Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SPRG_03282111501004100452840.0
SDRG_14094111501003100450980.0
H310_11729111501002103635600.0
H257_1278711150968101535510.0
PYIW_14752111501031106632000.0
PYIR_15175111501030106531990.0
PHYSO_560347111501010104331970.0
PYU1_G005966111501030106531900.0
PHYCA_570034111501011104431880.0
PHALS_11566111501009104231810.0
PPTG_09255111501008104131810.0
PYVX_13921111501041107331750.0
PITG_13745111501008104131710.0
HYAP_08497111501007104630970.0
CCA179911115096598730260.0
PHYRA_8167811150975104730140.0
PYAP_2488311150980102429210.0
CCI4083111150116396228180.0
PYAR_247791115069971320150.0
PHYKE_64071115093464819250.0
PYAR_243741057103253269261e-115
SPRG_0920712681334678950.030
H257_09623456166664930.059
SPRG_1363913724917966870.098
H310_1052314050926272890.10
PYU1_G0025058274240052870.25
H257_0392513993329063860.29
SDRG_1204513028824562850.35
CCA20583329736544850.43
SPRG_1487013028824662820.70
SDRG_1477712681324452820.74
PYVX_17912481013439790.80
PYIW_13425481025744820.81
CCI470381195331282820.88
H310_11163456166338821.1
CCI42121329758244821.3
PHYRA_8762173858183130781.4
HYAP_07166645217632731.6
PHYRA_8411271985321130801.6
PHYRA_7256069544321185801.6
PHYRA_7255969543321185801.6
PHYRA_7313732918243130782.0
CCA149951195331032792.0
PYVX_178811053674847792.5
PHYRA_8251471560251130782.7
PHYRA_7374669742268127773.1
PHYRA_77018719293955793.2
CCA169391528608641713.3
PHYRA_8583972647150130743.4
H310_07251138840494773.7
PYIW_249341296926171773.7
SDRG_0942512610921771763.8
PYAP_13607481027038773.8
PPTG_087318601157841784.0
PYVX_1323979041021123784.0
PHYRA_8695173358334126764.8
PHYKE_74907904895123775.5
PHYRA_77897262033247765.6
PYIW_161772254106178775.7
H310_0707713993330174755.7
H310_0669213887635842756.5
H257_0532614050927377756.5
PYU1_G0123301254624841747.0
PHYRA_8710573467321130757.1
PITG_104208601155141767.1
PHYSO_488734708837948757.3
SPRG_1071112763022777747.6
PHYRA_8465372135321130748.1
H257_0133313887635339748.2
PHYSO_3073514932228184748.4
H310_05086708837968748.5
PYVX_229964956218645729.1
PHYCA_527156481026298739.3
PITG_03761329743140749.7
PYIW_162818333526138739.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SPRG_03282

Length=1004
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPRG_03282                                                            2040    0.0   
SDRG_14094                                                            1968    0.0   
H310_11729                                                            1375    0.0   
H257_12787                                                            1372    0.0   
PYIW_14752                                                            1237    0.0   
PYIR_15175                                                            1236    0.0   
PHYSO_560347                                                          1236    0.0   
PYU1_G005966                                                          1233    0.0   
PHYCA_570034                                                          1232    0.0   
PHALS_11566                                                           1229    0.0   
PPTG_09255                                                            1229    0.0   
PYVX_13921                                                            1227    0.0   
PITG_13745                                                            1226    0.0   
HYAP_08497                                                            1197    0.0   
CCA17991                                                              1170    0.0   
PHYRA_81678                                                           1165    0.0   
PYAP_24883                                                            1129    0.0   
CCI40831                                                              1090    0.0   
PYAR_24779                                                            780     0.0   
PHYKE_6407                                                            746     0.0   
PYAR_24374                                                            361     1e-115
SPRG_09207                                                            41.2    0.030 
H257_09623                                                            40.4    0.059 
SPRG_13639                                                            38.1    0.098 
H310_10523                                                            38.9    0.10  
PYU1_G002505                                                          38.1    0.25  
H257_03925                                                            37.7    0.29  
SDRG_12045                                                            37.4    0.35  
CCA20583                                                              37.4    0.43  
SPRG_14870                                                            36.2    0.70  
SDRG_14777                                                            36.2    0.74  
PYVX_17912                                                            35.0    0.80  
PYIW_13425                                                            36.2    0.81  
CCI47038                                                              36.2    0.88  
H310_11163                                                            36.2    1.1   
CCI42121                                                              36.2    1.3   
PHYRA_87621                                                           34.7    1.4   
HYAP_07166                                                            32.7    1.6   
PHYRA_84112                                                           35.4    1.6   
PHYRA_72560                                                           35.4    1.6   
PHYRA_72559                                                           35.4    1.6   
PHYRA_73137                                                           34.7    2.0   
CCA14995                                                              35.0    2.0   
PYVX_17881                                                            35.0    2.5   
PHYRA_82514                                                           34.7    2.7   
PHYRA_73746                                                           34.3    3.1   
PHYRA_77018                                                           35.0    3.2   
CCA16939                                                              32.0    3.3   
PHYRA_85839                                                           33.1    3.4   
H310_07251                                                            34.3    3.7   
PYIW_24934                                                            34.3    3.7   
SDRG_09425                                                            33.9    3.8   
PYAP_13607                                                            34.3    3.8   
PPTG_08731                                                            34.7    4.0   
PYVX_13239                                                            34.7    4.0   
PHYRA_86951                                                           33.9    4.8   
PHYKE_7490                                                            34.3    5.5   
PHYRA_77897                                                           33.9    5.6   
PYIW_16177                                                            34.3    5.7   
H310_07077                                                            33.5    5.7   
H310_06692                                                            33.5    6.5   
H257_05326                                                            33.5    6.5   
PYU1_G012330                                                          33.1    7.0   
PHYRA_87105                                                           33.5    7.1   
PITG_10420                                                            33.9    7.1   
PHYSO_488734                                                          33.5    7.3   
SPRG_10711                                                            33.1    7.6   
PHYRA_84653                                                           33.1    8.1   
H257_01333                                                            33.1    8.2   
PHYSO_307351                                                          33.1    8.4   
H310_05086                                                            33.1    8.5   
PYVX_22996                                                            32.3    9.1   
PHYCA_527156                                                          32.7    9.3   
PITG_03761                                                            33.1    9.7   
PYIW_16281                                                            32.7    9.8   

>SPRG_03282
Length=1004

 Score = 2040 bits (5284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1004/1004 (100%), Positives = 1004/1004 (100%), Gaps = 0/1004 (0%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI  180
             VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI  180

Query  181   ILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA  240
             ILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA
Sbjct  181   ILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA  240

Query  241   TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR  300
             TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR
Sbjct  241   TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR  300

Query  301   TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS  360
             TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS
Sbjct  301   TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS  360

Query  361   SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPI  420
             SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPI
Sbjct  361   SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPI  420

Query  421   AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  480
             AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR
Sbjct  421   AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  480

Query  481   IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALT  540
             IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALT
Sbjct  481   IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALT  540

Query  541   FDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDTLSDAEHARVADALDYIRG  600
             FDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDTLSDAEHARVADALDYIRG
Sbjct  541   FDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDTLSDAEHARVADALDYIRG  600

Query  601   LSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQ  660
             LSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQ
Sbjct  601   LSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQ  660

Query  661   LRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAV  720
             LRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAV
Sbjct  661   LRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAV  720

Query  721   LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVK  780
             LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVK
Sbjct  721   LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVK  780

Query  781   QQTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSIL  840
             QQTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSIL
Sbjct  781   QQTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSIL  840

Query  841   SQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQAT  900
             SQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQAT
Sbjct  841   SQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQAT  900

Query  901   KCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQ  960
             KCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQ
Sbjct  901   KCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQ  960

Query  961   FFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             FFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL
Sbjct  961   FFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004

>SDRG_14094
Length=1003

 Score = 1968 bits (5098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 973/1004 (97%), Positives = 984/1004 (98%), Gaps = 1/1004 (0%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMY STGS
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYTSTGS  120

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI  180
             VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI  180

Query  181   ILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA  240
             ILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA
Sbjct  181   ILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA  240

Query  241   TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR  300
             TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR
Sbjct  241   TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR  300

Query  301   TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS  360
             TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS
Sbjct  301   TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS  360

Query  361   SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPI  420
             SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSV    E++    +    FDKNLYPI
Sbjct  361   SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVYRLSEKDTAS-KLSILFDKNLYPI  419

Query  421   AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  480
             AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR
Sbjct  420   AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479

Query  481   IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALT  540
             IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGS+AKEGTPQALT
Sbjct  480   IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSNAKEGTPQALT  539

Query  541   FDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDTLSDAEHARVADALDYIRG  600
             FDVETALTVLRENYPQHALALA+KH EHSWYLKIQLDRISDTLSDAEHARVADALDYIRG
Sbjct  540   FDVETALTVLRENYPQHALALARKHAEHSWYLKIQLDRISDTLSDAEHARVADALDYIRG  599

Query  601   LSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQ  660
             LSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQ
Sbjct  600   LSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQ  659

Query  661   LRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAV  720
             LR+FLEYIVQVESVSNTSIGNTLLEMVLNDTHKR+VPKDD+ +EPEV EAPSPVTTEAAV
Sbjct  660   LREFLEYIVQVESVSNTSIGNTLLEMVLNDTHKRDVPKDDDSEEPEVHEAPSPVTTEAAV  719

Query  721   LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVK  780
             LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVK
Sbjct  720   LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVK  779

Query  781   QQTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSIL  840
             QQTDSNLWLLALRYFAERGPYPKG+S RSTDEWSELKQLLALVDVTPTLQIPPLQVVSIL
Sbjct  780   QQTDSNLWLLALRYFAERGPYPKGSSVRSTDEWSELKQLLALVDVTPTLQIPPLQVVSIL  839

Query  841   SQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQAT  900
             SQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQM  LSSKAMVFQAT
Sbjct  840   SQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMAGLSSKAMVFQAT  899

Query  901   KCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQ  960
             KCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQ
Sbjct  900   KCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQ  959

Query  961   FFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             FFNQLETAADGFNTIAEYFGKGIFKSEAA+DRRPSGV RFSNEL
Sbjct  960   FFNQLETAADGFNTIAEYFGKGIFKSEAAVDRRPSGVPRFSNEL  1003

>H310_11729
Length=1002

 Score = 1375 bits (3560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/1036 (69%), Positives = 819/1036 (79%), Gaps = 68/1036 (7%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FF+++LLKD NG WLRG+DVT MSGNRGLL++GDA G IH+ANRQLETRAFR
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHLANRQLETRAFR  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+HFVSHV+MMKK N+LVSIGDGKDPRDPDLI++SKAVAEA+RTQAQ DEQ ++ S+ S
Sbjct  61    AHEHFVSHVIMMKKANLLVSIGDGKDPRDPDLIKASKAVAEASRTQAQQDEQ-LFTSSDS  119

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI  180
              + STALVK+WRTDQQDR+GKPKL+ Q+KIF+KF EEAVTAFAVS+D SQIA+GL NGAI
Sbjct  120   -RGSTALVKIWRTDQQDRDGKPKLLQQIKIFSKFAEEAVTAFAVSDDLSQIAIGLLNGAI  178

Query  181   ILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA  240
             ILFRS+ KRR+            Q A   PVT+L FA K             N L LYAA
Sbjct  179   ILFRSDAKRRSDKPPLLL-----QPATQYPVTSLHFATKV------------NILTLYAA  221

Query  241   TKRGLTCYHCDDVKSK----NSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYT  296
             TKRGLTCYHCDD  SK    N+ MPRSVVLDERGVALHCG V++DGDM +GQ+DAVYFYT
Sbjct  222   TKRGLTCYHCDDASSKSNASNNGMPRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYT  281

Query  297   PEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKAL  356
             PE+R+ CFGFEGDKKYLGFFK YLLVAH D RGR+Q+N+YDLQNK IAFNW LTNTAK  
Sbjct  282   PEERSVCFGFEGDKKYLGFFKQYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTAKIG  341

Query  357   PGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKN  416
              G   R            EEIRHVVSEFGAVFV++S G V    E +    +    F K+
Sbjct  342   AGGGGRFGDDA------AEEIRHVVSEFGAVFVLSSLGYVYRLMEIDT-TSKLDILFRKH  394

Query  417   LYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFL  476
             LY IAISLAFSSNYDL+SIMDIFR YGD LY KGD+DGSLRQYARTIG+VEPSYVIR+FL
Sbjct  395   LYSIAISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFL  454

Query  477   DAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSS------  530
             DAQRIHNLTTYLE LH KAFAT+EHTTLLLNCYTKLKDVKKLD+FLLIDD+ ++      
Sbjct  455   DAQRIHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDDEQTTDDAPTT  514

