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135
                          G   G  + G+  K     + ++ +T G+      +  NA++A
Sbjct  145707  ---------TPGMELGLTLAGYDGKI----MHIYTKTVGE----FVLCNNAMTA  145817

>ALCA:scaffold_55 AcNc2_CONTIG_55_length_103441 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_55_length_103441:1:103441:1 
REF
Length=103441

 Score = 38.5 bits (88),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 71/180 (39%), Gaps = 30/180 (17%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
              GY+ K+G F KSWR RF +L      ++YY S+        E S    S  L +  P   
Sbjct  93098  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHL-TKLGEISVDDQSVLLKT--PRN-  92931

Query  85     VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGD-RNKWLEVARNALSAKRQLTRQA  143
                      G P  F  + HA +     L +F E   D  N W++  R +   + ++ R A
Sbjct  92930  --------GIPHCF-TVKHAART----LIMFTEDGEDIMNTWMD--RISRCIRLRIDRNA  92796

Query  144    IDQ--------SVSSNKKNLFGFGVSLSPQPLMTPQKQMQT--LTQNKDELLSGALRDIE  193
              I          SV+S +  L     ++   P   P  + Q   L  N    L GAL  +E
Sbjct  92795  ITNTIMDREQSSVNSTESALILDTAAIRAHPKTHPSHKHQNVHLASNDSFRLLGALEQME  92616

>SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154v2:supercont2.7:1:943373:1 
REF
Length=943373

 Score = 38.1 bits (87),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 37/59 (63%), Gaps = 7/59 (12%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
               + EG++ K+G    +W+ R++VL+G    I+YY+ +   +P A E    KG+F L+++E
Sbjct  162385  AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVTNPRAKE----KGTFTLAAVE  162230

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 30/131 (23%), Positives = 63/131 (48%), Gaps = 23/131 (18%)
 Frame = -3

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI--  79
               + EGY+ K+GHF  + + +++VL G++L   +Y S  A     A+ +A  G   ++S+  
Sbjct  568461  TVEGYLVKQGHFVPTMKQKYVVLRGNHL--FFYASYDAY---MAKTTADVGCSQVASVGD  568297

Query  80      -EPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE-----VARNAL  133
                + H  ++        PF  + + HA      ++     T  +++KW+      +A++A+
Sbjct  568296  WDGHTLLLTY----PHPFRIETVAHA------QVLCSAPTASEKDKWMRGLRAAIAKHAI  568147

Query  134     SAKRQLTRQAI  144
                AK   +   +
Sbjct  568146  GAKTSTSSDVV  568114

>PYVX:scaffold_47 pve_scaffold_47 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_47:1:73819:1 
REF
Length=73819

 Score = 38.1 bits (87),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (52%), Gaps = 2/54 (4%)
 Frame = +1

Query  7     PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
             P+  AT S D  +   C G++ K+G    SW+ R+  L GS L+  YY+S    
Sbjct  8296  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKSETGA  8451

>PHSO:scaffold_3
Length=10773376

 Score = 38.1 bits (87),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
                GY+ K+G F KSWR RF +L      + YY S
Sbjct  3934639  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  3934544

 Score = 33.9 bits (76),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
                EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  2073133  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIP  2073008

>APIN:scaffold_71 supercont1.71 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.71:1:149896:1 
REF
Length=149896

 Score = 38.1 bits (87),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 57/137 (42%), Gaps = 16/137 (12%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR----AACHPPAAEPSAPKGSFYLSSIE  80
              G + KRGH RK+W  RF VL    L+  YY       A C   + +P   +G   L+ I 
Sbjct  53449  GILLKRGHLRKNWLTRFFVLTSGALR--YYRKPPGGGAKCTTWSVDPRYLRGELPLADII  53622

Query  81     PHEYVVGVMGAAGKP----FGFKMIGHAP---KKGYVELDVFVETQGDRNKWLEVARNAL  133
                E        A  P    F   ++ H      +  V   +   T+ +R +W+ V R   
Sbjct  53623  HVECDDSTPQPAYHPRTYRFTITVLRHRILFLVRRPVRFHLQATTEDERERWVRVLRE--  53796

Query  134    SAKRQLTRQAIDQSVSS  150
                ++QL++  + +  S+
Sbjct  53797  -PRKQLSKVTLPRHTSA  53844

>PYIR:scaffold_1235 pir_scaffold_1235 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1235:1:9021:1 
REF
Length=9021

 Score = 38.1 bits (87),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 16/84 (19%)
 Frame = -2

Query  22    SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
             S EGY+ K+    +SW+  + VLEG  +  +YYESR          S   G   +  +E 
Sbjct  3614  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDF----ISNSKLMGRIQIQGVED  3453

Query  82    HEYVVGVMGAAGKPFGFKMI--GH  103
                        GKP GF++I  GH
Sbjct  3452  DN--------MGKPNGFRVITEGH  3405

>PYUU:scaffold_1722 scf1117875581722 dna:supercontig supercontig:pug:scf1117875581722:1:328448:1 
REF
Length=328448

 Score = 38.1 bits (87),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
              G+V K+G   ++W+ RF+VL G   Q++YY++ A+  P   E    KGSF + + E
Sbjct  48051  GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-ASISPKTKE----KGSFQVITAE  48197

 Score = 37.4 bits (85),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 5/56 (9%)
 Frame = +2

Query  1      MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              M++++ P    + S    +P    G++ K+GH  +SW+ R+ VL G +LQ  Y+E+
Sbjct  76295  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN  76447

 Score = 33.5 bits (75),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 2/51 (4%)
 Frame = +2

Query  5      RVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
              +V E     SG++      EG++ K+G   K+W+ R+ VLE S L   YY+
Sbjct  76649  QVEETNLDNSGNRLGRLGQEGWLLKKGQNFKTWKQRYFVLERSRLM--YYD  76795

>PHRA:scaffold_66
Length=301783

 Score = 38.1 bits (87),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              GY+ K+G F KSWR RF +L      + YY S
Sbjct  68663  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  68568

>HYAP:scaffold_29 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_29:1:564789:1 
REF
Length=564789

 Score = 38.1 bits (87),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 56/133 (42%), Gaps = 18/133 (14%)
 Frame = +1

Query  1      MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
              M+ + +    A+ S         EGYV K+G +   W  R+L+L+G  L  +YY S+   
Sbjct  31486  MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKED-  31656

Query  61     HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
                 A      +G   L  + P  Y        GK  GF +      + +    +   ++ 
Sbjct  31657  ---ARSARNLRGRMLLLKVRPENY--------GKAHGFFL----ETQSHKHFHLCCSSEL  31791

Query  121    DRNKWLEVARNAL  133
              +++ W+E+ + A+
Sbjct  31792  EKDMWVEMMQAAI  31830

>PHKE:scaffold_58 scf_22126_58.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_58.1:1:127707:1 
REF
Length=127707

 Score = 37.7 bits (86),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 52/112 (46%), Gaps = 23/112 (21%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
              G++TK+GH  KSW+ RF VL  S+    YY+++             KG   L+     + 
Sbjct  20051  GWLTKQGHMWKSWKTRFFVL-FSDGTFVYYKNKGR--------KKIKGCMQLN-----DG  19914

Query  85     VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
              VV +    +  A KP+ F++     +KG+  L  +  +Q +   W+   R+ 
Sbjct  19913  VVSIQHVDVRVAEKPYVFQI-----EKGFYRLLCYCCSQFEAELWVTALRSV  19773

>PHRA:scaffold_16
Length=604796

 Score = 37.7 bits (86),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 75/162 (46%), Gaps = 28/162 (17%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  436829  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  436966

