Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
HYAP:scaffold_5919132919345270833360.0
PHCA:scaffold_8410509610727973023500.0
PHPA:scaffold_6325606125805566923190.0
PHSO:scaffold_12804955280699468222490.0
PHIF:NW_003303697.143609443808866922440.0
PHRA:scaffold_5614406514602665822020.0
PHKE:scaffold_98724567444166620980.0
PLHA:NW_020189861.11838393184038166620870.0
PYUU:scaffold_20371312606131454369114623e-177
PYIR:scaffold_8948769686167014392e-174
PYAP:scaffold_162248362642853413483e-162
PYIW:scaffold_9635227658545813122e-157
PYAR:scaffold_2996711126653612417e-148
PYVX:scaffold_13231436271642911556e-139
ALCA:scaffold_6224203257775318724e-99
ALLA:FR82421522204237635348345e-94
SAPA:scaffold_244298614315075796701e-72
SADI:scaffold_41714661731425836542e-70
PYVX:scaffold_6749090104244661711e-10
PYIR:scaffold_3274484754523371442e-07
PHKE:scaffold_386800888593041333e-06
PHIF:NW_003303706.11527231536403171262e-05
PYIW:scaffold_20520723216823431263e-05
SAPA:scaffold_924880349261173730.003
PYIR:scaffold_1348176843689797.1
APIN:scaffold_17144461470687797.3
PYIR:scaffold_10996368658978798.0
TBLASTN 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= HYAP_07104

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  1289    0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     909     0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  897     0.0   
PHSO:scaffold_1                                                       870     0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  868     0.0   
PHRA:scaffold_56                                                      852     0.0   
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  812     0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  808     0.0   
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  567     3e-177
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  558     2e-174
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  523     3e-162
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  509     2e-157
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  482     7e-148
PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:...  449     6e-139
ALCA:scaffold_62 AcNc2_CONTIG_62_length_96346 dna:supercontig sup...  340     4e-99 
ALLA:FR824215 dna:supercontig supercontig:ENA1:FR824215:1:55297:1...  325     5e-94 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  262     1e-72 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  256     2e-70 
PYVX:scaffold_674 pve_scaffold_674 dna:supercontig supercontig:pv...  70.5    1e-10 
PYIR:scaffold_32 pir_scaffold_32 dna:supercontig supercontig:pir_...  60.1    2e-07 
PHKE:scaffold_386 scf_22126_386.1 dna:supercontig supercontig:Phy...  55.8    3e-06 
PHIF:NW_003303706.1 Phytophthora infestans T30-4 supercont1.53 ge...  53.1    2e-05 
PYIW:scaffold_205 piw_scaffold_205 dna:supercontig supercontig:pi...  53.1    3e-05 
SAPA:scaffold_92 supercont2.92 dna:supercontig supercontig:ASM151...  32.7    0.003 
PYIR:scaffold_134 pir_scaffold_134 dna:supercontig supercontig:pi...  35.0    7.1   
APIN:scaffold_17 supercont1.17 dna:supercontig supercontig:Apha_i...  35.0    7.3   
PYIR:scaffold_1099 pir_scaffold_1099 dna:supercontig supercontig:...  35.0    8.0   

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 1289 bits (3336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/708 (100%), Positives = 708/708 (100%), Gaps = 0/708 (0%)
 Frame = -1

Query  14      DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73
               DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS
Sbjct  193452  DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  193273

Query  74      TEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSVNltsthhhlttstsmm  133
               TEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISSVNLTSTHHHLTTSTSMM
Sbjct  193272  TEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISSVNLTSTHHHLTTSTSMM  193093

Query  134     shPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT  193
               SHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT
Sbjct  193092  SHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT  192913

Query  194     GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA  253
               GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA
Sbjct  192912  GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA  192733

Query  254     ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  313
               ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE
Sbjct  192732  ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  192553

Query  314     EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL  373
               EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL
Sbjct  192552  EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL  192373

Query  374     LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG  433
               LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG
Sbjct  192372  LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG  192193

Query  434     IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF  493
               IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF
Sbjct  192192  IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF  192013

Query  494     VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID  553
               VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID
Sbjct  192012  VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAID  191833

Query  554     VLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFr  613
               VLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFR
Sbjct  191832  VLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFR  191653

Query  614     lttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMR  673
               LTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMR
Sbjct  191652  LTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMR  191473

Query  674     RasasassgqltssgssngsapgrsQSPQKVQTESDCQPVSILKRGRM  721
               RASASASSGQLTSSGSSNGSAPGRSQSPQKVQTESDCQPVSILKRGRM
Sbjct  191472  RASASASSGQLTSSGSSNGSAPGRSQSPQKVQTESDCQPVSILKRGRM  191329

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/730 (67%), Positives = 571/730 (78%), Gaps = 24/730 (3%)
 Frame = -3

Query  14      DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGP--PQY  71
               +G W LDEDS+RLKQ QD  VR DRS TL DTVN TDDVEEMFY     RST     PQY
Sbjct  107279  EGAWALDEDSLRLKQQQDDAVRFDRSTTLADTVNVTDDVEEMFYGRNTNRSTTASEMPQY  107100

Query  72      RSTEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV---Nltsthhhltt  128
               R+TEQ+ G  LTL++L+E+A TPS  + +SS     +   ++ ++    N+ +  +H  +
Sbjct  107099  RTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNYAASTPGNVGNNTYHGFS  106920

Query  129     stsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGA  188
               S    +    V     ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKEL LLKGA
Sbjct  106919  SALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGA  106740

Query  189     IAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYK  248
               IAQLT      ++    S + S S+PLS+ +R ALTRQTST TS+ATRDRLAASR+N +K
Sbjct  106739  IAQLTAA--QHSSPSVSSTESSSSDPLSAEERAALTRQTSTKTSAATRDRLAASRLNVHK  106566

Query  249     PPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWA  308
                PPPAARASVRLTQLAPVAD+ALSTPLSS Q+N++FPLIDFT++LAAHAR LTPGSRTWA
Sbjct  106565  TPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWA  106386

Query  309     LTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSS  368
               LTR EEWL++RF  G D LLAVVGEGG+GKSAF GTVAQQ+RG L+AAHCCQFDRK KSS
Sbjct  106385  LTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSS  106206

Query  369     PRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAF  428
               PRNVLLS+VHQLV NLPLFKNQLARLNLKYVLEEADP+LLA KVLVDPLNA+E+PV   F
Sbjct  106205  PRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATF  106026

Query  429     MLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSA  488
               MLVDGIDQC+ GP GRNELL+F AQ+IPQLPSW+G ++SSKPSSKLAKRLPVSSVLDFSA
Sbjct  106025  MLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSA  105846

Query  489     KNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSK  546
               KN AFVADVSSLVD+IA +F  +D  EAK+VLKHKSGGNFAYLEFTKQALS  GM + SK
Sbjct  105845  KNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSK  105666

Query  547     EGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEE  606
               EG V + VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA +GPYSPVTEE
Sbjct  105665  EGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEE  105486

Query  607     QAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDAL  666
               QA+EHF+LT EDLR+LRRSFVDLVAVKHG YRIE+SALCAWL DPAR+EEQFYF+IDDAL
Sbjct  105485  QAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDAL  105306

Query  667     QALRKMRRasasassgqltssgssngsapgrsQSPQKVQTESDCQ---------------  711
                ALRKMRR  +S+      SS  S+ +    S++  +V   S  Q               
Sbjct  105305  HALRKMRRNVSSSGHSHSGSSSDSSATHHTSSRASSRVTASSKSQQRSHTRHEPRTNPGK  105126

Query  712     PVSILKRGRM  721
               PV ILKRG++
Sbjct  105125  PVGILKRGKL  105096

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/669 (71%), Positives = 548/669 (82%), Gaps = 12/669 (2%)
 Frame = -1

Query  14      DGTWDLDEDSMRLKQNQDH-VVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYR  72
               +G W LDEDS+RLKQ QD   VR DRS TL DTVN TDDVEEMFY  + + +++  PQYR
Sbjct  258055  EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYR  257876