Query  531   --AKEGTPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRI-SDTLSDAE  587
                ++   Q LTFDVETALTVLR+ YP HALALAKKH EHSWYLKIQLDRI S+TLSDA+
Sbjct  515   ADTRKQPKQQLTFDVETALTVLRDYYPTHALALAKKHHEHSWYLKIQLDRIHSETLSDAD  574

Query  588   HARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDP  647
             HARV DAL YI GLSF EA++NLRKYGRTLVTH+PGPTTELL+ LCTGRF  +   K+DP
Sbjct  575   HARVQDALTYIEGLSFTEANLNLRKYGRTLVTHVPGPTTELLKALCTGRFHDSNGEKADP  634

Query  648   GDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPK------DDE  701
              +FLHLFVSHR QLR+FLEYIV VE+V+N  IGNTLLEMVL+D   R  P       D+E
Sbjct  635   ANFLHLFVSHRAQLREFLEYIVHVETVANPQIGNTLLEMVLSDV-GRGGPNAAVDELDEE  693

Query  702   GDEPEV-----TEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKl  756
              DE        T + S    E+AVL+LLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKL
Sbjct  694   HDEGGRAPGGGTASTSAAKNESAVLALLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKL  753

Query  757   hmyhmllqhhmEEGEDAAVLELVKQQTDSN--LWLLALRYFAERGPYPKGASARSTDEWS  814
             HMYHML+QHHMEEG++ AVLE VKQ  +SN  LWLLAL+YF+E+          +   ++
Sbjct  754   HMYHMLVQHHMEEGDNVAVLEQVKQHGESNPNLWLLALKYFSEKKD--------NDPTYT  805

Query  815   ELKQLLALVDVTP-TLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEI  873
              L+ LL+ +D +  +LQIPPLQVV+ILSQ+R++PLSVVR YVV+QLK+DQ HID ++DEI
Sbjct  806   HLQTLLSWMDSSSKSLQIPPLQVVAILSQARDLPLSVVRQYVVNQLKQDQIHIDKENDEI  865

Query  874   KKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERE  933
             KK+KQDTAKMR Q+T LSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISET+RE
Sbjct  866   KKFKQDTAKMRAQLTTLSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETDRE  925

Query  934   CITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGIFK------SE  987
             C+TC PEHRH ++LK SLE KA NHE FFNQLE+A DGFNTIAEYFGKGIFK      ++
Sbjct  926   CMTCGPEHRHFVALKTSLETKASNHELFFNQLESATDGFNTIAEYFGKGIFKADDPMMAQ  985

Query  988   AALDRRPSGVARFSNE  1003
               L    +  ARFSNE
Sbjct  986   LGLGDEHASEARFSNE  1001

>H257_12787
Length=968

 Score = 1372 bits (3551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1015 (70%), Positives = 809/1015 (80%), Gaps = 60/1015 (6%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FF+++LLKD NG WLRG+DVT MSGNRGLL++GDA G IHMANRQLETRAFR
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHMANRQLETRAFR  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AHDHFVSHV+MMKK N+LVSIGDGKDPRDP+LI++SKA+A+A+RTQAQ DEQ   AS   
Sbjct  61    AHDHFVSHVIMMKKANLLVSIGDGKDPRDPELIKASKAIADASRTQAQQDEQLFTASDS-  119

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAKFPEEAVTAFAVSEDASQIAVGLSNGAI  180
              Q STALVK+WRTDQQDR+GKPKL+ Q+KIFAKFPEEAVTAF+VS+D +QIAVGL NGAI
Sbjct  120   -QGSTALVKIWRTDQQDRDGKPKLLQQIKIFAKFPEEAVTAFSVSDDLAQIAVGLLNGAI  178

Query  181   ILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAA  240
             ILFRS+ KRR+            Q A   PVT+L FA K             N   LYAA
Sbjct  179   ILFRSDAKRRSDKPPLLL-----QPATQYPVTSLHFATKL------------NVPTLYAA  221

Query  241   TKRGLTCYHCDDVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDR  300
             TKRGLTCYHCDD  S++  MPRSVVLDERGVALHCG V++DGDM +GQ+DAVYFYTPEDR
Sbjct  222   TKRGLTCYHCDD-SSRSGGMPRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEDR  280

Query  301   TGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTAKALPGAS  360
             + CFGF+GDKKYLGFFK YLLVAH D RGR+Q+N+YDLQNK IAFNW LTNTAK      
Sbjct  281   SVCFGFDGDKKYLGFFKQYLLVAHVDPRGRHQVNLYDLQNKFIAFNWTLTNTAK------  334

Query  361   SRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPI  420
                    RFG +  EEIRHVVSEFGAVFV +S G V    E +    +    F K+LY I
Sbjct  335   GGGGGGGRFGDDAAEEIRHVVSEFGAVFVQSSLGYVYRLLEVDT-TSKLDILFRKHLYSI  393

Query  421   AISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  480
             AISLAFSSNYDL+SIMDIFR YGD LY KGD+DGSLRQYARTIG+VEPSYVIR+FLDAQR
Sbjct  394   AISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQR  453

Query  481   IHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALT  540
             IHNLTTYLE LH KAFAT+EHTTLLLNCYTKLKDVKKLD+FLLIDDD    K    Q LT
Sbjct  454   IHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDDDPKEKK----QPLT  509

Query  541   FDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRI-SDTLSDAEHARVADALDYIR  599
             FDVETALTVLR+NYP HAL LAKKH EHSWYLKIQLDRI S+TLS+++ ARV DAL YI 
Sbjct  510   FDVETALTVLRDNYPTHALTLAKKHHEHSWYLKIQLDRIHSETLSESDQARVLDALTYIE  569

Query  600   GLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRT  659
             GLSF EA++NLRKYGRTLVTH+PGPTTELL+ LCTGRF  +T+ K+DP +FLHLFVSHR 
Sbjct  570   GLSFGEANLNLRKYGRTLVTHVPGPTTELLKALCTGRFHDSTD-KADPANFLHLFVSHRA  628

Query  660   QLRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAA  719
             QLR+FLEYIV VE+V+N  IGNTLLEMVL D  +     +++ ++  +  A    T EAA
Sbjct  629   QLREFLEYIVDVETVANPQIGNTLLEMVLGDVGRSPATAEEDAEDKPIIMA----TNEAA  684

Query  720   VLSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELV  779
             VL+LLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEG+D AVL+ V
Sbjct  685   VLALLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGDDLAVLDQV  744

Query  780   KQQTDSN--LWLLALRYFAERGPYPKGASARSTDEWSELKQLLA-LVDVT-PTLQIPPLQ  835
             KQ  +SN  LWLLAL+YF+++             +   L+ LL+ ++D + P   IPPLQ
Sbjct  745   KQHGESNPNLWLLALKYFSDQ------------KDPGHLQTLLSWMMDTSVPAPPIPPLQ  792

Query  836   VVSILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAM  895
             VV+ILSQ+R++PLSVVRPYVVSQLK+DQAHID +  EIKK++QDTAKMR Q+TALSSKAM
Sbjct  793   VVAILSQARDLPLSVVRPYVVSQLKQDQAHIDKEKGEIKKFQQDTAKMRAQVTALSSKAM  852

Query  896   VFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKA  955
             VFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISET+REC+TC PEHRH ++L+ SL+ KA
Sbjct  853   VFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETDRECMTCGPEHRHFVALQSSLQAKA  912

Query  956   GNHEQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVA-------RFSNE  1003
              NHE FFNQLETA DGFNTIAEYFGKGIFK     D   + VA       RFSNE
Sbjct  913   SNHELFFNQLETATDGFNTIAEYFGKGIFKPVDDDDDDENRVAESVGSNERFSNE  967

>PYIW_14752
Length=1031

 Score = 1237 bits (3200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/1066 (62%), Positives = 785/1066 (74%), Gaps = 97/1066 (9%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD++ LKD NG WL+GVD+T MS NRG++ VGDA G IH+ANRQLETR F+
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+HFVSHVVMMK++N+LVSIGDG D R  +L   SKAVAEA R+    +E  MYAS   
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEE--MYASK-Q  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
                +TA+V++WRTDQQDR+GKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  118   TGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFR+++KRR+            Q A   PVT L F  KP        T+T + ++LYA
Sbjct  178   VILFRTDLKRRSDRPPHLL-----QPAGQYPVTGLEFTSKPV-------TNTASHVFLYA  225

Query  240   ATKRGLTCYHC--DD---VKSKNS--LMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAV  292
             +T+RGLTCYHC  DD   VKS  +  L PR+VVLDERGV  +C CVN++G++ +GQTDAV
Sbjct  226   STRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAV  285

Query  293   YFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNT  352
             YFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LTNT
Sbjct  286   YFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT  345

Query  353   -------AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGH  405
                     + L  A +      RFG +E+EEIRHVV EFGA+FVV+S G V    E++  
Sbjct  346   TTKGSTGGRKLSVAPNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDT-  404

Query  406   RVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGH  465
               + +  F KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGDYDGSLRQYARTIGH
Sbjct  405   TSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGH  464

Query  466   VEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLID  525
             VEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D
Sbjct  465   VEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLD  524

Query  526   D----------------DGSSA---------------------KEGTPQALTFDVETALT  548
             +                +GSS+                     K     AL FD+ETA++
Sbjct  525   EIIDGKKGDLSGDLLIANGSSSGDRKVSHSGQDGLSGGADGGKKRAGAAALNFDIETAIS  584

Query  549   VLRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------LSDAEHARVADALDYIRGL  601
             VL ENYPQHAL LAKKH EHSWYLKIQLDRIS         LS  E  RVADAL+YI+ L
Sbjct  585   VLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHL  644

Query  602   SFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQ  660
             SF+EAD NLRKYGRTLVTHLPGPTTELL+QLCTG+F       KSDPGDFLHLFVSHR Q
Sbjct  645   SFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQ  704

Query  661   LRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAV  720
             L++FL+YIV+VE+VSNTSIGNTLLEMVL+ +       D+   E EV         E AV
Sbjct  705   LKEFLQYIVEVETVSNTSIGNTLLEMVLSGS------ADETRSEEEV---------EDAV  749

Query  721   LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVK  780
             +++LDNPRVKYDEDHALI +QM G+K+GKRYLY KLHMYHML+Q H+EE +D ++++ V+
Sbjct  750   MAILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVR  809

Query  781   Q--QTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVS  838
             +  + D NLW LAL+YFAERGP PKGA+  S +EW ELKQLL L+D  P   IPPLQVV 
Sbjct  810   KHGEKDPNLWSLALKYFAERGPLPKGAT--SGEEWKELKQLLVLIDSNPV--IPPLQVVQ  865

Query  839   ILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQ  898
             +LSQSRE+P+SV++ Y+V+QL  D+  I+ D ++IK +K DT +M+ ++  L  KA+VFQ
Sbjct  866   VLSQSRELPVSVLKQYIVNQLLNDEKKIEEDDEKIKAFKSDTKQMKEEIAQLGGKAVVFQ  925

Query  899   ATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNH  958
             ATKCDLC+HDLDLP VHFMC HSFH NCISETERECITC+ +HRH++ LK  LE KAGNH
Sbjct  926   ATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNH  985

Query  959   EQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             EQFFNQLETAADGF+TIAEYFGKGIFKS        S   RFS E 
Sbjct  986   EQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031

>PYIR_15175
Length=1030

 Score = 1236 bits (3199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1065 (62%), Positives = 789/1065 (74%), Gaps = 96/1065 (9%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD++ LKD NG WL+GVD+T MS NRG++ VGDA G IH+ANRQLETR F+
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITTMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+HFVSHVVMMK++N+LVSIGDG DPR  +L   SKAVAEA R+    +E  MYAS   
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGIDPRSDELRAQSKAVAEAGRSANSAEE--MYASK-Q  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
                +TA+V++WRTDQQDR+GKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  118   TGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFR+++KRR+            Q A   PVT L F  KP        T+T + +YLYA
Sbjct  178   VILFRTDLKRRSDRPPHLL-----QPAGQYPVTGLEFTSKPV-------TNTVSHVYLYA  225

Query  240   ATKRGLTCYHC--DD---VKSKNS--LMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAV  292
             +T+RGLT YHC  DD   VKS  +  L PR+VVLDERGV  +C CVND+G++ +GQTDAV
Sbjct  226   STRRGLTVYHCTHDDPALVKSAGAAGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAV  285

Query  293   YFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNT  352
             YFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LTNT
Sbjct  286   YFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT  345

Query  353   AKALPGASSRNVVA-------TRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGH  405
                 P    +  VA        RFG +E+EEIRHVV EFGA+FVV+S G V    E++  
Sbjct  346   TTKGPVGGRKPPVAPNTRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDT-  404

Query  406   RVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGH  465
               + +  F KNL+ IAISLAFSSNYD++SIMDIFRMYGD LY KGDYDGSLRQYARTIGH
Sbjct  405   TSKLEILFRKNLFSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGH  464