Query  85      VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLT  140
               VV V    +  A K + F++     +KG+ +L  +  +Q +   W+     AL + R++T
Sbjct  436967  VVSVQHVDVRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVT  437119

Query  141     RQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQM-QTLTQNK  181
                   +  +++ ++      V+     +    KQ+ ++L Q K
Sbjct  437120  PPCYETDLTATEEKAGSNAVTRHLNKIFITDKQIAKSLVQFK  437245

>PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:pug:scf1117875582011:1:418791:1 
REF
Length=418791

 Score = 37.7 bits (86),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 16/84 (19%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
               S EGY+ K+    +SW+  + VLEG  +  +YYESR          +   G  ++ S+E 
Sbjct  318848  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDF----IMNTKLIGRIHIQSVED  318687

Query  82      HEYVVGVMGAAGKPFGFKMI--GH  103
                          GKP GF+++  GH
Sbjct  318686  DH--------MGKPNGFRILTEGH  318639

>APAS:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.4:1:1887962:1 
REF
Length=1887962

 Score = 37.7 bits (86),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 5/51 (10%)
 Frame = -2

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAP  70
                P   EGY+ KRG +   W    +VL+G  L++SYY+       P A+P AP
Sbjct  1422163  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLDG---PPAKPHAP  1422026

>ALCA:scaffold_464 AcNc2_CONTIG_464_length_18313 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_464_length_18313:1:18313:1 
REF
Length=18313

 Score = 37.7 bits (86),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 87/200 (44%), Gaps = 36/200 (18%)
 Frame = -2

Query  10     GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSA  69
              GA A   K    +  GY+ KRG   KS+R R++ L+G+ L  SYY+ + +        + 
Sbjct  15537  GAKAC-QKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTY  15367

Query  70     PKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVA  129
               +GS +L S+      +  + +  + +G  ++  +        ++ VE + + ++WL+  
Sbjct  15366  LRGSIHLESVTS----LQPLESKTEKYGVVLVTTSRT-----WELVVENEIEYHRWLKEL  15214

Query  130    RNA-------LSAKRQLTRQ--------------AIDQSVSSNKKNLFG-FGVSLSPQPL  167
               NA       ++ KR    Q              A D +V    +++F  +  +L   PL
Sbjct  15213  CNAVEFYAVHITYKRMFQLQEVSAKAITDVRMVIATDDTVEEIVEHIFNCYKQALDAAPL  15034

Query  168    --MTPQKQMQTLTQNKDELL  185
                  P++ +  +T  +D L+
Sbjct  15033  KPYIPEEYVLKITGYRDYLI  14974

>PHPA:scaffold_2 NW_008648988.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.2, whole genome shotgun 
sequence
Length=2916180

 Score = 37.7 bits (86),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (46%), Gaps = 18/112 (16%)
 Frame = -3

Query  25       GYVTKR---GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
                GY+ KR     +  SWR  F VL+G+ L+  +Y S+      A   +  +G  ++ SIEP
Sbjct  2778970  GYLRKRYSSSMYMGSWR--FCVLQGARLR--WYRSKEC----AETDTQLRGEVWVQSIEP  2778815

Query  82       HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                 +   G    A  P  F +   + K     L    ETQ DR+ WL+    AL
Sbjct  2778814  WD---GRTALATYPHAFAVRTTSKKL----LLCTAETQRDRDLWLQHLERAL  2778680

>PLHA:NW_020190023.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3120, whole genome shotgun sequence
Length=2481951

 Score = 37.4 bits (85),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
                GY+ K+G F KSWR RF +L      + YY S
Sbjct  1843159  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  1843064

>SAPA:scaffold_70 supercont2.70 dna:supercontig supercontig:ASM15154v2:supercont2.70:1:179816:1 
REF
Length=179816

 Score = 37.4 bits (85),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 23/110 (21%)
 Frame = -2

Query  19     RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
              +P  C GY+ K+G   K+WR R+  ++G + Q+SY +         A+ + PKG      
Sbjct  16438  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSD---------ADGAPPKG------  16307

Query  79     IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
                   +VV V     +PF   +   + ++    L V   TQ + + WL V
Sbjct  16306  ---FGHVVDVCVNTKRPFALYIHLASGRR----LAVAGSTQAEADTWLAV  16178

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 7/55 (13%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
              G+V K+G   KSW+ RFLV++G +  ++YY+ R+   P   E    KGS  L  +
Sbjct  17178  GFVFKQGALIKSWKKRFLVVQGRH--VTYYD-RSVHEPNPRE----KGSLVLVDV  17035

>PYIR:scaffold_1853 pir_scaffold_1853 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1853:1:4729:1 
REF
Length=4729

 Score = 37.4 bits (85),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 53/127 (42%), Gaps = 16/127 (13%)
 Frame = -3

Query  8     EIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
             +I    + D +   S  G++ K GH RK+W+ R+ VLE S L+    ES A         
Sbjct  2525  QITEVNAFDDSFLDSMCGWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARL-------  2367

Query  68    SAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWL  126
                KG   L       + V +  + GK   F + +G    K Y  L +  +   DR  W+
Sbjct  2366  ---KGEVLLFHPATRVHYVDIHLSGGKDCTFAIHVG----KDYALL-LQADQLSDRENWM  2211

Query  127   EVARNAL  133
                 +AL
Sbjct  2210  YCIEDAL  2190

>APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.15:1:1122121:1 
REF
Length=1122121

 Score = 37.4 bits (85),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                T  EGYV K+GH  ++WR R+ +L G+    +YY S+
Sbjct  1066084  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  1066188

>PYAP:scaffold_11 pag1_scaffold_11 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_11:1:137235:1 
REF
Length=137235

 Score = 37.4 bits (85),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
              G++ K+G   K+W+ RF+VL G   Q++YY++     P   E    KGSF + ++E
Sbjct  54496  GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTERIS-PRVKE----KGSFQVITVE  54350

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 49/115 (43%), Gaps = 24/115 (21%)
 Frame = -1

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
              C G++ K G   K+W+ RF  L G+ L+  Y++S              KGSF L + E  
Sbjct  57600  CSGWLNKEGGKVKTWKRRFFTLHGTTLK--YFKS-------------DKGSF-LRTYE--  57475

Query  83     EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKR  137
                V  V       FGF +  +  +K    + V  ET  +  KWL      L+ +R
Sbjct  57474  --VNAVEELPSLKFGFCVTMNGGRK----MIVTAETNEEYEKWLLAIWGVLADQR  57328

>APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.12:1:1527504:1 
REF
Length=1527504

 Score = 37.4 bits (85),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 26/44 (59%), Gaps = 2/44 (5%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
               EGY+ K+G   K W+ R+ V +G +L  SY+ ++A   P A  P
Sbjct  489917  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKADKTPSAVIP  490042

 Score = 37.0 bits (84),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
               EGY+ K+G   K W+ R+ V +G +L  SYY S+    P A  P
Sbjct  486848  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKPNAVIP  486973

>ALCA:scaffold_13 AcNc2_CONTIG_13_length_192192 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_13_length_192192:1:192192:1 
REF
Length=192192

 Score = 37.4 bits (85),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLEGS  47
               T  EGY+ K+GH  +SWR R+ VL G+
Sbjct  137083  TDWEGYIWKQGHVVRSWRYRYAVLSGT  137003

>PHCA:scaffold_27 PHYCAscaffold_27
Length=705730

 Score = 37.0 bits (84),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 53/112 (47%), Gaps = 23/112 (21%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G++TK+GH  KSW+ RF VL  S+   +YY+++             KG   L+     + 
Sbjct  527809  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGR--------KKIKGCMQLN-----DG  527946