Query  73      STEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV---Nltsthhhltts  129
               +TEQ+    +TL++L+ED E  +  + +SS     +   ++ ++    N +ST+H   T 
Sbjct  257875  TTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPSNYAASTPGNFSSTYHGFNTV  257696

Query  130     tsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAI  189
                S     RAV G   ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAI
Sbjct  257695  HSTTGTSRAVSG-DFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAI  257519

Query  190     AQLTGT--FPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTY  247
               AQLT T    PP+ S   S + S S+PLS+ +R ALTRQTST TS ATRDRLAASR N +
Sbjct  257518  AQLTATQHSAPPSVS---STESSSSDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIH  257348

Query  248     KPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTW  307
               K PPPAARASVRLTQLAPVAD+ALSTPLS  Q+N++FPLIDFT+ELAAHAR LTPG+RTW
Sbjct  257347  KTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTW  257168

Query  308     ALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKS  367
               ALTR EEWL++RF  G D LLAVVGEGG+GKSAFCGTVAQQ+RG L+AAHCCQFDRK KS
Sbjct  257167  ALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKS  256988

Query  368     SPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA  427
               SPRNVLLS+VHQLV NLP FKNQLARLNLKYVLEEADP LLA KVLVDPLNA+E+P+   
Sbjct  256987  SPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHAT  256808

Query  428     FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
               FMLVDGIDQC  G  GRNELLEF AQ+IPQLPSW+G ++SSKPSSKLAKRLPVSSVLDFS
Sbjct  256807  FMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFS  256628

Query  488     AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVS  545
               AKN AFVADVSS+VD+IA +F  +D  EAK+VLK KSGGNFAYLEFTKQALS  GMA+ S
Sbjct  256627  AKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAAS  256448

Query  546     KEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTE  605
               KEG V ++VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYSP+TE
Sbjct  256447  KEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTE  256268

Query  606     EQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDA  665
               EQA+EHF+ T EDLR+LRRSFVDLVAVKHG YRIE+SALCAWL DPAR+EEQFYF+IDDA
Sbjct  256267  EQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDA  256088

Query  666     LQALRKMRR  674
               LQALRKMRR
Sbjct  256087  LQALRKMRR  256061

>PHSO:scaffold_1
Length=13391543

 Score = 870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/682 (69%), Positives = 544/682 (80%), Gaps = 23/682 (3%)
 Frame = -1

Query  14       DGTWDLDEDSMRLKQNQDHV-VRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGP----  68
                D  W LDEDS+RLKQ QD   VR DRSGTL+DTVN TDDVE+MFY     RST       
Sbjct  2806994  DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNN-RSTASAASDV  2806818

Query  69       PQYRSTEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSVNl---------  119
                PQYR+TEQL    LTL++L+EDAETPS  +N SSSFSQFS    S  + +          
Sbjct  2806817  PQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPGNFSNHNG  2806638

Query  120      --tsthhhlttstsmmshPRAVGGA---SSELEQLRFELIEVKQEVAAIRQHVVNELHVT  174
                   +T+   T +    + P  VG A     ELE+LR E++EVK+EV AIR+ V+NELHVT
Sbjct  2806637  QNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAEVLEVKEEVKAIRREVMNELHVT  2806458

Query  175      RYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSA  234
                RYDVLKELALLKGA+AQLT        SV  +   S+ +PLS+ DR  L RQTST TS A
Sbjct  2806457  RYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSL-DPLSADDRAKLVRQTSTKTSPA  2806281

Query  235      TRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELA  294
                TR+RLAASR N  K PPP ARASVRLTQLAPVAD ALSTPL+S Q+N++FPLIDFT+ELA
Sbjct  2806280  TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  2806101

Query  295      AHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLV  354
                AHAR LTPGSRTWALTR EEWL+SRF  G D LLAVVGEGG+GKSAFCGTVAQQ+RG ++
Sbjct  2806100  AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  2805921

Query  355      AAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLV  414
                AAHCCQFDRK KS+PRNVLLS+VHQ+V N P FKNQLARLNLKYVLEEADP+LLA+KVLV
Sbjct  2805920  AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  2805741

Query  415      DPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKL  474
                DPLNALE+PV  AFM+VDGIDQC  G  GRNELLEF AQ+IPQLP+W+G ++SSKPSSKL
Sbjct  2805740  DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKL  2805561

Query  475      AKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFT  534
                AKRLPVSSVLDFSA+N+AFVADV+ LV++IA +F  +D  +AK +LK KSGGNFAYLEFT
Sbjct  2805560  AKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  2805381

Query  535      KQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLA  592
                KQALS  GMA+ SKEG V + VL +LPETLYDIYAEIFEDKFG GRARVW KA+ +LQL 
Sbjct  2805380  KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  2805201

Query  593      IGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPA  652
                +GA +GPYSPVTEEQA+EHF LT EDLR+LRRSFVDLVAV+HG YRIE+SALCAWL DPA
Sbjct  2805200  VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  2805021

Query  653      RAEEQFYFNIDDALQALRKMRR  674
                R+EEQFYF+IDDALQALR+MRR
Sbjct  2805020  RSEEQFYFSIDDALQALRQMRR  2804955

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/669 (70%), Positives = 538/669 (80%), Gaps = 12/669 (2%)
 Frame = -3

Query  14      DGTWDLDEDSMRLKQNQDH-VVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYR  72
               +G W LDEDS+RLKQ QD   VR DRS TL DTVN TDDVEEMFY  + + +++  PQYR
Sbjct  438088  EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYR  437909

Query  73      STEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV---Nltsthhhltts  129
               +TEQL G  +TL++L+ED E  +  + +SS     +   ++ ++      TSTH  L T+
Sbjct  437908  TTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAASTPGKFTSTHQGLNTA  437729

Query  130     tsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAI  189
                +     RAV G   ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAI
Sbjct  437728  QTTTGMSRAVSG-DFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAI  437552

Query  190     AQLTGT--FPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTY  247
               AQLT T    P + S   S         S  +R ALTRQTST TS ATRDRLAASR N +
Sbjct  437551  AQLTATQHIAPASVSSTESSSSDPL---SPDERAALTRQTSTKTSQATRDRLAASRTNIH  437381

Query  248     KPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTW  307
               K PPPAARASVRLTQLAPVAD+ALSTPL+  Q+N++FPLID T+ELAAHAR LTPG+RTW
Sbjct  437380  KTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTW  437201

Query  308     ALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKS  367
               ALTR EEWL++R+  G D LLAVVGEGG+GKS FCGTVAQQ+RG L+AAHCCQFDRK KS
Sbjct  437200  ALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKS  437021

Query  368     SPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA  427
               SPRNVLLS+VHQLV +LP FKNQLARLNLKYVLEEADP LLA KVLVDPLNA+E+P+   
Sbjct  437020  SPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHAT  436841

Query  428     FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
               F+LVDGIDQC VG  GRNELLE  AQ+IPQLPSW+G +VSSKPSSKLAKRLPVSSVLDFS
Sbjct  436840  FILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFS  436661

Query  488     AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVS  545
               AKN AFVAD SSLVD+IA +F  +D  EAK+VLK KSGGNFAYLEFTKQALS  G+A+ S
Sbjct  436660  AKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAAS  436481

Query  546     KEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTE  605
               KEG V ++VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYSPVTE
Sbjct  436480  KEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTE  436301

Query  606     EQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDA  665
               EQA+EHF LTTEDLR+LRRSFVDLV+VKHG YRIE+SALCAWL DPAR+EEQFYF++DDA
Sbjct  436300  EQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDA  436121

Query  666     LQALRKMRR  674
               L ALRK+RR
Sbjct  436120  LLALRKIRR  436094

>PHRA:scaffold_56
Length=334739

 Score = 852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/658 (71%), Positives = 530/658 (81%), Gaps = 6/658 (1%)
 Frame = +2

Query  14      DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73
               D  W LDEDS+RLKQ QD  +RLDRS TLTDTVN TDDVEEMFY    T S    PQYR+
Sbjct  144065  DANWALDEDSLRLKQTQDDALRLDRSTTLTDTVNVTDDVEEMFYGGRSTVS--DVPQYRT  144238