Query  466   VEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLID  525
             VEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D
Sbjct  465   VEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLD  524

Query  526   D------------------------------------DGSSAKEGTPQALTFDVETALTV  549
             +                                    DG     GT  AL FDVETA++V
Sbjct  525   EILDGKKSDLNGDLLIANGNGTAGDKKAKQDGSVGGADGGKKGPGTA-ALNFDVETAISV  583

Query  550   LRENYPQHALALAKKHGEHSWYLKIQLDRI-------SDTLSDAEHARVADALDYIRGLS  602
             L ENYPQHAL LAKKH EHSWYLKIQLDRI       S  LS  E  RVADAL+YI+ LS
Sbjct  584   LWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSAALSAHEKERVADALEYIKHLS  643

Query  603   FAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSA-TTNAKSDPGDFLHLFVSHRTQL  661
             F+EAD NLRKYGRTLVTHLPGPTTELL+QLCTG+F    +  KSDPGDFLHLFVSHR QL
Sbjct  644   FSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQL  703

Query  662   RDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVL  721
             ++FL+YIV+VE+VSNTSIGNTLLEMVL+ +          GDE + +E      TE AV+
Sbjct  704   KEFLQYIVEVETVSNTSIGNTLLEMVLSGS----------GDEEKRSEE----ETEDAVM  749

Query  722   SLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ  781
             ++LDNPRVKYDEDHALI +QM G+K+GKRYLY KLHMYHML+Q H+EE +D ++++ V++
Sbjct  750   AILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRK  809

Query  782   --QTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSI  839
               + D NLW LAL+YFAERGP PKGA+  S +EW ELKQLL L+D  P   IPPLQVV +
Sbjct  810   HGEKDPNLWSLALKYFAERGPLPKGAT--SGEEWKELKQLLVLIDNNPV--IPPLQVVQV  865

Query  840   LSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQA  899
             LSQSRE+P++V++ Y+V+QL  D+  I+ D ++IK +K DT +M+ +++ LS KA+VFQA
Sbjct  866   LSQSRELPVAVLKQYIVNQLLNDEKKIEEDDEKIKAFKSDTKQMKEEISQLSGKAVVFQA  925

Query  900   TKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHE  959
             TKCDLC+HDLDLP VHFMC HSFH NCISETERECITC+ +HRH++ LK  LE KAGNHE
Sbjct  926   TKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKSQLEQKAGNHE  985

Query  960   QFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             QFFNQLETAADGF+TIAEYFGKGIFKS        S   RFSNE 
Sbjct  986   QFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSNEF  1030

>PHYSO_560347
Length=1010

 Score = 1236 bits (3197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/1043 (63%), Positives = 792/1043 (76%), Gaps = 72/1043 (7%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMMK++NVLV+IGDG DPRD +L + SKA+AEA R     + ++MY S  +
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRG---PNAEEMYTSKPT  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
              + STA+V+ WRTDQQDREGKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILF+S++KRRA            Q A   PVT L+F  KP        T+T   ++LYA
Sbjct  177   VILFKSDLKRRADRPPQLL-----QPAGQYPVTGLAFTSKPV-------TATVAHVFLYA  224

Query  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  285   VYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344

Query  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T      +  P A +  V   RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  345   TNPKGPMRKPPLAPNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523

Query  527   --------DGSSAKEGTPQA-------LTFDVETALTVLRENYPQHALALAKKHGEHSWY  571
                      GS + + TP+        L FDVETA++VL ENYPQHAL LAKKH EHSWY
Sbjct  524   VIDAKKTKGGSDSGDLTPRNGGAAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWY  583

Query  572   LKIQLDRISDT-------LSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGP  624
             LKIQLD IS         LSD+E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+PGP
Sbjct  584   LKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPGP  643

Query  625   TTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTL  683
             TTELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGNTL
Sbjct  644   TTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTL  703

Query  684   LEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMH  743
             LEMVL+D        DDEG+      A S    E AVL +LDNPRVKYDEDHALI +QMH
Sbjct  704   LEMVLSD--------DDEGE----NGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMH  751

Query  744   GLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERGPY  801
             G+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++    D NLW LAL+YFAERGP 
Sbjct  752   GMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPL  811

Query  802   PKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKK  861
             PKGA+  S +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  
Sbjct  812   PKGAT--SGEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLAN  867

Query  862   DQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHS  921
             D+  I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HS
Sbjct  868   DEKKIEEDEEKIKAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHS  927

Query  922   FHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGK  981
             FH NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGK
Sbjct  928   FHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGK  987

Query  982   GIFKSEAALDRRPSGVARFSNEL  1004
             GIFKS   +    S   RFS E 
Sbjct  988   GIFKSNEVVLDEGSFETRFSAEF  1010

>PYU1_G005966
Length=1030

 Score = 1233 bits (3190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1065 (63%), Positives = 797/1065 (75%), Gaps = 96/1065 (9%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD++ LKDGNG WL+GVD+T MS NRG++ VGD  G IH+ANRQLETR F+
Sbjct  1     MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH++FVSHVVMMK++N+LVSIGDG DPR  +L   SKAVA+A R+    +E  M+AS  +
Sbjct  61    AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSANSAEE--MFASKQT  118

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
              + +TA+V++WRTDQQDR+GKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ+AVGL NGA
Sbjct  119   GK-TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGA  177

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFR+++KRR+            Q A   PVT L F  KP        T+T + ++LYA
Sbjct  178   VILFRTDLKRRSDRPPHLL-----QPAGQYPVTGLEFTSKPV-------TNTVSHVFLYA  225

Query  240   ATKRGLTCYHC--DD---VKSKNS--LMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAV  292
             +T+RGLTCYHC  DD   VKS  +  L PR+VVLDERGV  +C CVND+G++ +GQTDAV
Sbjct  226   STRRGLTCYHCTHDDPALVKSAGASGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAV  285

Query  293   YFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNT  352
             YFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LTNT
Sbjct  286   YFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT  345

Query  353   AKALPGASSRNVVA-------TRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGH  405
                 P    +  +A        RFG +E+EEIRHVV EFGA+FVV+S G V    E++  
Sbjct  346   TSKGPAGGRKPPIAPNSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDT-  404

Query  406   RVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGH  465
               + +  F KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGDYDGSLRQYARTIGH
Sbjct  405   TSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGH  464

Query  466   VEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLID  525
             VEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D
Sbjct  465   VEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLD  524

Query  526   D--DG----------------------------SSAKEGTPQ------ALTFDVETALTV  549
             +  DG                            SSA   T Q      AL FDVETA++V
Sbjct  525   EIVDGKKNDLSGGDALSAVNGTGAAGDKLAKRDSSAGAETAQKGPGTAALNFDVETAISV  584

Query  550   LRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------LSDAEHARVADALDYIRGLS  602
             L ENYPQHAL LAKKH EHSWYLKIQLDRIS         LS  E  RVADAL+YI+ LS
Sbjct  585   LWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSTHEKERVADALEYIKHLS  644

Query  603   FAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSA-TTNAKSDPGDFLHLFVSHRTQL  661
             F+EAD NLRKYGRTLVTHLP PTTELL+QLCTG+F    +  KSDPGDFLHLFVSHR QL
Sbjct  645   FSEADSNLRKYGRTLVTHLPEPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQL  704

Query  662   RDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVL  721
             ++FL+YIV+VE+VSNTSIGNTLLEMVL++T       D++  E EV         E AV+
Sbjct  705   KEFLQYIVEVETVSNTSIGNTLLEMVLSET------ADEKRTEEEV---------EDAVM  749

Query  722   SLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ  781
             ++LDNPRVKYDEDHALI +QM G+K+GKRYLY KLHMYHML+Q H+EE +D ++++ V++
Sbjct  750   AILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRK  809

Query  782   --QTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSI  839
               + D NLW LAL+YFAERGP PKGA+  + +EW ELKQLLAL+D  P   IPPLQVV +
Sbjct  810   HGEKDPNLWSLALKYFAERGPLPKGAT--TGEEWRELKQLLALIDSNPV--IPPLQVVQV  865

Query  840   LSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQA  899
             LSQSRE+P+SV++ Y+V+QL  D+  I+ D ++IK +K DT +M+ ++T LS KA+VFQA
Sbjct  866   LSQSRELPVSVLKQYIVNQLLNDEKKIEEDEEKIKAFKSDTKQMKEEITQLSGKAVVFQA  925

Query  900   TKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHE  959
             TKCDLC+HDLDLP VHFMC HSFH NCISETERECITC+ +HRH++ LK  LE KAGNHE
Sbjct  926   TKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHE  985

Query  960   QFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             QFFNQLETAADGF+TIAEYFGKGIFKS        S  ARFSNE 
Sbjct  986   QFFNQLETAADGFHTIAEYFGKGIFKSNEVPIDDGSFDARFSNEF  1030

>PHYCA_570034
Length=1011

 Score = 1232 bits (3188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/1044 (63%), Positives = 793/1044 (76%), Gaps = 73/1044 (7%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMMK++NVLV+IGDG DPR  +L + SKA+AEA RT    + ++MY S  +
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPEELREQSKAIAEAGRT---PNAEEMYTSKPT  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
              + STA+V+ WRTDQQDREGKPKL+ Q+ IFAK +PEEAVTAFAV++D +Q AVGL NGA
Sbjct  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLTQFAVGLKNGA  176

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFRS++KRR             Q A   PVT LSFA KP        T+T + ++LYA
Sbjct  177   VILFRSDLKRRTDRPPHLL-----QPAGQYPVTGLSFASKPV-------TATVSHVFLYA  224

Query  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDVNCSCVNEEGEIAVGQTDA  284

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CFGFEG+K+YL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  285   VYFYTTEDRSVCFGFEGEKRYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344

Query  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G +    E++   
Sbjct  345   TNPKGPMRKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHIYRLSEKDT-T  403

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523

Query  527   ----------DGSSAKEGTPQA------LTFDVETALTVLRENYPQHALALAKKHGEHSW  570
                        GS + + TP+       L FDVETA++VL ENYPQHAL LAKKH EHSW
Sbjct  524   VIDAKKNGTKSGSDSGDLTPRNGGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSW  583

Query  571   YLKIQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPG  623
             YLKIQLD IS         LS++E  RVADAL+YI  LSF+EAD NLRKYGRTLVTHLPG
Sbjct  584   YLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHLPG  643

Query  624   PTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNT  682
             PTTELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGNT
Sbjct  644   PTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNT  703

Query  683   LLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQM  742
             LLEMVL+D        DD+G+        S    E AVL +LDNPRVKYDEDHALI +QM
Sbjct  704   LLEMVLSD--------DDDGE----NGTRSVEEKEEAVLRILDNPRVKYDEDHALIHLQM  751

Query  743   HGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGP  800
             HG+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAERGP
Sbjct  752   HGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGP  811

Query  801   YPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLK  860
              PKGA+    +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL 
Sbjct  812   LPKGATG--GEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLA  867

Query  861   KDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGH  920
              D+  I+ D ++IK +K DT +M+ ++T LSS+A+VFQATKCDLC+HDLDLP VHFMC H
Sbjct  868   SDEKKIEEDEEKIKAFKGDTKQMKEEITQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQH  927

Query  921   SFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFG  980
             SFH NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFG
Sbjct  928   SFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFG  987

Query  981   KGIFKSEAALDRRPSGVARFSNEL  1004
             KGIFKS   +    S   RFS E 
Sbjct  988   KGIFKSNEVVLDEGSFETRFSAEF  1011

>PHALS_11566
Length=1009

 Score = 1229 bits (3181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1042 (62%), Positives = 778/1042 (75%), Gaps = 71/1042 (7%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +++ANR +E R F+
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGSVYLANRSMEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMMK++NVLV+IGDG DPR  +L + SK +AEA R     D   MY +  +
Sbjct  61    AHEMFVSHVVMMKRSNVLVTIGDGIDPRSEELREQSKVIAEAGRAPNAED---MYTAKPT  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
              + STA+V+ WRTDQQDREGKPKL+ Q+ IFAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  118   GK-STAIVRFWRTDQQDREGKPKLMQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFRS++KRRA            Q A   PVT L+F  KP        T T + ++LYA
Sbjct  177   VILFRSDLKRRADRPPHLL-----QPAGQYPVTGLAFTSKPV-------TVTLSHVFLYA  224

Query  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  225   STGRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVEMNCSCVNEEGEIAVGQTDA  284

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CFGFEG+KK++ FFKHYL+VAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  285   VYFYTTEDRSVCFGFEGEKKFVCFFKHYLIVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344

Query  352   TA-----KALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T+     +  P + +      RFG +E+EEIRHVV EFGA+FVV+S G V    E++   
Sbjct  345   TSSKGPIRKAPLSLNARAPGARFGIDEMEEIRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDV+KLD F+ +D+
Sbjct  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVQKLDKFIQLDE  523