Query  85      VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
               VV V    +  A K + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  527947  VVSVQHVDIRVADKAYVFQI-----EKGFYKLMCYCCSQFEAELWVSALRSV  528087

>HYAP:scaffold_312 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_312:1:30087:1 
REF
Length=30087

 Score = 37.0 bits (84),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 7/58 (12%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
              C G+V K+G   K+W+ RF+VL     Q++YY +        A     KGSF + ++E
Sbjct  10053  CAGWVYKQGSLVKNWKKRFMVLR--ERQLTYYNTDIVTPTVKA-----KGSFQVITVE  10205

>SADI:scaffold_77 supercont1.77 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.77:1:267713:1 
REF
Length=267713

 Score = 37.0 bits (84),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 47/104 (45%), Gaps = 30/104 (29%)
 Frame = -3

Query  37      WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
               W+ R+ VL+ S L I YYES  A    AAE S  KG     S+  H++        GKP 
Sbjct  198066  WKRRYCVLQESALAIFYYESEEA----AAEGSL-KGKIPYCSV--HDW-------DGKPH  197929

Query  97      GFKMIGHAPKKGYVE--------------LDVFVETQGDRNKWL  126
               GF++    P +G +                 V+ ++  +RNKW+
Sbjct  197928  GFQV--DTPYRGILGSCTCT*FYTPTNKCFRVYCDSDDERNKWM  197803

>APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.2:1:2059303:1 
REF
Length=2059303

 Score = 37.0 bits (84),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 2/44 (5%)
 Frame = +3

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
                EGY+ K+G   K W+ R+ V +G +L  SYY ++    P A  P
Sbjct  1220973  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKLEKKPNAVIP  1221098

 Score = 33.9 bits (76),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (5%)
 Frame = +2

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
                EGY+ K+G   K W+ R+ V +G  L  SY+ +     P A  P
Sbjct  1224350  EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHTNLDKTPSAIIP  1224475

>APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.14:1:1185136:1 
REF
Length=1185136

 Score = 37.0 bits (84),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
                T  EGYV K+GH  ++WR R+ +L G+    +YY S+
Sbjct  1143919  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  1144023

>SADI:scaffold_17 supercont1.17 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.17:1:803178:1 
REF
Length=803178

 Score = 36.6 bits (83),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 32/57 (56%), Gaps = 7/57 (12%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
                 G+V K+G   KSW+ RFLV++G +  +SYY+ R+   P   E    KGS  L  +
Sbjct  253370  WSGFVFKQGSLIKSWKKRFLVVQGRH--VSYYD-RSVHEPDPRE----KGSLVLGDV  253221

>HYAP:scaffold_46 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_46:1:421953:1 
REF
Length=421953

 Score = 36.6 bits (83),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 51/112 (46%), Gaps = 23/112 (21%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G++TK+GH  KSW+ RF VL       +YY+++             KG   L+     + 
Sbjct  109870  GWLTKQGHLWKSWKTRFFVLFADG-TFAYYKNKGR--------KKIKGCMQLN-----DG  110007

Query  85      VVGV----MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
               VV V    +  A K + F++     +KG+ +L  +  +Q +   W+   R+ 
Sbjct  110008  VVSVQHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALRSV  110148

>PHCA:scaffold_72 PHYCAscaffold_72
Length=230452

 Score = 36.6 bits (83),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +2

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              GY+ K+G F KSW+ RF +L      + YY S
Sbjct  70904  GYLVKQGSFWKSWKRRFFILRRDRPVLCYYTS  70999

>PYAR:scaffold_951 par_scaffold_951 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_951:1:11721:1 
REF
Length=11721

 Score = 36.6 bits (83),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = -2

Query  1      MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRA  58
              +N L +    A+   D    + C G++ K GH RK+W++R+ VLE S L+  YY   A
Sbjct  10805  LNGLYLDHPTASPFDDTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEA  10641

>PYUU:scaffold_2025 scf1117875582025 dna:supercontig supercontig:pug:scf1117875582025:1:692778:1 
REF
Length=692778

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
               GY+ K+G + K+WR R+ +L      +SYY+S
Sbjct  138731  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  138826

>SADI:scaffold_20 supercont1.20 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.20:1:765613:1 
REF
Length=765613

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 49/123 (40%), Gaps = 14/123 (11%)
 Frame = -3

Query  18      ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK-GSFYL  76
               A  T  EGY+ KR  + K W   + VL G  L        A   P   E S  K G+F  
Sbjct  296570  AVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQP---ENSKIKHGAFSF  296400

Query  77      SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFV--ETQGDRNKWLEVARNALS  134
               +S    ++VV + G     F F+     P        VF+  +TQ  +  W+ +A   + 
Sbjct  296399  TSHVILQHVVSIHGHGAFDFIFETSSGKP--------VFLRAKTQAMKTLWMAMAAQGIH  296244

Query  135     AKR  137
                 R
Sbjct  296243  DTR  296235

>SADI:scaffold_1 supercont1.1 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.1:1:1813439:1 
REF
Length=1813439

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 39/73 (53%), Gaps = 11/73 (15%)
 Frame = -1

Query  9       IGATASGDKAR--PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAE  66
               + ++ SG++A   P +  GYV K+G F K+W+ R++VL    L   YY S  A       
Sbjct  206723  LSSSRSGNEAPSGPPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT------  206568

Query  67      PSAPKGSFYLSSI  79
                + P+G F ++ I
Sbjct  206567  -TKPRGFFRVTGI  206532

>PYIW:scaffold_735 piw_scaffold_735 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_735:1:14751:1 
REF
Length=14751

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              GY+ K+G F K+WR R+ +L      +SYY+S
Sbjct  12042  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  11947

>PYAP:scaffold_87 pag1_scaffold_87 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_87:1:70840:1 
REF
Length=70840

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +3

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHP  62
             EGY+ K+G   K W+ R+ V +G  L  SYY SR    P
Sbjct  5436  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  5546

>APAS:scaffold_36 supercont1.36 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.36:1:490657:1 
REF
Length=490657

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 20/134 (15%)
 Frame = +3

Query  24     EGYVTKRG-HFRKSWRVRFLV-LEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
              EGY+ K+G  FR   +  F++ LE  ++ + YY S+ A    +  P  P  + Y  S+E 
Sbjct  29778  EGYMLKQGSRFRMLTKRYFILRLEEKHMTLGYYTSKEALVLCSETPIGPGHALYDISVEG  29957

Query  82     HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTR  141
              H  +                    + G   L V VET+ D  KW    + A+   + +  
Sbjct  29958  HHRL------------------ELRHGTTSLIVEVETEADFVKWKNCLQEAVRWHQAMVF  30083

Query  142    QAIDQSVSSNKKNL  155
                 ++  S  KK L
Sbjct  30084  DGANKVTSYGKKCL  30125

>APAS:scaffold_22 supercont1.22 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.22:1:940546:1 
REF
Length=940546

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 48/121 (40%), Gaps = 8/121 (7%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGY+ KR  + K W   + VL G  L     +  A  HP  ++     G F  S     +
Sbjct  441431  EGYLMKRSDWLKHWETYYFVLHGRVLYCYLSDEEAKLHPENSK--IKHGKFTFSDNLILD  441258

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQA  143
                V+ V       F F+       KG  ++ +  +T+  +  W+ +A + +     L  Q 
Sbjct  441257  EVITVQSRLTYEFVFE-----SDKG-KQIHLRAKTEASKQMWMHMACHGIVDTEMLRNQV  441096

Query  144     I  144
               +
Sbjct  441095  L  441093

>PYAR:scaffold_799 par_scaffold_799 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_799:1:13125:1 
REF
Length=13125