Query  74      TEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSVNltsthhhlttstsmm  133
               TEQL G  +TL++L+EDAE  S  S++ S FS  +    + S+             ++  
Sbjct  144239  TEQLRGTHMTLSALHEDAEA-SNASSSFSQFSATTPSNYAASTPGHVPNQGAYHDFSTAH  144415

Query  134     shPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT  193
               S  RA+  A  ELE+LR E++EVK+EV AIR+ V+NELHVTRYDVLKELALLKGAIAQL 
Sbjct  144416  STTRAISDAF-ELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLA  144592

Query  194     GTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPA  253
                T      +   S + S S+PLS+ +R ALTRQTST TSSATR+RLAASR N +K PPPA
Sbjct  144593  ATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTSSATRERLAASRANIHKTPPPA  144772

Query  254     ARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAE  313
               ARASVRLTQLAPVAD+ALSTPL+  Q+ND+FPLIDFT+ELAAHAR LTPGSRTWALTR E
Sbjct  144773  ARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVE  144952

Query  314     EWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVL  373
               EWL++RF  G D LLAVVGEGG+GKSAF GTVAQQ+RG L+AAHCCQFDRK KSSPRNVL
Sbjct  144953  EWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVL  145132

Query  374     LSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDG  433
               LS+VHQLV +LP FKNQLARLNLKYVLEEADP +LA KVLVDPLNA+E+P+   FMLVDG
Sbjct  145133  LSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDG  145312

Query  434     IDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAF  493
               IDQC+ GP GRNELLEF AQ+IP LPSW+G +VSSKPSSKLAKRLPVSSVLDFSAKN AF
Sbjct  145313  IDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAF  145492

Query  494     VADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSKEGVVA  551
               V+DVSSLV+++A +F   D  EAK+VLK KSGGNFAYLEFTKQALS  GMA+ SKEG V 
Sbjct  145493  VSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVP  145672

Query  552     IDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEH  611
               + VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL +GA AGPYS VTEEQA++H
Sbjct  145673  LSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKH  145852

Query  612     FrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQAL  669
               F LT EDLR+LR SFVDLVAV+HG YRIE+SALC WL DPAR+EEQFYF IDDA+QAL
Sbjct  145853  FNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  146026

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/666 (64%), Positives = 518/666 (78%), Gaps = 11/666 (2%)
 Frame = -3

Query  14     DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRS----TNGPP  69
              +G W LDEDS+RL + Q    R DR+  +TDTVN +DDVE+MFY  + T+S    T+  P
Sbjct  74441  EGAWALDEDSLRLNKQQQDADRFDRNTAMTDTVNVSDDVEDMFYGRSTTQSQLSNTSDVP  74262

Query  70     QYRSTEQLPGRLLTLTSLNED-AETPsggsnasssfsqfsdhatsISSVNltsthhhltt  128
               YR+TEQ+ G   TLT+L+E+ A TPS    ++S  S ++    +  +    +  +   +
Sbjct  74261  SYRTTEQMRGTNSTLTALHEEEAMTPSASHLSNSFASSYASTPGNYQNPPTFNGFNTTHS  74082

Query  129    stsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGA  188
              +    +        ++E+ +LR EL EVK EV  IR+ V+NELH+TRYDVLKEL LLKGA
Sbjct  74081  TGLSRTISEDTYN-NNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGA  73905

Query  189    IAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYK  248
              +AQL+      TT        S S+PLS+ DR ALTR  S +TS  T+DRLA SRVN + 
Sbjct  73904  VAQLSAA---QTTGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHT  73734

Query  249    PPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWA  308
               PPPAARASVRLTQLAPVAD+ALSTPL+  Q+N++FPLIDFT+ELAAHAR L PG+RTWA
Sbjct  73733  VPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWA  73554

Query  309    LTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSS  368
              LTR EEWL++RF  G D +LAVVG+GG+GKSAFCGTVAQQ+RG L+AAHCCQFDRK KS+
Sbjct  73553  LTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKST  73374

Query  369    PRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAF  428
              PRNVLLS VHQLV NLP FKNQLARLNLKYVLEE+DP LLA+KV VDPLNA+E+P+   F
Sbjct  73373  PRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATF  73194

Query  429    MLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSA  488
              MLV+G+DQC+ GP GRNELLEFL+Q+IPQLPSW+G ++SSKP SK AKRLPVSSVLDFSA
Sbjct  73193  MLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSA  73014

Query  489    KNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSK  546
              KN AFV+DVSSLVD+IA +F  ED  EAK VLK KSGGNFAYLEFTKQALS  GMA  SK
Sbjct  73013  KNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASK  72834

Query  547    EGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEE  606
              EG V ++VL +LP++L+DIY EIFEDKFG GRAR+W+KA+ +LQL +GA AGPYSPVTE 
Sbjct  72833  EGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEG  72654

Query  607    QAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDAL  666
              QA+EHF  TTEDLR+LRRSFVDLV VKHG YR+E+SALC+WL DPAR+EEQFY ++DDAL
Sbjct  72653  QAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDAL  72474

Query  667    QALRKM  672
               ALRK+
Sbjct  72473  TALRKL  72456

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/666 (67%), Positives = 523/666 (79%), Gaps = 9/666 (1%)
 Frame = +2

Query  14       DGTWDLDEDSMRLKQNQDHVVRLDRSGTLTDTVNETDDVEEMFYSSTQTRSTNGPPQYRS  73
                +  ++L++DS+R K  QD  VR+DRS TLTDTVN TDDVEEMFY+  ++ +T+G PQYR+
Sbjct  1838393  ESAYELNDDSLRRKHTQDETVRVDRSATLTDTVNMTDDVEEMFYN--RSTATSGIPQYRT  1838566

Query  74       TEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhatsISSV----Nltsthhhltts  129
                TEQ+ G  L L +L+ED ET S  S+ASSSFSQFS    S  +     N    HH  +T 
Sbjct  1838567  TEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSYAASTPGNHAGIHHDFSTM  1838746

Query  130      tsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAI  189
                 +  S   A+ G   +LE+L  E++++K EV  IR+ V+NELHVTRYDVLKEL LLKGAI
Sbjct  1838747  YNTTSTLPAISG-DFDLERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAI  1838923

Query  190      AQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKP  249
                AQL  T    ++S   S   S S+PLSS +R ALTRQT T TS ATRDRLAA R+NT K 
Sbjct  1838924  AQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKTSQATRDRLAAPRINTNKA  1839103

Query  250      PPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWAL  309
                PP A RAS RLTQLAPVAD ALSTPL+S Q+N+ FPLIDFT+ELAAHAR LTPGSR+WAL
Sbjct  1839104  PPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWAL  1839283

Query  310      TRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSP  369
                TR +EWL++RF  G D LLAVVGEGGSGKSAFCGTVAQQ+RG L+AAHCCQFDRK KS P
Sbjct  1839284  TRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRP  1839463

Query  370      RNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFM  429
                RNVLLS+VHQLV NLPLFKNQLARLNL+YVLEE DP LLA+KVL+DPLNALE+P    F+
Sbjct  1839464  RNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFI  1839643

Query  430      LVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAK  489
                L+DGIDQC  G  GRNELLEF++Q+I  LPSW+G +VSSKPSSKLAK LPVSSVLDFSAK
Sbjct  1839644  LIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAK  1839823

Query  490      NEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALS--GMASVSKE  547
                N AFVAD SSLV++I+ +F  +D  EAK +L  KSGGNFAYLEFTKQALS  GMA  S  
Sbjct  1839824  NGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTN  1840003

Query  548      GVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQ  607
                GVV + VLRELPETLYDIYAEIFEDKFG G AR W KA+ +LQL +GA AGPYS VTEEQ
Sbjct  1840004  GVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQ  1840183

Query  608      AQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQ  667
                A++   L  +DLR+LRRSFVD+VAVKHG YRIE+SALCAWL DP R+EEQFYF+I+DAL 
Sbjct  1840184  AKKQLDLNADDLRMLRRSFVDIVAVKHGAYRIESSALCAWLSDPVRSEEQFYFSIEDALL  1840363

Query  668      ALRKMR  673
                ALRKMR
Sbjct  1840364  ALRKMR  1840381