Query  527   --DGSSAKE------------GTPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYL  572
               D    K             G    L FDVETA++VL ENYPQHAL LAKKH EHSWYL
Sbjct  524   VIDAKKTKTDRNSGDLMLRNGGATANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYL  583

Query  573   KIQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPT  625
             KIQLD IS         LS++E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+P PT
Sbjct  584   KIQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPT  643

Query  626   TELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLL  684
             TELL++LCTG+F  +  + KSDPGDFLHLFVSHR QL++FL+YIV+VE++SNTSIGNTLL
Sbjct  644   TELLKRLCTGKFVPSNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETISNTSIGNTLL  703

Query  685   EMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHG  744
             EMVL+D        DDEG+        S    E AVL +LDNPRVKYDEDHALI +QMH 
Sbjct  704   EMVLSD--------DDEGE----NGLRSVEEKEDAVLRILDNPRVKYDEDHALIHLQMHS  751

Query  745   LKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGPYP  802
             +K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAERGP P
Sbjct  752   MKKGKRYLYNKLHMYHMLVQFHIEESDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLP  811

Query  803   KGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKD  862
             KGA     +EW ELKQLL L+D  P   IPPLQVV +LSQSRE+P+SV++ YVVSQL  D
Sbjct  812   KGAI--DGEEWKELKQLLVLIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVSQLAND  867

Query  863   QAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSF  922
             +  I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSF
Sbjct  868   EKKIEEDEEKIKAFKSDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSF  927

Query  923   HQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKG  982
             H NCISET+REC+TC+ +HRH+L LK  LE KAGNHEQF+NQLETA DGF+TIAEYFGKG
Sbjct  928   HLNCISETDRECLTCSMDHRHILGLKSQLEQKAGNHEQFYNQLETAVDGFHTIAEYFGKG  987

Query  983   IFKSEAALDRRPSGVARFSNEL  1004
             IFKS   +    S   RFS E 
Sbjct  988   IFKSNEVVLDEGSFETRFSAEF  1009

>PPTG_09255
Length=1008

 Score = 1229 bits (3181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/1041 (63%), Positives = 788/1041 (76%), Gaps = 70/1041 (7%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMMK++NVLV+IGDG DPR  +L + SKA+AEA R+    + ++MY S  S
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRS---PNAEEMYTSKPS  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
              + STA+V+ WRTDQQDREGKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFRS++KRRA            Q A   PVT LSF  KP        T+T + ++LYA
Sbjct  177   VILFRSDLKRRADRPPHLL-----QPAGQYPVTGLSFTSKPV-------TATVSHVFLYA  224

Query  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  285   VYFYTTEDRSVCFGFEGEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344

Query  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  345   TNPKGPMRKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLID-  525
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D 
Sbjct  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523

Query  526   -----------DDGS-SAKEGTPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYLK  573
                        D G  + + G    L FDVETA++VL ENYPQHAL LAKKH EHSWYLK
Sbjct  524   VIDAKKTKSDSDSGDLTPRNGAAANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLK  583

Query  574   IQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTT  626
             IQLD IS         LS++E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+P PTT
Sbjct  584   IQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTT  643

Query  627   ELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLLE  685
             ELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGNTLLE
Sbjct  644   ELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLE  703

Query  686   MVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGL  745
             MVL+D        ++EG    V E       E AVL +LDNPRVKYDEDHALI +QMHG+
Sbjct  704   MVLSDD------DEEEGGTRSVEE------KEEAVLRILDNPRVKYDEDHALIHLQMHGM  751

Query  746   KQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGPYPK  803
             K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAERGP PK
Sbjct  752   KKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPK  811

Query  804   GASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQ  863
             GA+    +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  D+
Sbjct  812   GATG--GEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLASDE  867

Query  864   AHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFH  923
               I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH
Sbjct  868   KKIEEDEEKIKAFKGDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFH  927

Query  924   QNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGI  983
              NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGKGI
Sbjct  928   LNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGI  987

Query  984   FKSEAALDRRPSGVARFSNEL  1004
             FKS   +    S   RFS E 
Sbjct  988   FKSNEVVLDEGSFETRFSAEF  1008

>PYVX_13921
Length=1041

 Score = 1227 bits (3175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/1073 (61%), Positives = 786/1073 (73%), Gaps = 101/1073 (9%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLR-----------------GVDVTCMSGNRGLLIVGDA  43
             MAQWRRF FFD+++LKD NG W++                 GVD+T MS NRG++ VGDA
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKSLDANFFRRLVVPDAIQGVDITSMSANRGMICVGDA  60

Query  44    QGQIHMANRQLETRAFRAHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEAN  103
              G +H+ANRQLE R F+AH++FVSHVVMMK++NVLV++GDG DPR  +L   SKA+AEA 
Sbjct  61    DGFVHLANRQLEARKFQAHENFVSHVVMMKRSNVLVTVGDGIDPRSEELKAQSKAIAEAG  120

Query  104   RTQAQTDEQQMYASTGSVQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAF  162
             R+    + ++M+    S + STA+V+ WRTDQQDR+GKPKL+ Q+ IFAK +PEEAVTAF
Sbjct  121   RS---GNAEEMFTPKQSGK-STAVVRFWRTDQQDRDGKPKLLQQVPIFAKKYPEEAVTAF  176

Query  163   AVSEDASQIAVGLSNGAIILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKP  222
             AV +D SQ AVGL NGA+ILFRS++KRR+            Q A   PVT L+F  KP  
Sbjct  177   AVHDDVSQFAVGLKNGAVILFRSDLKRRSDRPPHLL-----QPAGQYPVTGLAFTSKPI-  230

Query  223   AAGPGKTSTENALYLYAATKRGLTCYHC--DD-----VKSKNSLMPRSVVLDERGVALHC  275
                   T+T + ++LYA+T+RGLTCYHC  DD           + PR+VVLDERGV + C
Sbjct  231   ------TATVSHVFLYASTRRGLTCYHCTHDDPAVTKAAGAAGMPPRTVVLDERGVDMSC  284

Query  276   GCVNDDGDMCMGQTDAVYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNI  335
              CVND+G++ +GQTDAVYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+
Sbjct  285   SCVNDEGELAVGQTDAVYFYTTEDRSVCFGFEGEKKYLSFFKHYLLVAHVDPRGRHQVNV  344

Query  336   YDLQNKCIAFNWILTNTAKALPGASSRNVVA--------------TRFGYEEVEEIRHVV  381
             YDLQNK IAFNW LT+T     G + R  +A               RFG +E+EEIRHVV
Sbjct  345   YDLQNKFIAFNWTLTSTNSNAKGGARRPPLAPNARXXXXXXXXXGARFGLDEMEEIRHVV  404

Query  382   SEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRM  441
              EFGA+FVV+S G V    E++    + +  F KNLY IAISLAFSSNYD++SIMDIFRM
Sbjct  405   CEFGAIFVVSSVGHVYRLSEKDT-TSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRM  463

Query  442   YGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEH  501
             YGD LY KGD+DGSLRQY RTIGHVEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEH
Sbjct  464   YGDHLYQKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEH  523

Query  502   TTLLLNCYTKLKDVKKLDAFLLIDDDGSSAK--------------------EGTPQALTF  541
             TTLLLNCYTKLKDVKKLD F+ +D+   S+K                    +G      F
Sbjct  524   TTLLLNCYTKLKDVKKLDKFIQLDEVIDSSKKAADRNSIAKLPRSSDETGLDGKRDNPNF  583

Query  542   DVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------LSDAEHARVADA  594
             DVETA++VL ENYP+HAL LAKK+ EHSWYLKIQLDRIS         LSD E  RV DA
Sbjct  584   DVETAISVLWENYPKHALTLAKKYEEHSWYLKIQLDRISYVESEDSVALSDHEKERVTDA  643

Query  595   LDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRF-SATTNAKSDPGDFLHL  653
             L+YI+ LSF+EAD NLRKYGRTLVTHLPGPTTELL+QLCTG+F    ++ KSDPGDFLHL
Sbjct  644   LEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNSSLKSDPGDFLHL  703

Query  654   FVSHRTQLRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSP  713
             FVSHR QL++FL+YIV+VE+V+NTSIGNTLLEMVL+D       +D EG  P      + 
Sbjct  704   FVSHRAQLKEFLQYIVEVETVTNTSIGNTLLEMVLSDD-----SEDAEGSAPR-----TD  753

Query  714   VTTEAAVLSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDA  773
                E AV+ +LDNPRVKYDEDHALI +QMHG+K+GKRYLY KLHMYHML+Q H+EE +D 
Sbjct  754   AEKEDAVMLILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQ  813

Query  774   AVLELVKQ--QTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQI  831
             ++++ V++  + D NLW LAL+YFAERGP PKGA+  S +EW ELKQLLAL+D  P   I
Sbjct  814   SIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGAT--SGEEWKELKQLLALIDTNPV--I  869

Query  832   PPLQVVSILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALS  891
             PPLQVV +LSQSRE+P+SVV+ Y+V+QL  D+  I  D ++IK +K DT +M+ +++ LS
Sbjct  870   PPLQVVQVLSQSRELPVSVVKQYIVNQLANDERKIAEDEEKIKAFKGDTKQMKEEISQLS  929

Query  892   SKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSL  951
             SKA+VFQATKCDLC+HDLDLP VHFMC HSFH NCISETEREC+TC+ +HRH++ LK  L
Sbjct  930   SKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECMTCSLDHRHIMGLKTQL  989

Query  952   EVKAGNHEQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             E KAGNHEQF+NQLETAADGFNTIAEYFGKGIFKS    D   S   RFS E 
Sbjct  990   EQKAGNHEQFYNQLETAADGFNTIAEYFGKGIFKSNEVAD-DGSFETRFSAEF  1041

>PITG_13745
Length=1008

 Score = 1226 bits (3171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/1041 (63%), Positives = 788/1041 (76%), Gaps = 70/1041 (7%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD NG W++GVDVT MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMMK++NVLV+IGDG DPR  +L + SKA+AEA R     + ++MY S  +
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRA---PNAEEMYTSKPA  117

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
              + STA+V+ WRTDQQDREGKPKL+ Q+ IFAK +PEEAVTAFA ++D SQ AVGL NGA
Sbjct  118   GK-STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGA  176

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFRS++KRR             Q A   PVT LSF  KP        T+T + ++LYA
Sbjct  177   VILFRSDLKRRTDRPPQLL-----QPAGQYPVTGLSFTSKPV-------TATVSHVFLYA  224

Query  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  225   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CFGFEG+KK+L FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  285   VYFYTTEDRSVCFGFEGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  344

Query  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  345   TNPKGPMRKPPLASNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  404   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  464   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523

Query  527   --------DGSSAKEGTPQA-----LTFDVETALTVLRENYPQHALALAKKHGEHSWYLK  573
                       S + E TP+      L FDVETA++VL ENYPQHAL LAKKH EHSWYLK
Sbjct  524   VIDAKKTKTDSDSGELTPRNGAVANLNFDVETAISVLWENYPQHALTLAKKHEEHSWYLK  583

Query  574   IQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTT  626
             IQLD IS         LS++E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH+P PTT
Sbjct  584   IQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKYGRTLVTHMPAPTT  643

Query  627   ELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLLE  685
             ELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIGNTLLE
Sbjct  644   ELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLE  703

Query  686   MVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGL  745
             MVL+D        DDEG+  +     S    E AVL +LDNPRVKYDEDHALI +QMHG+
Sbjct  704   MVLSD--------DDEGENGK----RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGM  751

Query  746   KQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGPYPK  803
             K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAERGP PK
Sbjct  752   KRGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLPK  811

Query  804   GASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQ  863
             GA+    +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+QL  D+
Sbjct  812   GATG--GEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVNQLASDE  867

Query  864   AHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFH  923
               I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFMC HSFH
Sbjct  868   KKIEEDEEKIKAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFH  927

Query  924   QNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGI  983
              NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAEYFGKGI
Sbjct  928   LNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGI  987

Query  984   FKSEAALDRRPSGVARFSNEL  1004
             FKS   +    S   RFS E 
Sbjct  988   FKSNEVVLDEGSFETRFSAEF  1008

>HYAP_08497
Length=1007

 Score = 1197 bits (3097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/1046 (61%), Positives = 772/1046 (74%), Gaps = 81/1046 (8%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMMK++NVL +IGDG DPR  +L + SKA+AEA R  A   E+     TG 
Sbjct  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGR--APNAEE----PTG-  113

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
                STA+V+ WRTD QDREGKPKL+ Q+ IFAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  114   --KSTAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  171

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFRS++KRR    S        Q A   PVT LSF  KP        T+T   ++LYA
Sbjct  172   VILFRSDLKRRTDRPSHLL-----QPAGQYPVTGLSFISKPV-------TATSVHVFLYA  219