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (41%), Gaps = 11/132 (8%)
 Frame = -1

Query  6     VPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAA  65
             V EI A  S  +      EGY+ KRGH   S R R+ VL  + L  +YY ++       +
Sbjct  6741  VDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSR--NS  6574

Query  66    EPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKW  125
             + S P GSF +  +       G        FG ++  H  K  +        +  ++ +W
Sbjct  6573  DTSQPLGSFRVEIVSDWH---GKTAMQTYEFGMELETHDGKTFFCA----AFSSEEKTQW  6415

Query  126   LEVARNALSAKR  137
             +    + ++  R
Sbjct  6414  IRAFHHGIAISR  6379

>PHCA:scaffold_42 PHYCAscaffold_42
Length=526029

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 57/130 (44%), Gaps = 28/130 (22%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR-AACHPPAAEPSAPKGSFYL------  76
               EGY+ KRGH   S R R+ VL G+ L  SYY +   + +P     + P G+F++      
Sbjct  350103  EGYLMKRGHKIPSMRKRYCVLIGNEL--SYYVTHDDSKNPGGGAMTNPLGNFHIEVAGDW  349930

Query  77      ---SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                  ++ + +E+ + +    GK F                     T  ++ +W++  R  +
Sbjct  349929  HGKTATQTYEHAMELETTDGKTFF----------------CAAATAKEKQQWVDAFRRGI  349798

Query  134     SAKRQLTRQA  143
               +  R+  R+A
Sbjct  349797  ALARKEQRRA  349768

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 50/114 (44%), Gaps = 25/114 (22%)
 Frame = -3

Query  24      EGYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
               +GY+  R H   S WR RF+VLEGS+L I Y E+   C     +P  P       ++E H
Sbjct  347470  DGYLRVRHHNLGSVWRDRFVVLEGSSLTI-YSEN---CVLDEGKPRFPN-----LAVEQH  347318

Query  83      EYV-----------VGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKW  125
               E V           +G  G+  K  GF+    A     V L+   +T  +  KW
Sbjct  347317  ELVGVEKWRPVFTSLGRSGSGLKGTGFR----AETSSGVYLEFTAKTAEEATKW  347168

>PHRA:scaffold_3
Length=946144

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
               G+V K+G   ++W+ RF+VL G   Q++YY++ A   P        KGSF + ++E
Sbjct  661720  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  661574

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 54/124 (44%), Gaps = 24/124 (19%)
 Frame = -2

Query  13      ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
               +S  ++    C G++ K G   KSW+ R+  L GS L  SYY+S              KG
Sbjct  666363  SSTTQSESKGCVGWLKKEGGNVKSWKRRYFTLYGSKL--SYYKSE-------------KG  666229

Query  73      SFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
               S  L S+     VV +        G  ++    +K  ++ D    +  + NKWL   + A
Sbjct  666228  SL-LRSVS----VVDITAHPSVSLGLTVLTVGGRKLIIQAD----SNEEFNKWLGAIQEA  666076

Query  133     LSAK  136
               ++A+
Sbjct  666075  VAAE  666064

>PYIR:scaffold_78 pir_scaffold_78 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_78:1:58522:1 
REF
Length=58522

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              GY+ K+G F K+WR R+ +L      +SYY+S
Sbjct  48174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  48079

>PYIW:scaffold_784 piw_scaffold_784 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_784:1:14159:1 
REF
Length=14159

 Score = 35.8 bits (81),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 3/41 (7%)
 Frame = -2

Query  16     DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              D++ P  C GY+ K G   KSW++R+  L G+ L  SY++S
Sbjct  10108  DESLP-GCSGYLRKEGSTIKSWKLRYFTLTGTTL--SYFKS  9995

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -3

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              CEG++ KRG    +W+ RF  L G   Q++Y E+
Sbjct  11703  CEGWLYKRGQRSTAWKKRFFTLNG--FQLTYQEN  11608

>SADI:scaffold_8 supercont1.8 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.8:1:1177252:1 
REF
Length=1177252

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 66/157 (42%), Gaps = 33/157 (21%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G+V KRG   +SW+ R+ VL  + L  +YY+      P        KG   + SIE    
Sbjct  755264  GWVEKRGAVMRSWKRRYFVLRENVL--AYYDINLEGQP-------KKGGDLVQSIE----  755404

Query  85      VVGVMGAAGKPFG--FKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS----AKRQ  138
                     +  KP G  FKM+      G      F ET  D  +WL +A N L     AKR 
Sbjct  755405  -----TSTVKPNGLEFKMVSGRSLVG------FTETTDDHVQWL-LAANTLYHEP*AKRV  755548

Query  139     LTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQ  175
                 +  + Q+ S++ +   G   S S  P  TP  + Q
Sbjct  755549  KLKNVVWQNPSASTRT--GAWPSGS*SPAATPCARCQ  755653

>PYAR:scaffold_995 par_scaffold_995 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_995:1:11277:1 
REF
Length=11277

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 53/116 (46%), Gaps = 24/116 (21%)
 Frame = +1

Query  23    CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
             C G++ K+G   KSW+ RF  L G+ L+  Y+++               G F   +    
Sbjct  7864  CSGWLRKQGGHIKSWKERFFTLVGTTLR--YFKTE-------------NGPFIGGAT---  7989

Query  83    EYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138
               +V V+    +   F+M  ++ +K    + V  E++G+  +W+   + A++  R+
Sbjct  7990  --IVHVLLIHTRKHSFEMTLNSGRK----MAVLAESEGEAERWIRALKRAIAVARE  8139

>PYIW:scaffold_1511 piw_scaffold_1511 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1511:1:8511:1 
REF
Length=8511

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 16/116 (14%)
 Frame = +1

Query  22    SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
             S  G++ K GH RK+W+ R+ VL+ S L+    ES A            KG   L     
Sbjct  3250  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL----------KGEVLLFHPAT  3399

Query  82    HEYVVGVMGAAGKPFGFKM-IGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
               + V +  + GK   F + +G    K Y  L +  E   DR  W+    +AL  +
Sbjct  3400  RVHYVDIHLSGGKDGTFAIHVG----KDYALL-LQAEQLSDRENWMYCIEDALLCR  3552

>PHPA:scaffold_25 NW_008649011.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.25, whole genome shotgun 
sequence
Length=859936

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 60/146 (41%), Gaps = 27/146 (18%)
 Frame = -3

Query  13     ASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPK  71
              A  D    T  +GY+  R H   S WR RF+VLEGS L + + E+   C     E   P+
Sbjct  88196  AGNDNTDTTQTKGYLRVRHHNLGSIWRERFVVLEGSTLTV-FSEN---CQ--LDEEGKPR  88035

Query  72     GSFYLSSIEPHEYV-----------VGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120
                F   ++E HE V           +G  G+  K  GF+    A     V L+    T  
Sbjct  88034  --FPDLAVEKHELVGVEKWHPVFTSLGRSGSGLKGTGFR----AETSSGVYLEFIATTAE  87873

Query  121    DRNKW---LEVARNALSAKRQLTRQA  143
              D  KW   +  A    SA   ++R A
Sbjct  87872  DAFKWKSAITAATTKESATATVSRDA  87795

>PYIR:scaffold_47 pir_scaffold_47 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_47:1:69492:1 
REF
Length=69492

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 4/52 (8%)
 Frame = -2

Query  6      VPEIG-ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
              VP +G    S D++ P  C G++ K G   K+W++R+  L G+ L  SY++S
Sbjct  53090  VPYVGMGCVSLDESFP-GCSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  52944