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 567 bits (1462),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 314/691 (45%), Positives = 427/691 (62%), Gaps = 81/691 (12%)
 Frame = -2

Query  20       DEDSMRL-KQNQDHVVRLDRSGTLTDTVNE------TDDVEEMFY---------------  57
                DED++R+ K   +   R  R+ T+  +         +DDVE+MFY               
Sbjct  1314543  DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  1314364

Query  58       --SSTQTRSTNGPPQ---------YRSTEQLPGRLLTLTSLNEDAETPsggsnasssfsq  106
                  +++  R  NG  +         YR+TEQL  R   L  LNED   P+     +     
Sbjct  1314363  GRTTSSMRDANGMNRSTSLRVTDVYRTTEQL--RNTNLMPLNEDEVLPAAMRTTTG----  1314202

Query  107      fsdhatsISSVNltsthhhlttstsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQH  166
                                               A GG  SE + LR EL+E+KQE+  IR+ 
Sbjct  1314201  -------------------------------AAGG--SEADALRAELVEMKQEMQTIRRE  1314121

Query  167      VVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNP---LSSADRGAL  223
                ++NE+HVTRYDVLKE+ +LKG I QL       +  V       V+ P   LS A    +
Sbjct  1314120  MMNEMHVTRYDVLKEITMLKGTIIQLVAALE--SKGVRTLDAGGVAEPQPELSPAQLDTI  1313947

Query  224      TRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDL  283
                TR T+  TS AT+DRLAA  V     P      + RLTQLAPVAD ALSTPL   Q++D+
Sbjct  1313946  TRTTAVHTSKATKDRLAAREVTAI--PTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  1313773

Query  284      FPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCG  343
                FPL+DF+ +L  HA++  P SR WA  R ++W++SRF  G D LLA+VG+GGSGKS   G
Sbjct  1313772  FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  1313593

Query  344      TVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEA  403
                 +  ++   +VA H C+FDRK KSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE 
Sbjct  1313592  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  1313413

Query  404      DPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLG  463
                DP++LA KVLVDPL ALE+P+    +LVDGIDQC      RN+LL+FLA +IP+ P+WLG
Sbjct  1313412  DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLG  1313239

Query  464      VIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHK  523
                + ++SKPS +L  +L ++S+LDFS KN  ++ D   L+++I  +F  +DV EA+++LK K
Sbjct  1313238  IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  1313059

Query  524      SGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWS  583
                SGGNF +L+FTKQALS      + G V +DVL +LPE++Y+IY EIFEDKFG G  R+W 
Sbjct  1313058  SGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWK  1312879

Query  584      KAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSA  643
                K + +L L + A +GPY+ +TEEQAQE F L+ +D+R++RR+F D++ V+HG YR+E SA
Sbjct  1312878  KVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSA  1312699

Query  644      LCAWLCDPARAEEQFYFNIDDALQALRKMRR  674
                +  WL DP R+ EQFY NI  ++  LR++ R
Sbjct  1312698  MYEWLVDPQRSGEQFYVNISASMDILRRLHR  1312606

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 86/391 (22%), Positives = 154/391 (39%), Gaps = 72/391 (18%)
 Frame = -2

Query  239     LAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHAR  298
               +AAS +N         R S+R  QL       L       +++ +   + F  +++  A 
Sbjct  169968  IAASSIN-------EVRYSMRKDQLITALQGQLDHEGQQARLHSILAPVPFQQQISKLAS  169810

Query  299     RLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHC  358
               R     R W + +  +W++S   + M     V G+ GSGK+A    + Q    ++ A H 
Sbjct  169809  RFV--GRKWLIAQLTKWIDSPTASQM---FWVTGQIGSGKTALAARLVQTI-PEIKAFHF  169648

Query  359     CQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVL----LASKVLV  414
                  + +   + R  +LS+ +QL   L   K+  A L  +  LEE  PV     L + +L+
Sbjct  169647  AFEEDEQTQNARRCVLSLAYQLTTQL---KDYAAFLQAREPLEELVPVSTFNELVTHLLI  169477

Query  415     DPLN---ALEDPVDVAFMLVDGIDQCNVGPAGRNE-------------------------  446
                PLN    L+       +L+DG++  + G +  +                          
Sbjct  169476  KPLNEIAQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFARGSMTAPTAFTSAE  169297

Query  447     -LLEFLAQLIPQLPSWLGVIVSSKP----SSKLAKRLPVSSVLDFSAKNEAFVADVSSLV  501
                L+  L  L+ QLP W+ VIV S+     ++KL    P   +  +  +N+    D+   +
Sbjct  169296  CLVSALPSLVSQLPKWVRVIVLSRNDPAINAKLQNFTPNIVLEAYVKENK---EDIKQFI  169126

Query  502     DEIACHFKHEDVEEAK-------EVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDV  554
               ++  C      +   K       +++  +S G F Y     Q+L       +E   A+  
Sbjct  169125  EKSLCSSASTGLSSGKTLPPDQIDLIVERSEGLFLYAANVVQSL-------EEKWFAVG-  168970

Query  555     LRELPETLYDIYAEIFEDKFGHGRARVWSKA  585
                + LP  +     + F   FG  + +VW  A
Sbjct  168969  -QSLPIGMNGYLYDFFVSHFGAKQYKVWVHA  168880

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 558 bits (1439),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 310/670 (46%), Positives = 430/670 (64%), Gaps = 25/670 (4%)
 Frame = +1

Query  20     DEDSMRL-KQNQDHVVRLDRSGTLTDTVNE------TDDVEEMFYSSTQTRSTNGPPQYR  72
              DE+++R+ K  Q+   R  R+ T+  +         +DDVEEMFY+ +   + N     R
Sbjct  94876  DEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSASAR  95055

Query  73     STEQLPGRLLTL------TSLNEDAETPsggsnasssfsqfsdhatsISSVNltsthhhl  126
              ST+   GR  T       T  N +A   +GGS   +   + ++     + + L       
Sbjct  95056  STDNF-GRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTNLMPLQEDEVLP  95232

Query  127    ttstsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLK  186
                S +  +   A  G +  ++ LR EL E+K EV AIR+ ++NE+HVTRYDVLKE+ +LK
Sbjct  95233  AASRATTTMATASNGGNP-IDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLK  95409

Query  187    GAIAQLTGTFPPPTT----SVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAAS  242
              G I QL             +   ++       LSS +   ++R T+  TS AT++R    
Sbjct  95410  GTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTISRTTALYTSKATKER----  95577

Query  243    RVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTP  302
              R       P   RAS RLTQLAPVAD ALSTPL   Q++++FPL++ +TEL A A+   P
Sbjct  95578  RATREDSAPVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDP  95757

Query  303    GSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFD  362
               SR WA+ R +EW++SRF  G+D LLA+VG+GGSGKS   G +  ++   +VA H C FD
Sbjct  95758  SSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFD  95937

Query  363    RKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALED  422
              RK KSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE DP++LA KVLVDPL ALE+
Sbjct  95938  RKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEE  96117

Query  423    PVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSS  482
              P+     + DGIDQC     GRN+LL+FLA +IP+LP+W+GV ++SKPS +L  +L ++S
Sbjct  96118  PLTAKVFVFDGIDQCK--SKGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITS  96291

Query  483    VLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMA  542
              +LDFSAKN  ++ D   L+++I  +F  +DV +A+E+LK KSGGNF +L+FTKQALS   
Sbjct  96292  LLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPG  96471

Query  543    SVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSP  602
                   G + +DVL +LPE++Y+IY EIFEDKFG GR+R+W K + +L+L + A +GPY+ 
Sbjct  96472  MEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYAL  96651

Query  603    VTEEQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNI  662
              +TE QAQE F L+ ED+R +RR+FVD++AV HG YRIE SAL  WL DP RA EQFY ++
Sbjct  96652  ITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDV  96831

Query  663    DDALQALRKM  672
                 +  LR++
Sbjct  96832  SGGMNLLRQL  96861

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 523 bits (1348),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 267/534 (50%), Positives = 368/534 (69%), Gaps = 11/534 (2%)
 Frame = -3