Query  240   ATKRGLTCYHC--DD------VKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T+RGLTCYHC  DD      V    +L PR+ VLDERGV ++C CVN++ ++ +GQTDA
Sbjct  220   STRRGLTCYHCSHDDPALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDA  279

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CF FEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  280   VYFYTTEDRSVCFAFEGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTS  339

Query  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  340   TNPKGPMRKPPLASNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  398

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  399   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  458

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYT---------------K  511
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYT               +
Sbjct  459   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  518

Query  512   LKDVKKLDAFLLIDDDGS--SAKEGTPQA-LTFDVETALTVLRENYPQHALALAKKHGEH  568
             + D KK +    ID+D S  + K+G   A L FDVETA++VL ENYPQHAL LA+KH EH
Sbjct  519   VIDAKKTNG-TKIDNDASDLALKDGGGAANLNFDVETAISVLWENYPQHALTLARKHEEH  577

Query  569   SWYLKIQLDRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHL  621
             SWYLKIQL +IS         LS++E  RVADAL+YI+ LSF+EAD NLRKYGRTLVTH+
Sbjct  578   SWYLKIQLGQISYVDSEDSAALSESEKERVADALEYIQHLSFSEADSNLRKYGRTLVTHM  637

Query  622   PGPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIG  680
             PGP TELL++LCTG++     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSIG
Sbjct  638   PGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIG  697

Query  681   NTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILM  740
             NTLLEMVL+D        DDEG+        S    E +VL +LDNPRVKYDEDHALI +
Sbjct  698   NTLLEMVLSD--------DDEGE----NGGRSVEEKEESVLRILDNPRVKYDEDHALIHL  745

Query  741   QMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQQ--TDSNLWLLALRYFAER  798
             QM G+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++    D NLW LAL+YFAER
Sbjct  746   QMRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAER  805

Query  799   GPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQ  858
             GP PKGA+  S  EW EL+QLL L+D      IPPLQVV +LSQSRE+P+SV++ YVV+Q
Sbjct  806   GPLPKGAT--SGKEWEELQQLLVLIDTNSA--IPPLQVVQVLSQSRELPVSVIKQYVVNQ  861

Query  859   LKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMC  918
             L  D+  I+ D ++IK ++ DT +M+ ++  LSS+A+VFQATKCDLCSHDLDLP VHFMC
Sbjct  862   LASDEKKIEEDEEKIKAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMC  921

Query  919   GHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEY  978
              HSFH NCISET+RECI+C+ +HRH+L LK  LE KAGNHEQF+NQLETAADGFNTIAEY
Sbjct  922   QHSFHLNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEY  981

Query  979   FGKGIFKSEAALDRRPSGVARFSNEL  1004
             FGKGIFKS   +    S   RFS E 
Sbjct  982   FGKGIFKSNEVVLDEGSFETRFSAEF  1007

>CCA17991
Length=965

 Score = 1170 bits (3026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/987 (60%), Positives = 746/987 (76%), Gaps = 73/987 (7%)

Query  31   MSGNRGLLIVGDAQGQIHMANRQLETRAFRAHDHFVSHVVMMKKTNVLVSIGDGKDPRDP  90
            MS NRGL+  GDA+G IH++N QLE R F+AH+HFVS +VMMK++N+LVS+GDG DPR P
Sbjct  1    MSANRGLICAGDAEGYIHLSNSQLEVRKFQAHNHFVSQIVMMKRSNILVSVGDGIDPR-P  59

Query  91   DLIQSSKAVAEANRTQAQTDEQQMYASTGSVQNSTALVKMWRTDQQDREGKPKLILQLKI  150
             +I + KA  + N ++A  D +           STA++++WRTDQQDREGKPK++ Q+++
Sbjct  60   SMIHAEKADVDINSSKAAGDSE-----------STAMIRIWRTDQQDREGKPKMLQQIQV  108

Query  151  FAK-FPEEAVTAFAVSEDASQIAVGLSNGAIILFRSEMKRRApgmsgggpplllQSAINS  209
            FAK FPEEAVTAFAVS+D SQ +VGL NGA+IL+RS+ + R   +         Q A   
Sbjct  109  FAKRFPEEAVTAFAVSDDVSQWSVGLKNGAVILYRSDSRFRVERIDPILL----QPAGQH  164

Query  210  PVTNLSFAMKPKPAAGPGKTSTENALYLYAATKRGLTCYHC--DD---VKS--KNSLMPR  262
            PVT L+F  KP        T++ N ++LYA+T+RGLTCYHC  DD   VK+   + + PR
Sbjct  165  PVTGLAFTTKPI-------TNSLNHVFLYASTRRGLTCYHCNQDDQYIVKAVGASRMPPR  217

Query  263  SVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDRTGCFGFEGDKKYLGFFKHYLLV  322
             V LDERGV  HC CVNDDG++ +GQ DAVYFYT +D++ CF F+G+KKYL FFK YL+V
Sbjct  218  CVTLDERGVDFHCSCVNDDGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIV  277

Query  323  AHADSRGRNQLNIYDLQNKCIAFNWILTNT-----------AKALPGASSRNVVATRFGY  371
            AH DSRGR+Q+N+YDLQNK IAFNW LT++           A A  G  S+   ++RFG 
Sbjct  278  AHVDSRGRHQVNVYDLQNKFIAFNWTLTHSVPSESSPNVSKATAARGKQSQPNPSSRFGL  337

Query  372  EEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPIAISLAFSSNYD  431
            + +E+I+H+VSEFG++FVV+S G V    E++    + +  F KNLY IAISLAFSSNYD
Sbjct  338  DRMEQIQHIVSEFGSIFVVSSAGHVYRLTEKDT-TSKLEILFRKNLYSIAISLAFSSNYD  396

Query  432  LSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETL  491
            ++SI+DIFRMYGD LY KGDYDGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLE L
Sbjct  397  INSIVDIFRMYGDHLYQKGDYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEAL  456

Query  492  HTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALTFDVETALTVLR  551
            H KAFA AEHTTLLLNC+TKLKDVKKLDAF+ ++D G++AK G   +L FDVETA++VL 
Sbjct  457  HEKAFANAEHTTLLLNCFTKLKDVKKLDAFIQLED-GNAAKAGGQTSLNFDVETAISVLW  515

Query  552  ENYPQHALALAKKHGEHSWYLKIQLDRIS-------DTLSDAEHARVADALDYIRGLSFA  604
            E YPQHAL LA+KH EHSWYLKIQLD+IS        TLS AE  RV DAL+YI+ LSFA
Sbjct  516  EMYPQHALTLARKHEEHSWYLKIQLDQISYVDSDGSTTLSSAEKERVIDALEYIKHLSFA  575

Query  605  EADMNLRKYGRTLVTHLPGPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRD  663
            EAD NLRKYGRTLVTHLPGPTTELL++LCTG+F       KSDP DFLHLFVSHR QLR+
Sbjct  576  EADANLRKYGRTLVTHLPGPTTELLKRLCTGKFVPEKPELKSDPADFLHLFVSHRAQLRE  635

Query  664  FLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSL  723
            FL+YIV+VE++++ SIGNTLLEMVL D          EG E    E+PS    E AV+++
Sbjct  636  FLQYIVEVETITDPSIGNTLLEMVLTD----------EGSE----ESPSADMKEDAVMAI  681

Query  724  LDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQQ-  782
            LDNPRV+YDEDHALI +QMHG+++GKRYL+ KLHMYHML+QHH+EE +D +++E V++  
Sbjct  682  LDNPRVRYDEDHALIHLQMHGMRKGKRYLFNKLHMYHMLVQHHIEEHDDQSIIEEVRKHG  741

Query  783  -TDSNLWLLALRYFAERGPYPKGASAR---STDEWSELKQLLALVDVTPTLQIPPLQVVS  838
              D NLW LAL+YFAERGP PK  S     S +EW EL+QLL ++D  P   IPPLQVV 
Sbjct  742  DKDPNLWSLALKYFAERGPLPKYVSKSGNASNEEWKELRQLLIMIDTNPV--IPPLQVVQ  799

Query  839  ILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQ  898
            +LSQ+R++PLSV++PY+++QL  +Q  +D D ++I+ +K DT +M+ ++  L+SKA+VFQ
Sbjct  800  VLSQARDLPLSVIKPYILNQLSHNQELVDNDEEKIRAFKADTRQMKEEIAQLNSKAIVFQ  859

Query  899  ATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNH  958
            ATKCDLC+HDLDLP VHFMC HSFH NCISET+REC+TC+ EHRH+L LK  LE KAGNH
Sbjct  860  ATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECMTCSVEHRHILGLKTQLEQKAGNH  919

Query  959  EQFFNQLETAADGFNTIAEYFGKGIFK  985
            EQF+NQLET+ DGF TIAEYFGKGIFK
Sbjct  920  EQFYNQLETSMDGFETIAEYFGKGIFK  946

>PHYRA_81678
Length=975

 Score = 1165 bits (3014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/1047 (61%), Positives = 759/1047 (72%), Gaps = 115/1047 (11%)

Query  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
             MAQWRRF FFD+++LKD +G W++GVD+T MS NRGL+ VGDA G +H+ANR LE R F+
Sbjct  1     MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
             AH+ FVSHVVMM                      +SK   +                   
Sbjct  61    AHELFVSHVVMM---------------------YTSKPTGK-------------------  80

Query  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
                +TA+V+ WRTDQQDREGKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  81    ---TTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  137

Query  180   IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
             +ILFRS++KRR             Q A   PVT L F  KP        T+T   ++LYA
Sbjct  138   VILFRSDLKRRTDRPPHLL-----QPAGQYPVTGLEFTSKPV-------TATVAHVFLYA  185

Query  240   ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
             +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  186   STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  245

Query  292   VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
             VYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LT+
Sbjct  246   VYFYTTEDRSVCFGFEGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTS  305

Query  352   T-----AKALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
             T      +  P AS+      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  306   TNPKGPMRKPPLASNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  364

Query  407   VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
              + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGD+DGSLRQY RTIGHV
Sbjct  365   SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRTIGHV  424

Query  467   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  425   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  484

Query  527   -----------DGSSAKEGTPQA--------LTFDVETALTVLRENYPQHALALAKKHGE  567
                         GS + + TP+         L FDVETA++VL ENYPQHAL LAKKH E
Sbjct  485   VIDARKANGTKSGSDSGDTTPRNGGGGAAANLNFDVETAISVLWENYPQHALTLAKKHEE  544

Query  568   HSWYLKIQLDRISDT-------LSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTH  620
             HSWYLKIQLD IS         LS+ E  RVADAL+YI  LSF+EAD NLRKYGRTLVTH
Sbjct  545   HSWYLKIQLDHISYVDSEDSVALSENEKERVADALEYIEHLSFSEADSNLRKYGRTLVTH  604

Query  621   LPGPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSI  679
             +PGPTTELL++LCTG+F     + KSDPGDFLHLFVSHR QL++FL+YIV+VE+VSNTSI
Sbjct  605   MPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSI  664

Query  680   GNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALIL  739
             GNTLLEMVL+D        DDEG+      A S    E AVL +LDNPRVKYDEDHALI 
Sbjct  665   GNTLLEMVLSD--------DDEGE----NGARSIEEKEEAVLRILDNPRVKYDEDHALIH  712

Query  740   MQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQ--QTDSNLWLLALRYFAE  797
             +QMHG+K+GKRYLY KLHMYHML+Q H+EE +D ++LE V++  + D NLW LAL+YFAE
Sbjct  713   LQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDLNLWSLALKYFAE  772

Query  798   RGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVS  857
             RGP PKGA+  S +EW ELKQLLAL+D  P   IPPLQVV +LSQSRE+P+SV++ YVV+
Sbjct  773   RGPLPKGAT--SGEEWKELKQLLALIDTNPA--IPPLQVVQVLSQSRELPVSVIKQYVVN  828

Query  858   QLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFM  917
             QL  D+  I+ D ++IK +K DT +M+ ++  LSS+A+VFQATKCDLC+HDLDLP VHFM
Sbjct  829   QLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFM  888

Query  918   CGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAE  977
             C HSFH NCISET+RECITC+ +HRH+L LK  LE KAGNHEQF+NQLETAADGF+TIAE
Sbjct  889   CQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAE  948

Query  978   YFGKGIFKSEAALDRRPSGVARFSNEL  1004
             YFGKGIFKS   +    S   RFS E 
Sbjct  949   YFGKGIFKSNEVVLDEGSFETRFSAEF  975

>PYAP_24883
Length=980

 Score = 1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/1024 (59%), Positives = 743/1024 (73%), Gaps = 94/1024 (9%)

Query  31    MSGNRGLLIVGDAQGQIHMANRQLETRAFRAHDHFVSHVVMMKKTNVLVSIGDGKDPRDP  90
             MS NRG+L VGDA G +H+ANRQLE R FRAH+HFVSH+VMMK++NVLV+IGDG DPR  
Sbjct  1     MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD  60