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 23/46 (50%), Gaps = 4/46 (9%)
 Frame = -2

Query  5      RVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              + P +G T     A    CEG++ KRG    +W+ RF  L G  LQ
Sbjct  54434  KTPFLGETF----AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  54309

>ALLA:FR824107 dna:supercontig supercontig:ENA1:FR824107:1:102118:1 
REF
Length=102118

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              EGY+ KRGH   S R R+ VL+  N  + Y+E++
Sbjct  26529  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETK  26630

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = -3

Query  6      VPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
               PE     + D +   S  G++ K GH RK+W+ R+ VLE S L+  YY
Sbjct  62991  TPEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YY  62851

>PYIR:scaffold_12 pir_scaffold_12 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_12:1:99369:1 
REF
Length=99369

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = -2

Query  7      PEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
              P +  ++    A P    G++ K+G   KSW+ R+ VLEG  LQ  YYE
Sbjct  87827  PTVTISSPSVVAAPEIKYGWLLKQGSLIKSWKRRYFVLEGDLLQ--YYE  87687

>APIN:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.2:1:2980645:1 
REF
Length=2980645

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 63/124 (51%), Gaps = 18/124 (15%)
 Frame = -1

Query  17      KARPTS---CEGYV-TKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKG  72
               +++P+S    EG+V  +R HF  +W+  + VL+G  L  + Y++R        +P++ + 
Sbjct  276244  QSQPSSEIFLEGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKRE  276071

Query  73      SFYLSSIEPHEYVVGV-MGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARN  131
                 ++      ++  GV  G A   F  + I    + G+VE   +V+   D+ +W++  + 
Sbjct  276070  VVFVG-----DWYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQT  275924

Query  132     ALSA  135
               A+S+
Sbjct  275923  AVSS  275912

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = -2

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
                EG + K+G F ++WR R+ +L       SYY+S
Sbjct  2234571  EGSLVKQGSFWRTWRKRWFILRSDRPLFSYYKS  2234473

>SAPA:scaffold_40 supercont2.40 dna:supercontig supercontig:ASM15154v2:supercont2.40:1:298837:1 
REF
Length=298837

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (53%), Gaps = 13/70 (19%)
 Frame = -1

Query  17      KARPTSC------EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAP  70
               +AR TS        G++ K+G   K+W+ RF+VL+  +L   Y+E+      P  +   P
Sbjct  230200  RARSTSAPPSRDHRGWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---P  230042

Query  71      KGSFYLSSIE  80
               KGSF +  IE
Sbjct  230041  KGSFQVLVIE  230012

 Score = 33.5 bits (75),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
               EGY+ K+GH  K+WR RF  L G++L+
Sbjct  105637  EGYLLKQGHVVKNWRRRFFRLLGASLE  105557

>PYAR:scaffold_122 par_scaffold_122 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_122:1:30762:1 
REF
Length=30762

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 2/44 (5%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
             EG++ K+G   KSW+ R+ V +G  L  SYY SR    P A  P
Sbjct  2123  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISRKDRKPNAIIP  1998

>ALCA:scaffold_25 AcNc2_CONTIG_25_length_153538 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_25_length_153538:1:153538:1 
REF
Length=153538

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 8/56 (14%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
              G+V K+G   K+W+ RF+VL G+ L+  YY S       ++  +  KGS  + S+E
Sbjct  24954  GWVYKQGAIVKTWKRRFMVLNGTELK--YYNS------SSSMKTEEKGSVQILSVE  25097

>PHKE:scaffold_238 scf_22126_238.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_238.1_contig_1:1:54351:1 
REF
Length=54351

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 12/62 (19%)
 Frame = +2

Query  34    RKSWRVRFLVLEGSNLQISYYESRAACHPPAA-----------EPSAP-KGSFYLSSIEP  81
             ++SW  R+ VL+     +SYY    A H P A            P+ P KGS  +SS +P
Sbjct  5279  KRSWHRRWFVLDRQRGVLSYYRHNPANHIPTASSHGNIVHMADSPAPPGKGSAAVSSSQP  5458

Query  82    HE  83
             HE
Sbjct  5459  HE  5464

>PYAP:scaffold_549 pag1_scaffold_549 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_549:1:22126:1 
REF
Length=22126

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 2/44 (5%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              EGY+ K+G   K W+ R+ V  G  L  SYY SR    P A  P
Sbjct  18799  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISRKDRKPNAVIP  18924

>PYIW:scaffold_651 piw_scaffold_651 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_651:1:15595:1 
REF
Length=15595

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 48/113 (42%), Gaps = 18/113 (16%)
 Frame = -3

Query  22     SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
              S EGY+ K+    ++W+  + VLEG  +  +YYESR          S   G   +  +E 
Sbjct  12473  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESREDF----ISNSKLIGRIQIQGVED  12312

Query  82     HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALS  134
                         GKP GF++I    +  ++       T  ++++W    +  LS
Sbjct  12311  DN--------MGKPNGFRIITEGHRTNHLS----SRTGFEKDQWKRAIKVPLS  12189

>SADI:scaffold_66 supercont1.66 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.66:1:301975:1 
REF
Length=301975

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 50/115 (43%), Gaps = 17/115 (15%)
 Frame = +3

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPA---AEPSAPKGSFYLSSIEP  81
               G + KRGH RK+W  RF VL  ++L+  YY+   + H  +    +    +G   L+ +  
Sbjct  237753  GVLQKRGHLRKNWLTRFFVLTPTHLR--YYKKPRSPHISSTWNTDKRYLRGELRLADL--  237920

Query  82      HEYVVGVMGAAGKPFGF--------KMIGHAPKKGYVELDVFVETQGDRNKWLEV  128
                   V   GA  +P+ F         ++        ++  +   +  DR+KW+ +
Sbjct  237921  --IHVESSGADHRPYCFVATFVRQANVLWLYHAHSTIDYHIQANSDDDRDKWIRL  238079

>PHKE:scaffold_452 scf_22126_452.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_452.1_contig_1:1:27284:1 
REF
Length=27284

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 42/97 (43%), Gaps = 18/97 (19%)
 Frame = +1

Query  37     WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
              W+ R+ V+    LQI+Y+ S         E  + +G    SS+   +         GKP 
Sbjct  20491  WKKRYCVVYKDELQITYFLSLEDF-----EKRSIRGKIPFSSVHAWD---------GKPN  20628

Query  97     GFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              GF+   + P        V+ ET  D+ KWLEV +  L
Sbjct  20629  GFQF--YTPSNTCFR--VYTETAEDQLKWLEVMQKVL  20727

>PYVX:scaffold_1 pve_scaffold_1 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1:1:185872:1 
REF
Length=185872

 Score = 35.4 bits (80),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 16/71 (23%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR---------AACHPPAAEPSAPKGSFY  75
              GY+ K+G F K+WR R+ VL      +SY+ S+         A       EP APK  F 
Sbjct  80031  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKDDLMKLGEIAIDESTTVEP-APKDGF-  80204

Query  76     LSSIEPHEYVV  86
                   P+ ++V
Sbjct  80205  -----PNRFIV  80222

>PHCA:scaffold_14 PHYCAscaffold_14
Length=1100894

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 32/68 (47%), Gaps = 3/68 (4%)
 Frame = -1

Query  1       MNILRVPEIGATASGDKARPTSC-EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
               M  L+ PE     S     PT   EG++ K+G   K W+ R+ V +G  L  SYY SR  
Sbjct  548075  MIFLKWPERVPVESMPDYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKD  547902

Query  60      CHPPAAEP  67
                 P A  P
Sbjct  547901  RKPNAVIP  547878