Query  149    LRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT-------GTFPPPTT  201
              LR EL E+KQE+ AI++ ++NE+H+TRYDVLKE+ +LKG I QL        G      T
Sbjct  26428  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  26249

Query  202    SVPLSIQRS-VSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRL  260
              +  + I     +N LS  ++ AL+R+T+T+ S  T++R+  +R +  + PP     S RL
Sbjct  26248  AAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRL  26075

Query  261    TQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRF  320
              TQLAPV DSALSTPL   Q++D+FPLIDF+ E+   +R    GSR W   R +EWL+SRF
Sbjct  26074  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  25895

Query  321    KAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQL  380
                G D +LA+VG+ GSGK+    +V  +Y  Q+VA H C+FDRK KSSPRNVLLS+V+QL
Sbjct  25894  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  25715

Query  381    VVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVG  440
                +LP+FK+QLARLNLKYVLEE D   L+ KVL+DPLNALE+P+   F++ D IDQC  G
Sbjct  25714  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  25535

Query  441    PAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSL  500
                G N+L +FL+ +IP+ P WLG +VSSKPS + A  +PVSSVLDFSA+N  ++ D   L
Sbjct  25534  -VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  25358

Query  501    VDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPE  560
              +++IA  F   D  EAK++LK KSGGN++YLEFTKQALS        G V +DVL +LP+
Sbjct  25357  INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQ  25178

Query  561    TLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlr  620
              +LY+IY EIFEDKFG GR RVW KA  VLQL   A +GPY+ +TE+   +    T +++R
Sbjct  25177  SLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVR  24998

Query  621    llrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMRR  674
              +LRR+F+D+++++HG Y I +SA+  WL D  R  EQ++ +++  ++ LRK+ R
Sbjct  24997  MLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  24836

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 509 bits (1312),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 249/458 (54%), Positives = 335/458 (73%), Gaps = 5/458 (1%)
 Frame = +1

Query  215   LSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTP  274
             LS+ +   ++R T+  TS AT+DR A    ++    P   RAS RLTQLAPVAD ALSTP
Sbjct  5227  LSTDEINTISRTTALFTSKATKDRRATRDESS---SPMLVRASSRLTQLAPVADEALSTP  5397

Query  275   LSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEG  334
             L   Q++++FPLI+ + EL A +R     SR WA+ R +EW++SRF  G+D LLA+VGEG
Sbjct  5398  LLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEG  5577

Query  335   GSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARL  394
             GSGKS   G ++ ++   +VA H C FDRK KSSPRNVLLS+V+Q++ NLPLFKNQLARL
Sbjct  5578  GSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARL  5757

Query  395   NLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQL  454
             NLKYVLEE+DPV+LA K+LVDPL ALE+P+     ++DG+DQC     GRN+LL+FLA +
Sbjct  5758  NLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVI  5931

Query  455   IPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVE  514
             IP+LP+W+GV ++SKPS +L  RL +SS+LDFSAKN  ++ D   ++++I   F  +DV 
Sbjct  5932  IPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVP  6111

Query  515   EAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKF  574
             +A+E+LK KSGGNF +L+FTKQALS        G + +DVL +LPE++Y+IY EIFEDKF
Sbjct  6112  QAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKF  6291

Query  575   GHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKH  634
             G GR R+W K + +L+L + A +GPY+ +TE QAQE F L+ ED+R +RRSFVD++ V+H
Sbjct  6292  GKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRH  6471

Query  635   GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKM  672
             G YRIENSAL  WL DP RA EQFY ++   + ALR++
Sbjct  6472  GTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  6585

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 97/212 (46%), Gaps = 64/212 (30%)
 Frame = +1

Query  20    DEDSMRL-KQNQDHVVRLDRSGTLTDTVNET------DDVEEMFY---------------  57
             DEDS+R+ K  Q+   R  R+ T+  +   +      DDVE+MFY               
Sbjct  4426  DEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSSVRST  4605

Query  58    -------------SSTQTRSTNGPPQ----YRSTEQLPGRLLTLTSLNEDAETPsggsna  100
                          + T +R+T G  +    YR+TEQL G    L  L ED   P+     
Sbjct  4606  DTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRG-TANLIPLQEDEVLPAASRTT  4782

Query  101   sssfsqfsdhatsISSVNltsthhhlttstsmmshPRAVGGASSELEQLRFELIEVKQEV  160
             ++S    + + ++ +S                        G  S+L+ LR EL E+K EV
Sbjct  4783  TTSQMPTNGNYSNGNS------------------------GGGSQLDALRTELSEMKLEV  4890

Query  161   AAIRQHVVNELHVTRYDVLKELALLKGAIAQL  192
              AIR+ ++NE+HVTRYDVLKE+ +LKG I QL
Sbjct  4891  QAIRREMMNEMHVTRYDVLKEVTMLKGTILQL  4986

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 482 bits (1241),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 249/536 (46%), Positives = 356/536 (66%), Gaps = 27/536 (5%)
 Frame = +2

Query  162    AIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTF-----------PPPTTSVPLSIQRS  210
              AIR+ ++NE+H +RYDVLKE+ +LKG I QL                             
Sbjct  9671   AIRREMMNEMHTSRYDVLKEVTMLKGTITQLVSILQQSGXXXXXXXXXXXXXXXXXXXXX  9850

Query  211    VSNPLSSADR-GALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARA-SVRLTQLAPVAD  268
                 P  S D+   + R+T+T+ S +T++R+  +R +     PP  RA SVRLTQLAPV D
Sbjct  9851   XXXPELSPDQIETMARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDD  10021

Query  269    SALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLL  328
              SALSTPL+  Q+++LFPL+DF+ E+   AR    G+R WA  R +EWL+SRF  G D LL
Sbjct  10022  SALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLL  10201

Query  329    AVVGEGGSGKSA----------FCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVH  378
              A+VG+ G+GK+               ++ ++   +VA H C+F+RKGKSSPRNVLLSVV+
Sbjct  10202  AMVGDAGTGKTVAXXXXXXXXXXXXAISDRFHEHVVAQHFCKFERKGKSSPRNVLLSVVN  10381

Query  379    QLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCN  438
              QL   LP FK+QLARLNLKYVLEE D + LA KVLVDPL +LE+P+   F+L+DG+DQC 
Sbjct  10382  QLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCG  10561

Query  439    VGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVS  498
              V   G N+LL+FL+ ++P+ PSWLG ++++KPS + A+++PV+S+LDFSAKN A+V D +
Sbjct  10562  VA-NGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTA  10738

Query  499    SLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLREL  558
               L+ +I   F  ED  +A ++LK KS GN++YLEFT+QA+S     + +G V +DVL +L
Sbjct  10739  VLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDL  10918

Query  559    PETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrltted  618
              P++LY+IY EIFEDKFG GR R+W KA  VLQL   A +GPY+ +TE+   +      +D
Sbjct  10919  PQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDD  11098

Query  619    lrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMRR  674
              +R+LRR+F+D+++++HG Y I +SAL  WL DP R  E ++ ++   ++ LR++ R
Sbjct  11099  VRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLR  11266

>PYVX:scaffold_1323 pve_scaffold_1323 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1323:1:4715:1 
REF
Length=4715

 Score = 449 bits (1155),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 233/429 (54%), Positives = 306/429 (71%), Gaps = 6/429 (1%)
 Frame = -2

Query  250   PPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWAL  309
             P PAARAS RLTQLAPV D+ALS PL   Q+++LFPL+D +T++AA AR   PG+R WA 
Sbjct  2716  PTPAARASARLTQLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWAT  2537

Query  310   TRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSP  369
              R +EWL+SRF  G D LL VVG  G+GKS FCG+V    +G ++A H C+FDRK KS+P
Sbjct  2536  ARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTP  2357

Query  370   RNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFM  429
             R VLLS+V Q+V NLP FK QLARLNLKYVLEE D  +LA KVL+DPL A E+P+    +
Sbjct  2356  RVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCL  2177

Query  430   LVDGIDQCNVGPAG--RNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
             ++DG+DQC     G  RNELLEFLA ++PQLPSWLGV+VSSKP+ +LA +L  +S+LDFS
Sbjct  2176  VLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFS  1997