Query  91    DLIQSSKAVAEANRTQAQTDE-----QQMYASTGSVQNSTALVKMWRTDQQDREGKPKLI  145
             +L + S+A+AEA R              M+  +     STA+V++WRTDQQDR+G+PKL+
Sbjct  61    ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL  120

Query  146   LQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGAIILFRSEMKRRApgmsgggpplllQ  204
              Q+ +FAK +PEEAVTAFAVS+D  Q AVGL NGA+ILFR ++KRRA            Q
Sbjct  121   QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLL-----Q  175

Query  205   SAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYAATKRGLTCYHC--DD---VKSKNS-  258
              A   PVT LSF  KP        ++T   ++LYA+T+RGLTCYHC  DD   VK+  + 
Sbjct  176   PAGQFPVTGLSFTSKPI-------SNTVAHVFLYASTRRGLTCYHCNHDDPALVKAAGAA  228

Query  259   -LMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAVYFYTPEDRTGCFGFEGDKKYLGFFK  317
              L  R+VVLDERGV  HC CVND+G++ +GQ DAVYFY  EDR+ CFGFEG+KKYL FFK
Sbjct  229   GLPSRTVVLDERGVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFK  288

Query  318   HYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNTA------KALPGASSRNVVATRFGY  371
             HYLLVAH D RGR+Q+N+YDLQNK IAFNW LT TA      +  P  ++      RFG 
Sbjct  289   HYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQTASRNGGMRRPPLPTNNRAPGARFGL  348

Query  372   EEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHRVQAQHSFDKNLYPIAISLAFSSNYD  431
             +++EEIRHVV     V+ +T   +            + +  F KNLY IAISLAFSSNYD
Sbjct  349   DDMEEIRHVVC---CVYRLTEKDTTS----------KLEILFRKNLYSIAISLAFSSNYD  395

Query  432   LSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETL  491
             ++SIMDIFRMYGD LY KGD+DGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLT YLE L
Sbjct  396   INSIMDIFRMYGDHLYEKGDFDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEAL  455

Query  492   HTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDDD-----------------GSSA---  531
             H KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D++                 G+S    
Sbjct  456   HEKAFANAEHTTLLLNCYTKLKDVKKLDNFIQLDENTDKLNGETKGIAAVANGGTSNDKA  515

Query  532   -KEGTPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------L  583
              + G    + FD+ETA++VL ENYPQHAL LAKKH EHSWYLKIQLDRIS         L
Sbjct  516   HENGGKTGMNFDIETAISVLWENYPQHALILAKKHEEHSWYLKIQLDRISYVESEDSVGL  575

Query  584   SDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRF-SATTN  642
             S +E  RVADAL+YI+ LSF+EAD NLRKYGRTLVTHLPGPTT+LL++LCTG+F     +
Sbjct  576   SASEQERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGKFVPGNPS  635

Query  643   AKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEG  702
              KSDP DFLHLFVSHR QL++FL+YIV+VE+V+N  IGNTLLEMVL+D          +G
Sbjct  636   LKSDPADFLHLFVSHREQLKEFLQYIVEVETVTNPLIGNTLLEMVLSD----------DG  685

Query  703   DEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhml  762
             D        S    E AV+++LDNPRV+YDEDHALI +QM G+K+GKRYLY KLH+YHML
Sbjct  686   DT-----KLSDAEREDAVMAILDNPRVRYDEDHALIHLQMRGMKKGKRYLYNKLHLYHML  740

Query  763   lqhhmEEGEDAAVLELVKQ--QTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLL  820
             +Q H+EE +D A+++ V++  + D NLW LAL+YFAERGP PKG  A   +EW +LKQLL
Sbjct  741   VQFHIEENDDQAIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGVKA--GEEWKDLKQLL  798

Query  821   ALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDT  880
             AL+D  P   IPPLQVV +LSQSRE+P+SVV+ Y+V+QL  D+  I+ D ++IK YK DT
Sbjct  799   ALIDTNPV--IPPLQVVHVLSQSRELPVSVVKQYIVNQLVSDEKKIEEDEEKIKTYKADT  856

Query  881   AKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPE  940
              +M+ ++  L+S+A+VFQATKC+LC+HDLDLP VHFMC HSFH NCISETERECITC+ +
Sbjct  857   KQMKEEIAQLNSRAVVFQATKCELCNHDLDLPAVHFMCKHSFHLNCISETERECITCSLD  916

Query  941   HRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARF  1000
             HRH++ LK  LE KAGNHEQF+NQLETAADGF TIAEYFGKGIFK++ A +   +  ARF
Sbjct  917   HRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFGKGIFKTDIAAEDDSAFDARF  976

Query  1001  SNEL  1004
             S E 
Sbjct  977   SAEF  980

>CCI40831
Length=1163

 Score = 1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/962 (59%), Positives = 715/962 (74%), Gaps = 85/962 (9%)

Query  59    FRAHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYAST  118
             FRAH H V     MK++N+LVS+GDG DPR   +I + K+  +    +  T + +     
Sbjct  233   FRAHGHRV-----MKRSNILVSVGDGIDPR-TSMIHAEKSDVDTTSRKGDTGDSE-----  281

Query  119   GSVQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSN  177
                  STA++++WRTDQQDREGKPK++ Q+++FAK FPEEAVTAFAVS++ SQ +VGL N
Sbjct  282   -----STAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEEAVTAFAVSDEVSQWSVGLKN  336

Query  178   GAIILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYL  237
             GA+IL+RS+ + R   +         Q A   PVT L+F  KP         ++ N ++L
Sbjct  337   GAVILYRSDSRFRVERIDPILL----QPAGQHPVTGLAFTTKPI-------NNSLNHVFL  385

Query  238   YAATKRGLTCYHC--DD---VKS--KNSLMPRSVVLDERGVALHCGCVNDDGDMCMGQTD  290
             YA+T+RGLTCYHC  DD   VK+     + PR V LDERGV   C CVND+G++ +GQ D
Sbjct  386   YASTRRGLTCYHCNQDDQYIVKAVGTTGMPPRCVTLDERGVDFCCSCVNDEGEIAVGQPD  445

Query  291   AVYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILT  350
             AVYFYT +D++ CF F+G+KKYL FFK YL+VAH DSRGR+Q+N+YDLQNK IAFNW LT
Sbjct  446   AVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNVYDLQNKFIAFNWTLT  505

Query  351   NTAKALPGASSRNVVAT--------------RFGYEEVEEIRHVVSEFGAVFVVTSFGSV  396
             ++   +P  SS NV  T              RFG +++E+I+H+VSEFG++FVV+S G V
Sbjct  506   HS---VPSESSANVSKTMVARGKQSQPNPGARFGLDKMEQIQHIVSEFGSIFVVSSAGHV  562

Query  397   CLPFEREGHRVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSL  456
                 E++    + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSL
Sbjct  563   YRLTEKDT-TSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGDHLYQKGDYDGSL  621

Query  457   RQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVK  516
             RQY RTIGH+EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNC+TKLKDVK
Sbjct  622   RQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTLLLNCFTKLKDVK  681

Query  517   KLDAFLLIDDDGSSAKEGTPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYLKIQL  576
             KLDAF+ ++D G+ A  G   +L FDVETA++VL E YPQHAL LA+KH EHSWYLKIQL
Sbjct  682   KLDAFIQLED-GNVA--GGHTSLNFDVETAISVLWEMYPQHALTLARKHEEHSWYLKIQL  738

Query  577   DRIS-------DTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELL  629
             D+IS        TLS AE  RV DAL YI  LSFAEAD NLRKYGRTLVTHLPGPTTELL
Sbjct  739   DQISYVESDGSTTLSGAEKERVIDALKYIEHLSFAEADANLRKYGRTLVTHLPGPTTELL  798

Query  630   QQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNTLLEMVL  688
             ++LCTG+F       KS+P DFLHLFVSHR QLR+FL+YIV+VE++++ SIGNTLLEMVL
Sbjct  799   KRLCTGKFVPEKPELKSNPADFLHLFVSHRAQLREFLQYIVEVETITDPSIGNTLLEMVL  858

Query  689   NDTHKREVPKDDEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGLKQG  748
              D          EG E    E+P+    E AV+++LDNPRV+YDEDHALI +QMHG+++G
Sbjct  859   TD----------EGSE----ESPNTDRKEDAVMAILDNPRVRYDEDHALIHLQMHGMRKG  904

Query  749   KRYLYQKlhmyhmllqhhmEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERGPYPKGAS  806
             KRYL+ KLHMYHML+QHH+EE +D +++E V++    D NLW LAL+YFAERGP PK AS
Sbjct  905   KRYLFNKLHMYHMLVQHHIEENDDQSIIEEVRKHGDKDPNLWSLALKYFAERGPLPKNAS  964

Query  807   ARS---TDEWSELKQLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQ  863
               S   T+EW EL+QLL+++D  P   IPPLQVV +LSQ+R++PLSV++PY+++QL  +Q
Sbjct  965   KSSKSSTEEWKELRQLLSMIDTNPV--IPPLQVVQVLSQARDLPLSVIKPYILNQLSHNQ  1022

Query  864   AHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFH  923
               I++D ++I+ +K DT +M+ +++ L+SKA+VFQATKCDLC+HDLDLP VHFMC HSFH
Sbjct  1023  ELIESDEEKIRAFKADTRQMKEEISQLNSKAIVFQATKCDLCNHDLDLPAVHFMCQHSFH  1082

Query  924   QNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGI  983
              NCISET+REC+TC+ EHRH+L LK  L+ KAGNHEQF+NQLET+ DGF TIAEYFGKGI
Sbjct  1083  LNCISETDRECMTCSVEHRHILGLKTQLDQKAGNHEQFYNQLETSMDGFETIAEYFGKGI  1142

Query  984   FK  985
             FK
Sbjct  1143  FK  1144

>PYAR_24779
Length=699

 Score = 780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/713 (58%), Positives = 500/713 (70%), Gaps = 87/713 (12%)

Query  1    MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
            MAQWRRF FFD+++LKD NG+W++GVD+T MS NRG++ VGDA G +H+ANRQLE R FR
Sbjct  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60

Query  61   AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
            AH+HFVSH+VMMK++NVLV+IGDG DPR  +L + S+A+AEA R       + MYA+  +
Sbjct  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120

Query  121  VQNSTALVKMWRTDQQDREGKPKLILQLKIFA-KFPEEAVTAFAVSEDASQIAVGLSNGA  179
               S+A+V++WRTDQQDR+G PKL+ Q+ +FA K+PEEAVTAFAVS+D  Q AVGL NGA
Sbjct  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180

Query  180  IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
            +ILFR ++KR+        PP LLQ A   PVT LSF  KP        T+T    +LYA
Sbjct  181  VILFRIDLKRKV-----DRPPHLLQPAGQFPVTGLSFTSKP-------VTATVAHSFLYA  228

Query  240  ATKRGLTCYHCD-------------DVKSKNSLMPRSVVLDERGVALHCGCVNDDGDMCM  286
            AT+RGL+CYHC+                    + PR+VVLDERGV L+  CVND+G++ +
Sbjct  229  ATRRGLSCYHCNHEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAV  288

Query  287  GQTDAVYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFN  346
            GQ DAVYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFN
Sbjct  289  GQVDAVYFYTTEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFN  348

Query  347  WILTNTAKALPG----------ASSRNVVA--TRFGYEEVEEIRHVVSEFGAVFVVTSFG  394
            W LT  A+   G          AS  N  A   RFG +++EEIRHVV EFGA+FVV+S G
Sbjct  349  WSLTQMARRPGGGVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVG  408

Query  395  SVCLPFEREGHRVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDG  454
             V    E++    + +  F KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGD+DG
Sbjct  409  CVYRLTEKDT-TSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDG  467

Query  455  SLRQYARTIGHVEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKD  514
            SLRQY RTIGHVEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKD
Sbjct  468  SLRQYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKD  527

Query  515  VKKLDAFLLIDD----------------------------------------DGSSAKEG  534
            VKKLD F+ +D+                                        +G  AK G
Sbjct  528  VKKLDKFIQLDELVDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPG  587

Query  535  TPQALTFDVETALTVLRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------LSDAE  587
            +   + FD+ETA++VL ENYP HAL LAKKH EHSWYLKIQLDRIS         LS  E
Sbjct  588  S-GGMNFDIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHE  646

Query  588  HARVADALDYIRGLSFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRFSAT  640
              RVADAL+YI+ LSF+EAD NLRKYGRTLVTHLPGPTT+LL++LCTG F+A+
Sbjct  647  KERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTFAAS  699

>PHYKE_6407
Length=934

 Score = 746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/648 (62%), Positives = 475/648 (73%), Gaps = 54/648 (8%)

Query  1    MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60
            MAQWRRF FFD+++LKD NG W++GVD+T MS NRGL+ VGDA G +H++NR LE R F+
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ  60