>PHRA:scaffold_22
Length=569032

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = -2

Query  61     HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGA  91
              +PPA E   P G  +L +I PH Y +G+MGA
Sbjct  15735  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  15649

>PHIF:NW_003303746.1 Phytophthora infestans T30-4 supercont1.13 
genomic scaffold, whole genome shotgun sequence
Length=3221495

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (45%), Gaps = 18/112 (16%)
 Frame = +3

Query  25       GYVTKR---GHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
                GY+ KR     +  SWR  F VL+G+ L+  +Y S+      A   +  +G  ++ SIE 
Sbjct  3100977  GYLRKRYSSSMYMGSWR--FCVLQGARLR--WYRSKEC----AETDTQLRGEVWVQSIES  3101132

Query  82       HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                 +   G       P  F +   + K     L    ETQ DR++WL+    AL
Sbjct  3101133  WD---GRTALGTYPHAFAVRTTSKKL----LLCTAETQQDRDRWLQHLERAL  3101267

>SADI:scaffold_15 supercont1.15 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.15:1:848687:1 
REF
Length=848687

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 50/127 (39%), Gaps = 33/127 (26%)
 Frame = +2

Query  13     ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPP---------  63
              A  D A+P   EG +TKR  + K WR R+ VL+G+ L    Y  RA    P         
Sbjct  76298  AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  76462

Query  64     --------------AAEPSAPKGSFYL--SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKK  107
                              E + P+ ++Y+   S E  +  +G +G A   F     G     
Sbjct  76463  LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DD  76633

Query  108    GYVELDV  114
              GY E DV
Sbjct  76634  GYDEEDV  76654

>SAPA:scaffold_6 supercont2.6 dna:supercontig supercontig:ASM15154v2:supercont2.6:1:961754:1 
REF
Length=961754

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 54/139 (39%), Gaps = 35/139 (25%)
 Frame = +3

Query  1       MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
                 I+   E+   A  D A+P   EG +TKR  + K WR R+ VL+G+ L    Y  RA  
Sbjct  503352  FEIISSDEMDVVA--DLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQG  503510

Query  61      HPP-----------------------AAEPSAPKGSFYL--SSIEPHEYVVGVMGAAGKP  95
                 P                         E + P+ ++Y+   S E  +  +G +G A   
Sbjct  503511  EAPHGVIDLSECLTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVK  503690

Query  96      FGFKMIGHAPKKGYVELDV  114
               F     G     GY E DV
Sbjct  503691  FSSSFTG---DDGYDEEDV  503738

>PYAP:scaffold_200 pag1_scaffold_200 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_200:1:45598:1 
REF
Length=45598

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 42/108 (39%), Gaps = 19/108 (18%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
              G++ KR    KSW+ RF  LEGS L   YY  R          + PKG   L+  E    
Sbjct  22237  GHLYKRTGLAKSWKTRFFSLEGSVL---YYYKREG-------DTVPKGIVVLTGCE----  22374

Query  85     VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNA  132
                 +     K +    I H PK   V  D+    Q     W+E  + A
Sbjct  22375  ---IKTTRDKKYYSFRISH-PKTSKV-YDLAATLQSRTEDWMEALQEA  22503

>PYAR:scaffold_1067 par_scaffold_1067 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1067:1:10605:1 
REF
Length=10605

 Score = 35.0 bits (79),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 7/56 (13%)
 Frame = -1

Query  25    GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIE  80
             G++ K+G   +SW+ RF+VL G   Q++YY++     P   E    KGSF + + E
Sbjct  1101  GWIYKQGSLVRSWKKRFMVLRGK--QLTYYDTERIT-PRVKE----KGSFQVITAE  955

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 8/73 (11%)
 Frame = -2

Query  20    PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES------RAACHPPAAEPSAPKGS  73
             P  C G++ K G   K+W+ R+  L+G+   I Y++S      RA       E  A K  
Sbjct  4364  PRGCSGWLRKEGKRVKNWKRRYFTLQGTT--IKYFKSASGSLLRALEVTQVEEYPAVKFG  4191

Query  74    FYLSSIEPHEYVV  86
             F + + E    VV
Sbjct  4190  FVIVTTEGRRLVV  4152

>PYIR:scaffold_94 pir_scaffold_94 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_94:1:54970:1 
REF
Length=54970

 Score = 35.0 bits (79),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 31/64 (48%), Gaps = 9/64 (14%)
 Frame = -3

Query  5     RVPEIGATASGDKARPT----SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
             R   +  T  GD +R        EG +TKR  + K WR R+ VL+G+ L    Y  RA  
Sbjct  9539  RAAALQVTMEGDYSRCDLSDPDYEGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQ-  9375

Query  61    HPPA  64
             H PA
Sbjct  9374  HEPA  9363

>PYAP:scaffold_39 pag1_scaffold_39 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_39:1:95480:1 
REF
Length=95480

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 26/100 (26%)
 Frame = +2

Query  35     KSWRVRFLVLEGSNLQISYYESRAACHPPAAEPS-APKGSFYLSSIEPHEYVVGVMGAAG  93
              + W+  F VL G + + S            +EP  A KG   + S+E  +         G
Sbjct  40826  RKWKRYFAVLSGVDFRYS------------SEPGRASKGFGMVKSVERWD---------G  40942

Query  94     KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              KP+G K +  +      E+  +  T+ DRN+W+++   A+
Sbjct  40943  KPYGIKFVYTSG----AEVPAYCATEQDRNEWIDIVTRAI  41050

>PYAP:scaffold_747 pag1_scaffold_747 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_747:1:14717:1 
REF
Length=14717

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 47/112 (42%), Gaps = 14/112 (13%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
              G++ K GH RK+W++R+ VL+ S L+  YY             +  KG   L       +
Sbjct  13541  GWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGM--------TRLKGEVLLFHPATQVH  13392

Query  85     VVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136
               V +  + GK   F  I   P+     L +  E   DR  W+    +AL  +
Sbjct  13391  YVDIHESRGKDHTFA-IQVGPE---YTLLLQAERLADRENWMYCIEDALLCR  13248

>SAPA:scaffold_181 supercont2.181 dna:supercontig supercontig:ASM15154v2:supercont2.181:1:64981:1 
REF
Length=64981

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 3/54 (6%)
 Frame = -3

Query  3     ILRVPEIGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
             +L   E  A+  G K +      G + KRGH RK+W  RF VL  ++L+  YY+
Sbjct  5843  VLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  5688

>HYAP:scaffold_242 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_242:1:69772:1 
REF
Length=69772

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +3

Query  152    KKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDE  183
              K++L   G++LSP PL TPQK MQ +    DE
Sbjct  55995  KQSLNENGMALSPHPLATPQKLMQQVVSKSDE  56090

>PYAP:scaffold_926 pag1_scaffold_926 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_926:1:10218:1 
REF
Length=10218

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 2/34 (6%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
             EGY+ K+      WR  + VLEG  L  +YYESR
Sbjct  6806  EGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESR  6711

>PYIW:scaffold_525 piw_scaffold_525 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_525:1:17108:1 
REF
Length=17108

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = -1

Query  18    ARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56
             A P    G++ K+G   KSW+ R+ VLEG +LQ  Y+++
Sbjct  5120  AEPEIKYGWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDN  5010

>PLHA:NW_020187350.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_430, whole genome shotgun sequence
Length=1405462

 Score = 35.0 bits (79),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
               EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  769638  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRRPNAVIP  769763

>PHRA:scaffold_96
Length=174541

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = -2

Query  61     HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGA  91
              +PPA E   P G  +L +I PH Y +G+MGA
Sbjct  29673  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  29587