Query  488   AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKE  547
              KN+ FV D   LVD+IA +F      EA+ +L+ K+GGNFAYL+FT+QALS       +
Sbjct  1996  GKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPG--LDD  1823

Query  548   GVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVW--SKAEQVLQLAIGATAGPYSPVTE  605
             G + +D+L +LPE+LY+IY EIFEDKFG GR R+W                 GPYS V E
Sbjct  1822  GELELDMLHDLPESLYEIYLEIFEDKFGRGRNRLWXXXXXXXXXXXXXXXXXGPYSLVRE  1643

Query  606   EQAQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDA  665
             + A+E    +++D+RL++RSFVD++AV+ G YRIE+SAL  WL DPAR+ E F+F+ D  
Sbjct  1642  DAARELLGYSSDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAG  1463

Query  666   LQALRKMRR  674
             +  LR++++
Sbjct  1462  VDELRRLQQ  1436

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 82/195 (42%), Gaps = 53/195 (27%)
 Frame = -3

Query  14    DGTWDLDEDSMRL-KQNQDHVVRLDRSGTLTDTVNETDD-VEEMFYSSTQT---------  62
             DG    D++S+RL +Q  +  +R  R  TL+   +   D VEEMFY              
Sbjct  3438  DGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYGGGPGGHAGHGGHA  3259

Query  63    ------RSTNGPPQ----YRSTEQLPGRLLTLTSLNEDAETPsggsnasssfsqfsdhat  112
                   RST G  +    YR+TEQL  R   L  L ED   P                  
Sbjct  3258  GHGGADRSTAGSVRTTDVYRTTEQL--RSTGLEPLAEDRVLPPAVP--------------  3127

Query  113   sISSVNltsthhhlttstsmmshPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELH  172
                SV                S P A G     L  LR EL +V+ E  AIR+ V+NELH
Sbjct  3126  -YGSV-------------PHTSGPHADGPGG--LAALRAELADVRAETQAIRREVMNELH  2995

Query  173   VTRYDVLKELALLKG  187
             V RYDVLKE+ +LKG
Sbjct  2994  VLRYDVLKEVTVLKG  2950

>ALCA:scaffold_62 AcNc2_CONTIG_62_length_96346 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_62_length_96346:1:96346:1 
REF
Length=96346

 Score = 340 bits (872),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 192/531 (36%), Positives = 305/531 (57%), Gaps = 11/531 (2%)
 Frame = -1

Query  145    ELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVP  204
              ++E  R E+  +++E+  +RQ ++  +  TRYD+LKE+  LKG +A ++     P  +  
Sbjct  25777  QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKI  25598

Query  205    LSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLA----ASRVNTYKPPPPAARASVRL  260
                +  + +N  S+   GA       +++  T DR       S +          R S  L
Sbjct  25597  NKLNHTTANG-SACSEGA--DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRES-GL  25430

Query  261    TQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRF  320
                L  + ++ LS PLS  +++++FPLID + ++ ++A +L  G+R WAL    +W++S F
Sbjct  25429  PTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNF  25250

Query  321    KAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQL  380
              + G + +L +VGEGG+GKS   G V Q++   L A H  QFDRK  SS R+V+LS+V Q 
Sbjct  25249  ENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQF  25070

Query  381    VVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNAL-EDPVDVAFMLVDGIDQCNV  439
                 L L+K QL RLNL+Y+L E++P+++A+K+L+DPL A+ E      F+L DGIDQC V
Sbjct  25069  ASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV  24890

Query  440    GPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSS  499
                   N+LLE L+ +  + PSW+G +V+SK     A RL  +SV+     N  F+ D   
Sbjct  24889  KNQS-NDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRI  24713

Query  500    LVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELP  559
              L++ +  +F+ +   EA ++L  KSGGN  YL+F  +ALS      ++  +++DVL ELP
Sbjct  24712  LMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELP  24533

Query  560    ETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrlttedl  619
              E++ +I   IF+DKFG G  RVW  A+ +L++ + A AGPY  V E Q ++ F L   + 
Sbjct  24532  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  24353

Query  620    rllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALR  670
              R++ R+F D++      YRI NS+L  WL    R+ + F+ N     + LR
Sbjct  24352  RMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  24203

>ALLA:FR824215 dna:supercontig supercontig:ENA1:FR824215:1:55297:1 
REF
Length=55297

 Score = 325 bits (834),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 305/534 (57%), Gaps = 30/534 (6%)
 Frame = -2

Query  144    SELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQL-----------  192
              ++ E +R E+ +++ E+ ++RQ ++  +  TRYD++KE+  L+G +  +           
Sbjct  23763  NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  23584

Query  193    --TGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPP  250
                TGT    TT+   +   S  +      R     +++ +   + +      R+NT    
Sbjct  23583  SPTGTNENHTTANKTAFSESAEDD-EIISRFITPERSTIVADCSYKSGFVTERLNTKDSS  23407

Query  251    PPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALT  310
                        +   P+ +S LS PL   + +++FP ID  ++L ++A +L  G+R WAL 
Sbjct  23406  ---------FSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALD  23254

Query  311    RAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPR  370
              R +EW+ES FK+  D +L ++GEGGSGKS   G + Q++  +L A H CQFDRK +SS R
Sbjct  23253  RVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSR  23074

Query  371    NVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA---  427
              +V+LS+V Q     PL+K QL  LNL+Y+L+E++P+++A+K+L++PL A+  PV  +   
Sbjct  23073  DVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRG  22900

Query  428    FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487
              F+L DGIDQC V     N+LL+ ++ +  + PS +G +V+SK S     +    S++   
Sbjct  22899  FVLFDGIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLH  22723

Query  488    AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKE  547
               +N  F+ D   L++    +F+ +   EA ++L  KSGGN  YL+FT++ALS      + 
Sbjct  22722  ERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGER  22543

Query  548    GVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQ  607
                +++DVL ELP+++ DI+  IFEDKFG G  RVW   + +L+  + A AG +  V E Q
Sbjct  22542  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  22363

Query  608    AQEHFrlttedlrllrrSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFN  661
               ++ F+L  E+ R+++RSF D++      YRI  S+L AWL    R+ + FY +
Sbjct  22362  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYID  22204

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 262 bits (670),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 184/579 (32%), Positives = 295/579 (51%), Gaps = 92/579 (16%)
 Frame = -2

Query  155     EVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTF--PPPTTSVPLSIQRSVS  212
               E+K+ V  IR+ V+ ELH T+YD+LKE+ +L+GA+ QL       P   + PL       
Sbjct  431507  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL-------  431349

Query  213     NPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPP-----PAA-------------  254
                 L + DR       +T++S A  +         ++P P     PAA             
Sbjct  431348  --LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTV  431175

Query  255     -----RASVRLTQLA------------------------PVADSALSTPLSSVQMNDLFP  285
                    RAS +L++ +                        P+ D AL+ P  +V +N   P
Sbjct  431174  VRESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPWENV-LNQHLP  430998

Query  286     LIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTV  345
                ++        A  + P +RTWA+ +  +W +         +L VVG  G+GKS     +
Sbjct  430997  FLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  430830

Query  346     AQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADP  405
                  Y  Q++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP
Sbjct  430829  VSNYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDP  430656

Query  406     VLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVI  465
               V+LA+K+L++PL ++  P++   +++D +D+    P G N L+  LA +  + PSW+  +
Sbjct  430655  VVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLFL  430482

Query  466     VSSKPSSKLAKRLPVSSVLDFSAKNEAFVAD----VSSLVDEIACHFKHEDVEEAKEVLK  521
               +SS+P   + K LP   VL F  ++  F AD    V SL+D+        D +    +LK
Sbjct  430481  LSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGL-----DDKNILFLLK  430317

Query  522     HKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARV  581
                KS G+F YL+F  QA + + S    G++      ELP+TLY+IY ++FE+K+G GR RV
Sbjct  430316  AKSQGSFLYLQFVDQAFAMIHSEIDAGMIL-----ELPKTLYEIYDQVFEEKYGKGRRRV  430152