Query  61   AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120
            AH+ FVSHVVMM+++NVLV+IGDG DPR  +L   SKA+AEA R     D   MY S  S
Sbjct  61   AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPNAED---MYTSKPS  117

Query  121  VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179
             + STA+V+ WRTDQQDREGKPKL+ Q+ IFAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  118  GK-STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGA  176

Query  180  IILFRSEMKRRApgmsgggpplllQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239
            +ILFRS++KRR             Q A   PVT LSF  KP        T++ + ++LYA
Sbjct  177  VILFRSDLKRRTDRPPHLL-----QPAGQYPVTGLSFTSKPV-------TASVSHVFLYA  224

Query  240  ATKRGLTCYHC--DD---VKSKN---SLMPRSVVLDERGVALHCGCVNDDGDMCMGQTDA  291
            +T+RGLTCYHC  DD   VKS     +L PR+ VLDERGV ++C CVN++G++ +GQTDA
Sbjct  225  STRRGLTCYHCSHDDPALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDA  284

Query  292  VYFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTN  351
            VYFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LTN
Sbjct  285  VYFYTTEDRSVCFGFEGEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTN  344

Query  352  TA-----KALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGHR  406
            T+     +  P A++      RFG +E+EE+RHVV EFGA+FVV+S G V    E++   
Sbjct  345  TSSKAGMRKPPLAANARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDT-T  403

Query  407  VQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  466
             + +  F KNLY IAISLAFSSNYD++SI+DIFRMYGD LY KGDYDGSLRQY RTIGHV
Sbjct  404  SKLEILFRKNLYSIAISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHV  463

Query  467  EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  526
            EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  464  EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  523

Query  527  -----------DGSSAKEGTPQA-----LTFDVETALTVLRENYPQHALALAKKHGEHSW  570
                        GS +   TP+      L FDVETA++VL ENYPQHAL LAKKH EHSW
Sbjct  524  VIDAKKTNGTKSGSDSGMTTPRGAGASNLNFDVETAISVLWENYPQHALTLAKKHEEHSW  583

Query  571  YLKIQLDRISDT-------LSDAEHARVADALDYIRGLSFAEADMNLR  611
            YLKIQLD IS         LS+ E  RVADAL+YI  LSF+EAD NLR
Sbjct  584  YLKIQLDHISYVDSEDSVALSENEKERVADALEYIEHLSFSEADSNLR  631

 Score = 367 bits (941),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 233/290 (80%), Gaps = 6/290 (2%)

Query  717   EAAVLSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmyhmllqhhmEEGEDAAVL  776
             E AVL +LDNPRVKYDEDHALI +QMHG+K+GKRYLY KLHMYHML+Q H+EE +D ++L
Sbjct  649   EEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSIL  708

Query  777   ELVKQQ--TDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPL  834
             E V++    D NLW LAL+YFAERGP PKGA+  S +EW ELKQLLAL+D  P   IPPL
Sbjct  709   EEVRKHGDKDPNLWSLALKYFAERGPLPKGAT--SGEEWKELKQLLALIDTNPA--IPPL  764

Query  835   QVVSILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKA  894
             QVV +LSQSRE+P+SV++ YVV+QL  D+  I+ D ++IK +K DT +M+ ++  LSS+A
Sbjct  765   QVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSSRA  824

Query  895   MVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVK  954
             +VFQATKCDLC+HDLDLP VHFMC HSFH NCISET+RECITC+ +HRH+L LK  LE K
Sbjct  825   VVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLEQK  884

Query  955   AGNHEQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004
             AGNHEQF+NQLETAADGF+TIAEYFGKGIFKS   L    S  ARFS E 
Sbjct  885   AGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVLLDEGSFEARFSAEF  934

>PYAR_24374
Length=325

 Score = 361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/326 (59%), Positives = 237/326 (73%), Gaps = 31/326 (10%)

Query  700   DEGDEPEVTEAPSPVTTEAAVLSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKlhmy  759
             DE  E  V E       E AV+++LDNPRV+YDEDHALI +QMHG+K+GKRYLY KLH+Y
Sbjct  10    DEAKERTVAE------KEDAVMAILDNPRVRYDEDHALIHLQMHGMKKGKRYLYNKLHLY  63

Query  760   hmllqhhmEEGEDAAVLELVKQQ--TDSNLWLLALRYFAERGPYPKGASARSTDEWSELK  817
             HML+Q H+EE +D+++++ V++    D NLW LAL+YFAERGP PKG   ++ +EW +LK
Sbjct  64    HMLVQFHIEENDDSSIIDEVRKHGDKDPNLWSLALKYFAERGPLPKGV--KTGEEWHDLK  121

Query  818   QLLALVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVV-----------------SQLK  860
             QLLAL+D  P   IPPL VV +LSQSRE+P++VV+ Y+V                 +QL 
Sbjct  122   QLLALIDTNPA--IPPLHVVQVLSQSRELPVAVVKQYIVLSQSRELPVAVVKQYIVNQLL  179

Query  861   KDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGH  920
              D+  I+ D D+IK YK DT KM+ ++  L+SKA+VFQATKC+LC+HDLDLP VHFMC H
Sbjct  180   SDERKIEEDEDKIKTYKADTKKMKEEIGELNSKAVVFQATKCELCNHDLDLPAVHFMCKH  239

Query  921   SFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFG  980
             SFH NCISETERECITC+ EHRH++ LK  LE KAGNHEQF+NQLETAADGF TIAEYFG
Sbjct  240   SFHLNCISETERECITCSLEHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFG  299

Query  981   KGIFKSEAALDRRPSGV--ARFSNEL  1004
             KGIFK+E A      G    RFS E 
Sbjct  300   KGIFKTEIASGDDDDGAFDHRFSAEF  325

>SPRG_09207
Length=346

 Score = 41.2 bits (95),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 7/78 (9%)

Query  888  TALSSKAMVFQATKCDLCSHDLD-LPVVHFMCGHSFHQNCISETERECITCAPEHRHLLS  946
            TAL + + + ++ +C +C  DL    VV   CGHSFHQ+C  +  +   TCA   R    
Sbjct  164  TALVASSTMVESDECAICLGDLGACSVVTLSCGHSFHQHCALQWLQYTNTCAVCRRPCTD  223

Query  947  ------LKQSLEVKAGNH  958
                  + Q+++V   NH
Sbjct  224  GHADEVMAQAVDVNCVNH  241

>H257_09623
Length=666

 Score = 40.4 bits (93),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 13/64 (20%)

Query  880  TAKMR----TQMTALSSKAMVFQATKCDLCSHDLDLPVVHFM-CGHSFHQNCISETER-E  933
            TA +R    + M+ L+S ++V     CDLC H LD P+++   CGH+FH  C+ E     
Sbjct  140  TASLRQSQPSTMSPLASSSIV-----CDLCKH-LD-PILYIPECGHTFHSRCVGEWPMVT  192

Query  934  CITC  937
            C TC
Sbjct  193  CPTC  196

>SPRG_13639
Length=179

 Score = 38.1 bits (87),  Expect = 0.098, Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 7/66 (11%)

Query  889  ALSSKAMVFQATKCDLC-----SHDLDLP--VVHFMCGHSFHQNCISETERECITCAPEH  941
            A  S+  V   T+C +C       D ++P  VV   C H FHQ CI+E      TC    
Sbjct  100  AFQSRRNVPSETECSICLVPFSRDDFEVPGVVVETQCTHVFHQGCIAEWIETAATCPICR  159

Query  942  RHLLSL  947
             H+ S+
Sbjct  160  HHIESI  165

>H310_10523
Length=262

 Score = 38.9 bits (89),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 32/72 (44%), Gaps = 2/72 (3%)

Query  873  IKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLD-LPVVHFMCGHSFHQNCISETE  931
            +K YK  +  +  ++      A       C +C + LD   VV   C HS+H +CI +  
Sbjct  54   LKSYKPTSHSILEKLATWQVPATKLDDATCAVCMNSLDDATVVALPCKHSYHTDCIRQWL  113

Query  932  RECITCAPEHRH  943
              C TC P  RH
Sbjct  114  ARCNTC-PYCRH  124

>PYU1_G002505
Length=400

 Score = 38.1 bits (87),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 26/52 (50%), Gaps = 1/52 (2%)

Query  902  CDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEV  953
            C +C  DL L  V   CGHSF + C+    + C +C P  RH  S   S+ +
Sbjct  172  CAICCADLMLKPVSLSCGHSFCKYCLELWLKNCSSC-PACRHPTSAPVSMNL  222

>H257_03925
Length=290

 Score = 37.7 bits (86),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (48%), Gaps = 6/63 (10%)

Query  897  FQATKCDLC---SHDLDL---PVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQS  950
             + T C +C     D+D    P  H  CGH FH +CI E  +   TC    R L S++ +
Sbjct  133  IKTTSCAICWESCGDIDFCSSPPHHLPCGHGFHLSCIREWMKRDATCPLCRRALPSVQDT  192

Query  951  LEV  953
             E+
Sbjct  193  FEI  195

>SDRG_12045
Length=245

 Score = 37.4 bits (85),  Expect = 0.35, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 8/62 (13%)

Query  889  ALSSKAMVFQATKCDLC-----SHDLDLP--VVHFMCGHSFHQNCISETERECITCAPEH  941
            A  S+  +   T+C +C       D  +P  VV   C H FHQ CI+E      TC P  
Sbjct  169  AFQSRTSLPNETECSICLVPFSRDDFGIPGVVVETQCTHVFHQGCIAEWMETAATC-PIC  227

Query  942  RH  943
            RH
Sbjct  228  RH  229

>CCA20583
Length=365

 Score = 37.4 bits (85),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 3/44 (7%)

Query  897  FQATKCDLCSHDLDLPVVHFMCGHSFHQNCISET---ERECITC  937
            FQ+ +C +C ++L   +    CGH FH  CI E    +++C  C
Sbjct  102  FQSQECLICLNELQTNLAAVQCGHVFHLICIKEAFEYKKQCPVC  145

>SPRG_14870
Length=246

 Score = 36.2 bits (82),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 29/62 (47%), Gaps = 8/62 (13%)

Query  889  ALSSKAMVFQATKCDLC-----SHDLDLP--VVHFMCGHSFHQNCISETERECITCAPEH  941
            A  S++ +   T+C +C       D  LP  VV   C H FHQ CI+E      TC P  
Sbjct  167  AFQSRSSLPSETECSICLVPFSRDDFHLPGVVVETQCTHVFHQGCIAEWIETAATC-PIC  225

Query  942  RH  943
            RH
Sbjct  226  RH  227

>SDRG_14777
Length=244

 Score = 36.2 bits (82),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 1/52 (2%)

Query  888  TALSSKAMVFQATKCDLCSHDLD-LPVVHFMCGHSFHQNCISETERECITCA  938
            +AL + + V ++ +C +C   +    VV   CGHSFHQ+C  E  +   TCA
Sbjct  165  SALVASSTVIESDECAICLGAMGACSVVTLSCGHSFHQHCALEWLQYTTTCA  216

>PYVX_17912
Length=134

 Score = 35.0 bits (79),  Expect = 0.80, Method: Composition-based stats.
 Identities = 14/39 (36%), Positives = 17/39 (44%), Gaps = 3/39 (8%)

Query  902  CDLCSHDLDLPVVHFMCGHSFHQNCIS---ETERECITC  937
            C +C  + D P     CGH FH  CI    +    C TC
Sbjct  31   CVVCMDEFDAPCAQLPCGHQFHPRCIEPWLKMHSTCPTC  69

>PYIW_13425
Length=257

 Score = 36.2 bits (82),  Expect = 0.81, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 21/44 (48%), Gaps = 1/44 (2%)

Query  902  CDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLL  945
            C +C   L  P V   CGH FH+ CI    +   TC P  RH L
Sbjct  71   CVVCMDALKSPCVELPCGHQFHERCIEPWLKMHSTC-PTCRHQL  113

>CCI47038
Length=312

 Score = 36.2 bits (82),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (49%), Gaps = 10/82 (12%)

Query  877  KQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFM---------CGHSFHQNCI  927
            +Q +  + + ++  S+ A V +  + D C   L   V++           CGH FH+NCI
Sbjct  231  QQCSICLESLLSIESTTAFVKEKDRNDPCKKPLPSAVIYMRERSHSVRSPCGHIFHENCI  290

Query  928  SETERECITCAPEHRHLLSLKQ  949
                R+  TC PE R  +SLK+
Sbjct  291  MSWFRQSATC-PECRASVSLKR  311

>H310_11163
Length=663

 Score = 36.2 bits (82),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 21/38 (55%), Gaps = 4/38 (11%)

Query  902  CDLCSHDLDLPVVHFM-CGHSFHQNCISETER-ECITC  937
            CDLC H    P+++   CGH+FH  CI E     C TC
Sbjct  166  CDLCKHSD--PILYIPDCGHTFHSRCIGEWPMVTCPTC  201

>CCI42121
Length=582

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (7%)