>PHIF:NW_003303749.1 Phytophthora infestans T30-4 supercont1.10 
genomic scaffold, whole genome shotgun sequence
Length=3761764

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = -3

Query  61       HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGA  91
                +PPA E   P G  +L +I PH Y VG+MGA
Sbjct  2457644  NPPATE--IPSGYKWLYAITPHTYSVGIMGA  2457558

>ALCA:scaffold_49 AcNc2_CONTIG_49_length_115235 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_49_length_115235:1:115235:1 
REF
Length=115235

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 0/50 (0%)
 Frame = +2

Query  3      ILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
              I+ +       S D+ +  + EG +TKR  + K WR R+ +L+G+ L  S
Sbjct  38837  IMSIKNDEENLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  38986

>PHPA:scaffold_6 NW_008648992.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.6, whole genome shotgun 
sequence
Length=2202294

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = -2

Query  61       HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGA  91
                +PPA E   P G  +L +I PH Y VG+MGA
Sbjct  1884770  NPPATE--IPSGYKWLYAITPHTYSVGIMGA  1884684

>HYAP:scaffold_167 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_167:1:135444:1 
REF
Length=135444

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 40/97 (41%), Gaps = 18/97 (19%)
 Frame = +3

Query  37     WRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPF  96
              W+ R+ V+  + LQI Y+ S         E    +G    SS+   +         GKP 
Sbjct  16467  WKKRYCVIYANELQIVYFLSLEDF-----ERRTIRGKIPFSSVHAWD---------GKPN  16604

Query  97     GFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
              GF+    A         V+ ET  D+ KWLEV +  +
Sbjct  16605  GFQFYTPADHC----FRVYTETAADQLKWLEVMQKCI  16703

>ALLA:FR824348 dna:supercontig supercontig:ENA1:FR824348:1:31264:1 
REF
Length=31264

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              GY+ K+G F KSWR R+ +L      ++YY S+
Sbjct  12488  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  12390

>APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.18:1:978767:1 
REF
Length=978767

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 28/42 (67%), Gaps = 6/42 (14%)
 Frame = +2

Query  18     ARPTSC----EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
              +R TSC    EG++ K+G   KSW+ R+ V+ G++L  +YY+
Sbjct  97277  SRRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYK  97396

>PHIF:NW_003303653.1 Phytophthora infestans T30-4 supercont1.106 
genomic scaffold, whole genome shotgun sequence
Length=277544

 Score = 34.7 bits (78),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 14/84 (17%)
 Frame = +3

Query  19      RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78
               R  S EGY++K+     SW+  + VLE   L  ++YE+R          S   G   L S
Sbjct  182238  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDF----ISNSKLIGRIQLQS  182399

Query  79      IEPHEYVVGVMGAAGKPFGFKMIG  102
               IE  +         GKP GF++I 
Sbjct  182400  IEDED--------MGKPNGFRVIA  182447

>PYAR:scaffold_5711 par_scaffold_5711 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_5711:1:1474:1 
REF
Length=1474

 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 2/34 (6%)
 Frame = +3

Query  24   EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
            EGY+ K+      WR  + VLEG  L  +YYESR
Sbjct  219  EGYLHKKSEVLSHWRATYCVLEGDTL--AYYESR  314

>HYAP:scaffold_322 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_322:1:27901:1 
REF
Length=27901

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 2/31 (6%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
              G++ KRGH  K+W+ RF +L G+ L  +YY+
Sbjct  26994  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  27080

>ALCA:scaffold_29 AcNc2_CONTIG_29_length_140563 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_29_length_140563:1:140563:1 
REF
Length=140563

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              +G++ KRGH +K+W+ RF  +E   LQ  + E+R
Sbjct  17295  DGFLWKRGHLKKNWKKRFFRVENGQLQY-FTENR  17197

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = -2

Query  24       EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
                EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  1388122  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIP  1387997

>SAPA:scaffold_5 supercont2.5 dna:supercontig supercontig:ASM15154v2:supercont2.5:1:1129684:1 
REF
Length=1129684

 Score = 34.7 bits (78),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              EGY+ K+G   K W+ R+ V +G +L  SYY S     P A  P
Sbjct  88957  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISSKDKKPNAVIP  89082

>PHRA:scaffold_35
Length=466101

 Score = 34.7 bits (78),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 42/112 (38%), Gaps = 35/112 (31%)
 Frame = -1

Query  23     CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPH  82
              CEG++ KRG     W+ R+  L+G  LQ          +      S PKG          
Sbjct  23859  CEGWLYKRGQRSTEWQRRYFKLKGFKLQ----------YQDGPGESVPKG----------  23740

Query  83     EYVVGVMGAAGKPFGFKMIGHAPKKGYVELD------VFVETQGDRNKWLEV  128
                       AG   G K+        YV+LD      V  ++QG  +KW++ 
Sbjct  23739  ---------AGTVVGLKLGETGSNCVYVQLDSGRVLCVSADSQGQVDKWVQA  23611

>PYAR:scaffold_267 par_scaffold_267 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_267:1:23113:1 
REF
Length=23113

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 23/39 (59%), Gaps = 4/39 (10%)
 Frame = +3

Query  24    EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHP  62
             EG +TKR  + K WR RF VL+G+ L    Y  RAA  P
Sbjct  2250  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEP  2354

>SADI:scaffold_25 supercont1.25 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.25:1:683613:1 
REF
Length=683613

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              EGY+ K+G   K W+ R+ V +G +L  SYY S     P A  P
Sbjct  48892  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISSKDKKPNAVIP  49017

>PHRA:scaffold_82
Length=214170

 Score = 34.7 bits (78),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = +2

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR-AACHPPAAEPSAPKGSFYLSSI  79
              EGY+ KRGH   S R R+ VL G+ L  SY+ +   + +P     +AP G F ++ +
Sbjct  78806  EGYLMKRGHKIPSMRKRYCVLLGNEL--SYFVTHDDSKNPGGGATTAPLGKFRVAVV  78970

>PYVX:scaffold_912 pve_scaffold_912 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_912:1:10260:1 
REF
Length=10260

 Score = 34.3 bits (77),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = -2

Query  19    RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
             R  S EGY+ K+     +W+V + VLE   L  +Y+ESR
Sbjct  8972  RSISFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESR  8862

>APAS:scaffold_47 supercont1.47 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.47:1:501135:1 
REF
Length=501135

 Score = 34.3 bits (77),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 49/123 (40%), Gaps = 27/123 (22%)
 Frame = -2

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSA----PKGSFYLSSIE  80
               G + KRGH RK+W +RF VL    L+  YY       PP +  +     P+   YL    
Sbjct  421157  GILLKRGHVRKNWLMRFFVLTSGALR--YYRK-----PPGSRSTTWSVDPR---YLRGEL  421008

Query  81      PHEYVVGVMGAAGKP----------FGFKMIGHAP---KKGYVELDVFVETQGDRNKWLE  127
               P   ++ V      P          F   ++ H      +  V   V   T+ +R+KWL 
Sbjct  421007  PLADIIHVESDDSSPQRGQQPRTYRFTITVLRHRILFLLRRPVRFHVQAATEDERDKWLR  420828

Query  128     VAR  130
               + +
Sbjct  420827  ILK  420819

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 34.3 bits (77),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
               EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  382707  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIP  382832

>PHKE:scaffold_26 scf_22126_26.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_26.1:1:190058:1 
REF
Length=190058

 Score = 34.3 bits (77),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
               EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  157298  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIP  157173

>PYVX:scaffold_35 pve_scaffold_35 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_35:1:77315:1 
REF
Length=77315

 Score = 34.3 bits (77),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 4/41 (10%)
 Frame = +3