Query  582     WSKAEQVLQLAIGA-------TAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLVAVKH  634
               W K + VL+  +GA        A P+  VTE   Q  F+L   DL L+ RSF D+VAV  
Sbjct  430151  WQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDE  429978

Query  635     --GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRK  671
                 G+YR+++  L  +L D +R++E  + N++  +  L K
Sbjct  429977  ETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  429861

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 256 bits (654),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 181/583 (31%), Positives = 296/583 (51%), Gaps = 90/583 (15%)
 Frame = +1

Query  155     EVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNP  214
               E+K+ V  IR+ V+ ELH T+YD+LKE+ +L+GA+ QL       +T       R+V+ P
Sbjct  171466  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTP------RAVATP  171627

Query  215     L-SSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPP-----PAA--------------  254
               L  + DR       +T++S A  +         ++P P     PAA              
Sbjct  171628  LLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVF  171807

Query  255     ----RASVRLTQLA--------------------------------PVADSALSTPLSSV  278
                   RAS +L++ +                                P+ D AL+ P  +V
Sbjct  171808  RESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWENV  171987

Query  279     QMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGK  338
                +N   P ++        A  + P +RTWA+ +  +W +         +L VVG  G+GK
Sbjct  171988  -LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGK  172152

Query  339     SAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKY  398
               S     +   Y  Q++A+H  ++D +   +P  +L+S+ HQ+   LP ++ QL RLNL Y
Sbjct  172153  STLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKLPDYQQQLVRLNLPY  172326

Query  399     VLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQL  458
               +++E DP++LA+K+L++PL ++  P++   +++D +D+ +V   G N L+  LA +  + 
Sbjct  172327  LIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGAN-LISLLADVALEF  172500

Query  459     PSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHE-DVEEAK  517
               PSW+  ++SS+    + K LP   VL F  ++  F AD +  V  +    KH  D +   
Sbjct  172501  PSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMD--KHGLDDKNIL  172674

Query  518     EVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHG  577
                +LK KS G+F YL+F  QA S + S    G++      ELP+TL++IY ++FE+K+G G
Sbjct  172675  FLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEIYDQVFEEKYGKG  172839

Query  578     RARVWSKAEQVLQLAIGA-------TAGPYSPVTEEQAQEHFrlttedlrllrrSFVDLV  630
               R RVW K + VL+  +GA        A P+  VTE   Q  F+L   DL L+ RSF D+V
Sbjct  172840  RRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIV  173013

Query  631     AVKH--GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRK  671
                V    G+YR+++  L  +L D AR++E  + N++  +  L K
Sbjct  173014  TVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  173142

>PYVX:scaffold_674 pve_scaffold_674 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_674:1:16178:1 
REF
Length=16178

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 102/466 (22%), Positives = 184/466 (39%), Gaps = 79/466 (17%)
 Frame = -1

Query  255    RASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEE  314
              R + R  QLA      L       ++  L     F  +++    R T   R W   R ++
Sbjct  10424  RYAARKDQLATALRGQLDHEGQQARLFSLLSPFSFQQQISKLTYRFT--GRDWLFKRVQQ  10251

Query  315    WLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLL  374
              W+          +  + G+ GSGK++    + Q +  ++ A H    +       R  +L
Sbjct  10250  WINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDDQTHIARRCVL  10074

Query  375    SVVHQLVVNLPLFKNQLARLNLKYVLEEADPV----LLASKVLVDPLNALEDPVDVAFML  430
              S+ +QL   LP +      L  +  LEE  PV     L + +LV+PLN ++ P     +L
Sbjct  10073  SLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLILL  9903

Query  431    VDGIDQCNVGPAGRNE----------------LLEFLAQLIPQLPSWLGVIVSSKPSSKL  474
              +DG+ +C V  A  +                 L+  L  L+ +LPSW+ +++ S+    +
Sbjct  9902   IDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLSREDHDV  9726

Query  475    AKRLPV---SSVLD-FSAKNEA----FV----------ADV----------SSLVDEIAC  506
                RL     S V+D F+ +NE     FV          AD+           S +  +A 
Sbjct  9725   MTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIVEAATAETSGRSRLTTLAR  9546

Query  507    HF--------KHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLREL  558
              H         +     E  E++  ++ G F Y     Q +       +EG VA++ L +L
Sbjct  9545   HVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGI-------EEGRVALNELDKL  9387

Query  559    PETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFrltted  618
              P  +     + F+  F     +        ++ A+      Y P+T +   +       +
Sbjct  9386   PTGMGGCLRQFFDSHFDDNTYKT------TIRPALEVLCAAYEPLTMDALAKVLEWDIYE  9225

Query  619    lrllrrSFVDLVAVKHG--IYRIENSALCAWLCDPARAEEQFYFNI  662
               R +  +F  L+ V  G    R  +S++  W+ + +RA  +FY ++
Sbjct  9224   QREVVATFGSLLYVAEGDNFVRPFHSSVLEWVQN-SRAAGRFYADV  9090

>PYIR:scaffold_32 pir_scaffold_32 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_32:1:78258:1 
REF
Length=78258

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 78/337 (23%), Positives = 140/337 (42%), Gaps = 74/337 (22%)
 Frame = +3

Query  305    RTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRK  364
              R W   + E W+ S        +  V G+ GSGK+A    + Q    ++ A H    + +
Sbjct  74484  REWLFMQLENWIAS---PTATQVFWVTGQIGSGKTALAARMVQVIP-EIAAFHFALQEDE  74651

Query  365    GKSSPRNVLLSVVHQLVVNLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPLNALEDP  423
                 + R  +LS+ +QL   LP +   L +R  L+ ++  ++   L +++LV+PLN +  P
Sbjct  74652  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  74831

Query  424    VDVA--FMLVDGI--------------------------------DQCNVGPAGRNELLE  449
                     +L+DG+                                D CN  P+G   L+ 
Sbjct  74832  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  75011

Query  450    FLAQLIPQLPSWLGVIVSSK--PS--SKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEI-  504
               L  L+ +LP+W+ V++ S+  P+  +KL    P S VLD S K+E+   D+   V+ + 
Sbjct  75012  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTP-SIVLD-SLKSES-QQDIKRYVENML  75182

Query  505    --------------------ACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASV  544
                                  A  F ++   E  +++  +S G F Y     Q++      
Sbjct  75183  GESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI------  75344

Query  545    SKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARV  581
               +E  +A+D L  LP  +   + + F+  F   + +V
Sbjct  75345  -EEKRLAVDQLESLPIGMGGYFRQFFDGHFDEQQYQV  75452

>PHKE:scaffold_386 scf_22126_386.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_386.1:1:33848:1 
REF
Length=33848

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 69/304 (23%), Positives = 121/304 (40%), Gaps = 71/304 (23%)
 Frame = +1

Query  323   GMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVV  382
             G   +  VVG+ G+GK++    + Q    ++ A H  Q + +   + R  +LS+ +QL  
Sbjct  8008  GSQRVFWVVGQIGAGKTSVAARLVQSC-PEIAAFHFAQQEDEQTHNARRCVLSLAYQLTT  8184

Query  383   NLPLFKNQLARLNLKYVLEEADPVL----LASKVLVDPLNALEDPVDVAFMLVDGIDQCN  438
              LP + + L        LEE  PV     L + +LV PLNA+  P     +L+DG++   
Sbjct  8185  QLPEYAHYLQS---HEPLEEMVPVASFPELVTNLLVGPLNAIARPSKSLVLLIDGLEW--  8349

Query  439   VGPAGRNE---------------------LLEFLAQLIPQLPSWLGVIVSSKPSSKLAKR  477
             + PA  +                      L+  L  L+P+LP W+  ++ S+    +  R
Sbjct  8350  LIPASSSSSPPSLSSLSMSSWKESKEEECLVSMLPSLVPRLPEWVRFVLLSREDPTVLSR  8529

Query  478   L-----PVSSVLDFSAKNEAFVADVSSLV---------------------DEIACHFKHE  511
             L     P  ++ +F  +N+  +   +SL                      DE++ H    
Sbjct  8530  LQPFEPPNITMENFRQENDQDICRFTSLAFSKLDLEQTTASKSTASPANSDEVSAH----  8697