Query  20     PTS---CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              PTS    EG + KRGHF K+W+ RF  +E   L + Y E++
Sbjct  56106  PTSYIHMEGCLMKRGHFNKNWKNRFFRIEKGEL-LYYTENQ  56225

>PHCA:scaffold_82 PHYCAscaffold_82
Length=207552

 Score = 34.3 bits (77),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 4/32 (13%)
 Frame = +2

Query  61      HPPAAE-PSAPKGSFYLSSIEPHEYVVGVMGA  91
               +PPA E PS  K  +YL+   PH Y VG+MGA
Sbjct  158339  NPPATEVPSGYKWVYYLT---PHTYTVGIMGA  158425

>PYIR:scaffold_753 pir_scaffold_753 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_753:1:16413:1 
REF
Length=16413

 Score = 33.9 bits (76),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  189    LRDIEAAKLVGREACNEIVIQGEKLDA  215
              +R++EAA+ +GRE C E+V++ +KLDA
Sbjct  11530  VRELEAARELGREVCRELVLRVDKLDA  11610

>PLHA:NW_020187532.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_614, whole genome shotgun sequence
Length=3420761

 Score = 33.9 bits (76),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 2/31 (6%)
 Frame = +3

Query  25       GYVTKRGHFRKSWRVRFLVLEGSNLQISYYE  55
                G++ KRGH  K+W+ RF +L G  + ++YY+
Sbjct  2611854  GWLWKRGHSFKTWKKRFFLLNG--VALTYYK  2611940

>PHSO:scaffold_13
Length=2041583

 Score = 33.9 bits (76),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 22/38 (58%), Gaps = 1/38 (3%)
 Frame = -3

Query  15      GDKARPTSCEGYVTKRGHFRKS-WRVRFLVLEGSNLQI  51
               G  A  T  EG++  R H   S WR RF+VLEGS L I
Sbjct  356910  GADASSTKVEGHLRVRHHNLGSIWRNRFVVLEGSKLSI  356797

>PYVX:scaffold_158 pve_scaffold_158 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_158:1:42935:1 
REF
Length=42935

 Score = 33.9 bits (76),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  15513  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISRKDRKPNAVIP  15388

>APIN:scaffold_59 supercont1.59 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.59:1:326880:1 
REF
Length=326880

 Score = 33.9 bits (76),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 24/106 (23%)
 Frame = -1

Query  22      SCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEP  81
               S EG++ KRG   K+W+ R+  L G  L+  Y E       P A+   PKG         
Sbjct  308076  SFEGWLLKRGQRVKNWKRRYFTLNGQELK--YMEG------PGAK---PKG---------  307957

Query  82      HEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLE  127
               +  VVGV      P+    I   P +    LDV  E+  ++  W++
Sbjct  307956  YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQ  307831

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 2/52 (4%)
 Frame = -1

Query  8       EIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59
               + G  +S D A  T+CEG++ K+G   K+W+ R+  L G  L     +S  A
Sbjct  307596  DYGIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  307447

>PLHA:NW_020187331.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_410, whole genome shotgun sequence
Length=672108

 Score = 33.9 bits (76),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 4/44 (9%)
 Frame = -2

Query  20      PTS---CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60
               PTS    EG + KRGH  K+W+ RF  ++   L+  Y E++  C
Sbjct  208679  PTSYIHMEGRLLKRGHLNKNWKTRFFRIQQGELRY-YTENQNKC  208551

>ALCA:scaffold_110 AcNc2_CONTIG_110_length_72385 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_110_length_72385:1:72385:1 
REF
Length=72385

 Score = 33.9 bits (76),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESR  57
              EGY+ KRGH   S R R+ VL+  +  + Y+E++
Sbjct  67683  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETK  67784

>SAPA:scaffold_16 supercont2.16 dna:supercontig supercontig:ASM15154v2:supercont2.16:1:619246:1 
REF
Length=619246

 Score = 33.9 bits (76),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)
 Frame = -1

Query  20      PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79
               P    GYV K+G F K+W+ R + L    L   YY S  A        + P+G F ++S+
Sbjct  210190  PPDFSGYVRKQGSFVKNWKRRIMALHDDTL--FYYVSERAM-------AKPRGVFRVTSV  210038

>SAPA:scaffold_1 supercont2.1 dna:supercontig supercontig:ASM15154v2:supercont2.1:1:1615555:1 
REF
Length=1615555

 Score = 33.9 bits (76),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 48/111 (43%), Gaps = 27/111 (24%)
 Frame = -3

Query  25      GYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEY  84
               G+V KRG   ++W+ R+ VL  + L  +YY+      P        KG  ++ SIE    
Sbjct  923180  GWVEKRGAVMRTWKRRYFVLRENVL--AYYDINLEGQP-------KKGGDFVQSIET---  923037

Query  85      VVGVMGAAGKPFG--FKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL  133
                     +  KP G  FKM+      G      F ET  D  +WL +A N L
Sbjct  923036  ------STIKPNGLEFKMVSGRSLLG------FTETTDDHVQWL-LAANTL  922923

>PHRA:scaffold_67
Length=286994

 Score = 33.5 bits (75),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEP  67
              EG++ K+G   K W+ R+ V +G  L  SYY SR    P A  P
Sbjct  56953  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIP  57078

>APAS:scaffold_25 supercont1.25 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.25:1:849228:1 
REF
Length=849228

 Score = 33.5 bits (75),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 1/33 (3%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLEGS-NLQISYYES  56
              G++ K GH RK+W+ RF VL+GS  + I  +ES
Sbjct  22276  GWLYKLGHVRKNWKRRFFVLDGSVRMCIYLFES  22178

>APIN:scaffold_10 supercont1.10 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.10:1:1522286:1 
REF
Length=1522286

 Score = 33.5 bits (75),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 49/122 (40%), Gaps = 8/122 (7%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHE  83
               EGY+ KR  + K W   + VL G  L     E  A  HP +++     G F +S     +
Sbjct  173493  EGYLMKRSDWLKHWDTYYFVLHGRVLYCYLSEEEAKVHPESSK--IKHGKFSISDSLILD  173320

Query  84      YVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQA  143
                V  V       F F+      K+ Y+      +T+  +  W+ +A + +        QA
Sbjct  173319  EVFSVRSRHHYEFIFE--NDQGKQIYLR----AKTEASKQMWMHMASHGIVDNYTDHDQA  173158

Query  144     ID  145
               ++
Sbjct  173157  LN  173152

>HYAP:scaffold_152 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_152:1:158153:1 
REF
Length=158153

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 5/38 (13%)
 Frame = -3

Query  20     PTS---CEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54
              PTS    EG + KRGH  K+WR RF  +E   L+  YY
Sbjct  73584  PTSHIHMEGLLLKRGHVNKNWRNRFFRIEKGELR--YY  73477

>ALLA:FR824197 dna:supercontig supercontig:ENA1:FR824197:1:60032:1 
REF
Length=60032

 Score = 33.5 bits (75),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLEGSNLQ  50
              T  +G++ KRGH +K+W+ R+  +E   LQ
Sbjct  23664  TRRDGFLWKRGHLKKNWKKRYFRIEDGQLQ  23753

>ALLA:FR824109 dna:supercontig supercontig:ENA1:FR824109:1:99844:1 
REF
Length=99844

 Score = 33.5 bits (75),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLEGSNLQIS  52
              EG +TKR  + K WR R+ +L+G+ L  S
Sbjct  26098  EGELTKRSMWMKEWRKRYFILKGNKLYFS  26184

Lambda      K        H        a         alpha
   0.315    0.131    0.371    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 94208171748

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40