Query  512   DVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFE  571
                +  E++  +S G F Y     QA++       EG + +  L  LP  +     + F 
Sbjct  8698  ---DIVELVTRRSEGLFLYAVNVVQAIN-------EGRLHLHDLAALPVGMGACLQQFFA  8847

Query  572   DKFG  575
               F 
Sbjct  8848  SHFA  8859

>PHIF:NW_003303706.1 Phytophthora infestans T30-4 supercont1.53 
genomic scaffold, whole genome shotgun sequence
Length=932874

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 130/317 (41%), Gaps = 59/317 (19%)
 Frame = -3

Query  305     RTWALTRAEEWLE----SRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQ  360
               R W     + W++    S  +     +  V+G+ GSGKS+    + Q    ++ A H   
Sbjct  153640  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  153464

Query  361     FDRKGKSSPRNVLLSVVHQLVVNLPLFKNQL-ARLNLKYVLEEADPVLLASKVLVDPLNA  419
                + +   + R  +LS+ +QL   LP + + L +   L+ ++  A  V L + +L+ PLNA
Sbjct  153463  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  153284

Query  420     LEDPVDVA--FMLVDGID-----QCNVGPAG-----RNE--LLEFLAQLIPQLPSWLGVI  465
               +  P       +L+DG++      C     G     ++E  L+  L  L+ +LP W+ ++
Sbjct  153283  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  153104

Query  466     VSSKPS----SKLAKRLPVSSVLD-FSAKNEAFVADVSSLVDEIACHFKHEDV-------  513
               + S+      SKL    P   +++ F  +N+    D+   +          DV       
Sbjct  153103  LLSREEPPVLSKLHAFDPPDVIIEQFKLQND---QDIRRFISSSLSKLNLSDVDFEQASA  152933

Query  514     -------------EEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELP-  559
                            E+  E++  +S G F Y     QA+S       EG + +  L ELP 
Sbjct  152932  QIGSGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAELPV  152774

Query  560     ---ETLYDIYAEIFEDK  573
                    L+  +A  F D 
Sbjct  152773  GMGAYLHQFFASHFADH  152723

>PYIW:scaffold_205 piw_scaffold_205 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_205:1:24899:1 
REF
Length=24899

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 78/343 (23%), Positives = 138/343 (40%), Gaps = 64/343 (19%)
 Frame = +2

Query  203    VPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQ  262
              +PLSI R     +S      L  + S+ T ++ R  + +  +N+        R ++R  Q
Sbjct  20723  IPLSICRIQWLDMSDC----LLYEASSSTGASQRRLVDSVTINS-------VRYAIRKEQ  20869

Query  263    LAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKA  322
              L       L       ++  +   + F  +++    R     R W   + E W+ S   A
Sbjct  20870  LVTALKGKLDHEGQQTRLFSILSPLSFQQQISKLTSRF--AGREWLFAQLESWIASPSAA  21043

Query  323    GMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVV  382
                  +  V G+ GSGK+A    + Q    ++ A H    + +   + R  +LS+ +QL  
Sbjct  21044  ---QVFWVTGQIGSGKTALAARMVQLI-PEIAAFHFALQEDEQTQNARRCVLSLAYQLTT  21211

Query  383    NLPLFKNQLARLNLKYVLEEADPV----LLASKVLVDPLNALEDPVDVA---FMLVDGID  435
               LP +    + L  +  LEE  PV     L +++LV+PLN +  P        +L+DG++
Sbjct  21212  QLPQYA---SFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARPQTATKPLVLLIDGLE  21382

Query  436    Q---------CNVGPAGRNE---------------------LLEFLAQLIPQLPSWLGVI  465
                            P GR                       L+  L  L+ +LP W+ V+
Sbjct  21383  HLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVSALPSLVARLPKWVRVV  21562

Query  466    VSSKPSSKLAKRLPVSS---VLD-FSAKNEAFVADVSSLVDEI  504
              + S+    +  +L   +   VLD F  +N+    D+ S V++I
Sbjct  21563  LLSRKDPAIIAKLQGHTPNVVLDRFERENQ---QDIKSYVEKI  21682

>SAPA:scaffold_92 supercont2.92 dna:supercontig supercontig:ASM15154v2:supercont2.92:1:149726:1 
REF
Length=149726

 Score = 32.7 bits (73),  Expect(2) = 0.003, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 75/173 (43%), Gaps = 21/173 (12%)
 Frame = -2

Query  220    RGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQ  279
              R  L    S+ T+++ R  LA+SR   +KP        + +T L P  D  +   L   +
Sbjct  49261  RSRLLCVASSTTTASKRASLASSRRFRFKPSTICMTIFMHMTILCP--D*QVHARLCRPR  49088

Query  280    MNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKS  339
              M            + A+AR    G R +A+              +D  + V G+ G+GKS
Sbjct  49087  MGP-----GPAGPMEANARPSVLGHR-YAMESMH----------VDLSIVVQGQIGTGKS  48956

Query  340    AFCGTVAQQYRGQLVAAH-CCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQL  391
              A    + Q  R ++ A H  C+ D + +S  R  +LS+ +QL   LP + + L
Sbjct  48955  ALAAYIIQS-RPEVRAFHLVCKEDEQTQSH-RRCVLSLAYQLTTQLPEYASFL  48803

 Score = 32.3 bits (72),  Expect(2) = 0.003, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 20/99 (20%)
 Frame = -3

Query  400    LEEADPVL----LASKVLVDPLNALEDPVDVAF----------------MLVDGIDQCNV  439
              LEE  PV     L   +LV PL A+ +P                     +L+DG+D    
Sbjct  48732  LEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVYVHTKNDS*KKMC*VILLDGLDSLED  48553

Query  440    GPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRL  478
                   N L+  L  L+ +LPSW+ VI++S+    + ++L
Sbjct  48552  TQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKL  48436

>PYIR:scaffold_134 pir_scaffold_134 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_134:1:50667:1 
REF
Length=50667

 Score = 35.0 bits (79),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 3/89 (3%)
 Frame = +1

Query  336   SGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLN  395
             S ++ FC  V Q++    VA  CC   R  +++ R+V++   H + V +      LAR  
Sbjct  8176  SRRAPFCSMVMQEFHDLQVAVRCCGIHRASRAAFRSVVVQESHNVQVTVLSSLIHLAR--  8349

Query  396   LKYVLEEADPV-LLASKVLVDPLNALEDP  423
              K V    +P+  L +  L  P+N L+ P
Sbjct  8350  SKRVAVMVEPLDNLKNSSLFGPVNVLDAP  8436

>APIN:scaffold_17 supercont1.17 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.17:1:1477854:1 
REF
Length=1477854

 Score = 35.0 bits (79),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 40/87 (46%), Gaps = 16/87 (18%)
 Frame = -1

Query  408    LASKVLVDPLNALEDPVDVAF----------------MLVDGIDQCNVGPAGRNELLEFL  451
              L + +LV PLNA+  P  V                  +L+DG+D      A  N  +  L
Sbjct  14706  LVTTLLVVPLNAIAQPTTVPLVRTAVGCIRG*QGP*VILLDGLDAFQDAAALDNCFVSSL  14527

Query  452    AQLIPQLPSWLGVIVSSKPSSKLAKRL  478
                L+ +LPSW+ +I +S+    + ++L
Sbjct  14526  VALVRKLPSWVRMIWTSREDPSVMRKL  14446

>PYIR:scaffold_1099 pir_scaffold_1099 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1099:1:10443:1 
REF
Length=10443

 Score = 35.0 bits (79),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 38/78 (49%), Gaps = 4/78 (5%)
 Frame = -3

Query  143   SSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTS  202
             + EL  L  ELIE  QEV  I   + + L     +VL++L  +  AIAQ+        + 
Sbjct  6589  TEELRNLNRELIEASQEVIRIESEIFDALRAKVLNVLQDLQGMAHAIAQV----DVVCSH  6422

Query  203   VPLSIQRSVSNPLSSADR  220
               ++I R+ + PL  + R
Sbjct  6421  AQVAIDRNFTRPLLDSSR  6368

Lambda      K        H        a         alpha
   0.316    0.131    0.373    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 249297704544

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40