Query  897  FQATKCDLCSHDLDLPVVHFMCGHSFHQNCISET---ERECITC  937
            FQ+ +C +C ++L   +    CGH FH  CI E    + +C  C
Sbjct  227  FQSQECLICLNELQTNLATIQCGHVFHLICIKEALKYKEQCPIC  270

>PHYRA_87621
Length=183

 Score = 34.7 bits (78),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL
Sbjct  22   AFEGKEGENLHFWIREVEIAMRAGLISD-QGLRVAFALSNLSGRA--------KNWAYTL  72

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  73   ETTSPGCFASW-EQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASS  130

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  131  LVGNPLPEDV  140

>HYAP_07166
Length=76

 Score = 32.7 bits (73),  Expect = 1.6, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 4/32 (13%)

Query  906  SHDLDLPVVHFMCGHSFHQNCISETERECITC  937
            +H+LD  VV   CGH+FH +C+   ++ C TC
Sbjct  38   NHNLD--VVLLPCGHAFHDDCLD--DKSCPTC  65

>PHYRA_84112
Length=321

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL
Sbjct  83   AFEGKEGENLHFWIREVEIAMRAGLISD-QGLRVAFALSNLSGRA--------KNWAYTL  133

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  134  ETTSPG-CFASWEQLCE-RLRAAFLPANDAFRQCSRFLACKQGKRELYEYVQEMRTLASS  191

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  192  LVGNPLPEDV  201

>PHYRA_72560
Length=321

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 82/185 (44%), Gaps = 18/185 (10%)

Query  506  LNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALTFDVETALT-VLRENYPQHALALAKK  564
            L   T  + VK+++AF   + +  +  +G  QA   + +      LR   P    A   K
Sbjct  32   LASVTPAEQVKRVNAFDTYERELIAHVQGNLQASVAEPKPVQPKPLRLAVP----AFEVK  87

Query  565  HGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLP  622
             GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL T  P
Sbjct  88   EGENLHFWIREVEIAMGAGLISD-QGLRVAFALSNLSGRA--------KNWAYTLETTSP  138

Query  623  GPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNT  682
            G      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++ +GN 
Sbjct  139  G-CFASWEQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASSLVGNP  196

Query  683  LLEMV  687
            L E V
Sbjct  197  LPEDV  201

>PHYRA_72559
Length=321

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 82/185 (44%), Gaps = 18/185 (10%)

Query  506  LNCYTKLKDVKKLDAFLLIDDDGSSAKEGTPQALTFDVETALT-VLRENYPQHALALAKK  564
            L   T  + VK+++AF   + +  +  +G  QA   + +      LR   P    A   K
Sbjct  32   LASVTPAEQVKRVNAFDTYERELIAHVQGNLQASVAEPKPVQPKPLRLAVP----AFEVK  87

Query  565  HGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTHLP  622
             GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL T  P
Sbjct  88   EGENLHFWIREVEIAMGAGLISD-QGLRVAFALSNLSGRA--------KNWAYTLETTSP  138

Query  623  GPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIGNT  682
            G      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++ +GN 
Sbjct  139  G-CFASWEQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASSLVGNP  196

Query  683  LLEMV  687
            L E V
Sbjct  197  LPEDV  201

>PHYRA_73137
Length=243

 Score = 34.7 bits (78),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (47%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A  +K GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL
Sbjct  64   AFEEKEGENLHFWIREVEIAMRAGLISD-QGLRVAFALSNLSGRA--------KNWAYTL  114

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  115  ETTSPGCFASW-EQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASS  172

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  173  LVGNPLPEDV  182

>CCA14995
Length=310

 Score = 35.0 bits (79),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 1/32 (3%)

Query  918  CGHSFHQNCISETERECITCAPEHRHLLSLKQ  949
            CGH FH+NCI    R+  TC PE R  +SLK+
Sbjct  279  CGHIFHENCIMSWFRQSATC-PECRASVSLKR  309

>PYVX_17881
Length=748

 Score = 35.0 bits (79),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (13%)

Query  902  CDLCSHDLDLPVVHFM---CGHSFHQNCIS---ETERECITCAPEHR  942
            C +C  +LD+    +M   C H FH+ C+    + + EC TC P  R
Sbjct  673  CVICMMELDVDARDYMIAPCEHIFHRECLQGWMQVKMECPTCRPRAR  719

>PHYRA_82514
Length=251

 Score = 34.7 bits (78),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL
Sbjct  83   AFEGKEGENLHFWIREVEIAMRAGLISD-QGLRVAFALSNLSGRA--------KNWAYTL  133

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  134  ETTSPGCFASW-KQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASS  191

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  192  LVGNPLPEDV  201

>PHYRA_73746
Length=268

 Score = 34.3 bits (77),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 60/127 (47%), Gaps = 13/127 (10%)

Query  563  KKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTLVTH  620
            +K GE  H W  ++++   +  +SD +   VA AL  + G +        + +  TL T 
Sbjct  33   QKEGENLHFWIREVEIAIRAGLISD-QGLCVAFALSNLSGRA--------KNWAYTLETT  83

Query  621  LPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNTSIG  680
             PG      +QLC  R  A     +D       F++ R   R+  EY+ ++ +++++ +G
Sbjct  84   SPGCFASW-EQLCE-RLRAAFLPANDEFRQRSRFLACRQGKRELYEYVQEMRTLASSLVG  141

Query  681  NTLLEMV  687
            N LLE V
Sbjct  142  NPLLEDV  148

>PHYRA_77018
Length=939

 Score = 35.0 bits (79),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 3/55 (5%)

Query  857  SQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDL  911
            SQL+  Q+ +D    E K+ + D   +R Q+T   +K   F+A + DL   +L+L
Sbjct  520  SQLRSRQSQVDTQLAECKQLRSDNGTLREQVTGFEAK---FEAMRKDLVRRELEL  571

>CCA16939
Length=86

 Score = 32.0 bits (71),  Expect = 3.3, Method: Composition-based stats.
 Identities = 15/41 (37%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  528  GSSAKEGTPQALTFDVETALTVLRENYPQHALALAKKHGEH  568
            G+    GT  +    VE AL + R+ +P H   LAK  GE 
Sbjct  44   GNQVAHGTSSSTIITVEPALRIARQKHPIHHFELAKHAGEQ  84

>PHYRA_85839
Length=150

 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++D  +  +SD +  RVA AL  + G +        + +  TL
Sbjct  27   AFEGKEGENLHFWIREVEIDMRAGLISD-QGLRVAFALSNLSGRA--------KNWAYTL  77

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QL   R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  78   ETTSPG-CFAYWEQLYE-RLRAAFLPANDTFRQRSRFLACKQGKRELYEYVQEMRTLASS  135

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  136  LVGNPLPEDV  145

>H310_07251
Length=404

 Score = 34.3 bits (77),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 40/94 (43%), Gaps = 12/94 (13%)

Query  902  CDLCSHDLDL-PVVHFMCGHSFHQNCISETE-------RECITCAPEH---RHLLSLKQS  950
            C +C     L P V   C H FHQNC++  E       R C  C  ++   RH    +QS
Sbjct  164  CSICREPFGLAPKVILSCTHMFHQNCLASFERFLRTNQRVCPLCRKQNYQKRHTKQGEQS  223

Query  951  LEVKAGNHEQFFNQLETAADGFNT-IAEYFGKGI  983
              ++     Q F +   A   F + + +YF  G+
Sbjct  224  FRIQCTIKIQSFVRGFIARRRFPSLLRQYFKAGL  257

>PYIW_24934
Length=261

 Score = 34.3 bits (77),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 27/71 (38%), Gaps = 8/71 (11%)

Query  900  TKCDLCSHDLDLPV---VHFMCGHSFHQNCIS---ETERECITCAPEHRHLLSLKQSLEV  953
            T C +C  DL L     V   CGH FH  CI    +    C TC  + R   S   S  V
Sbjct  74   TACVVCMSDLALAASDAVQLPCGHCFHHGCIQSWLKLRSTCPTCRFQFRKAFS--GSYAV  131

Query  954  KAGNHEQFFNQ  964
            K  N      Q
Sbjct  132  KTLNSALLLKQ  142

>SDRG_09425
Length=217

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query  859  LKKDQAHIDADSDEIKKYKQDTAKMRT-QMTALSSKAMVFQATKCDLCSHDLDLPVVHFM  917
            L +D  H  +D   I+   +  A  R  QM+A+ S      A  C +C    D P V   
Sbjct  138  LHRDLLHATSDFCAIEYPLEVRASQRMRQMSAVES-----VAGDCCICLSTDDAPHVALR  192

Query  918  CGHSFHQNCIS  928
            CGH FH+ CI 
Sbjct  193  CGHVFHETCIC  203

>PYAP_13607
Length=270

 Score = 34.3 bits (77),  Expect = 3.8, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 17/38 (45%), Gaps = 0/38 (0%)

Query  900  TKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITC  937
            T C +C   +D P V   C H FH  CI    R   TC
Sbjct  73   TSCVVCMETMDQPCVQLPCHHYFHVGCIEPWLRMHSTC  110

>PPTG_08731
Length=1578

 Score = 34.7 bits (78),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 7/41 (17%)

Query  902   CDL-----CSHDLDLPVVHFMCGHSFHQNCISETERECITC  937
             CDL     C ++ +L VV   CGH+FH++C+ +    C  C
Sbjct  1529  CDLPVVIICDNNANLDVVLLPCGHAFHEHCLEDN--SCPVC  1567

>PYVX_13239
Length=1021

 Score = 34.7 bits (78),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 44/123 (36%), Gaps = 21/123 (17%)

Query  883   MRTQMTALSSKAMVFQATKCDLCSHDLDLP--------VVHFMCGHSFHQNCISETEREC  934
             +R Q+TA      V     C +C+  L  P        V  F CGH +H  C+ E  R  
Sbjct  893   LRRQVTAHKRARRVSAKKACAICNEVLRAPTSGKESIHVCVFECGHCYHLPCLEEKMR--  950

Query  935   ITCAPEHRHLLSLKQSLEVKAGNHEQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRP  994
                          K S  V  G+   F   L       +T A    +G+ +  A+L   P
Sbjct  951   -----------MWKHSDVVDTGDMNAFRQSLGCFVCDHSTRAHARSEGLGQQIASLSAPP  999

Query  995   SGV  997
              G+
Sbjct  1000  RGI  1002

>PHYRA_86951
Length=334

 Score = 33.9 bits (76),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 13/126 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++   +  +SD +  RVA AL  + G +        + +  TL
Sbjct  83   AFEGKEGENLHFWIREVEIAMRAGLISD-QGLRVAFALSNLSGRA--------KNWAYTL  133

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  134  ETMSPG-CFASWEQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASS  191

Query  678  SIGNTL  683
             +GN L
Sbjct  192  LVGNPL  197

>PHYKE_7490
Length=895

 Score = 34.3 bits (77),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 48/123 (39%), Gaps = 25/123 (20%)

Query  822  LVDVTPTLQIPPLQVVSILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQD--  879
            L+D++ T +    +++   SQ +  P+ ++R                D  EI+  KQ   
Sbjct  715  LIDLSLTSKDNVEKLLKFASQHKIDPIKLIRKI-------------PDDMEIENLKQKLI  761

Query  880  --TAKMRTQMTALSSKAMVFQATKCDLCSHDLDLP-----VVH---FMCGHSFHQNCISE  929
               A  R Q+ A      V     C +CS  L  P      VH   F CGH +H  C+ E
Sbjct  762  AIIANYRVQVEAHKRGRRVAAKKACAICSELLRAPSSGMETVHACVFECGHCYHLPCLEE  821

Query  930  TER  932
              R
Sbjct  822  KMR  824

>PHYRA_77897
Length=332

 Score = 33.9 bits (76),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query  881  AKMRTQMTALSSKAMVFQATKCDLCSHDLDLPVVHFMCGHSFHQNCI  927
            A+ R +  A SS  +  +  +C +C   L  PV    CGH+F + CI
Sbjct  78   ARRRQRPVAFSSLCVTLEDLRCSICFDTLCFPVT-LPCGHNFDRGCI  123

>PYIW_16177
Length=1061

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (44%), Gaps = 4/78 (5%)

Query  59   FRAHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAV----AEANRTQAQTDEQQM  114
             RA D F+S     +K+ +LV IG   D R  D  Q+ + V    AE NR  A   EQ +
Sbjct  411  LRAFDRFLSLHPEKRKSVILVQIGLSMDSRPNDYHQTREYVIKFAAEINRRWAPPGEQVV  470

Query  115  YASTGSVQNSTALVKMWR  132
            Y            + +WR
Sbjct  471  YFEEKLKTTCMERMNLWR  488

>H310_07077
Length=301

 Score = 33.5 bits (75),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 6/74 (8%)

Query  886  QMTALSSKAMVFQATKCDLCSHDLD------LPVVHFMCGHSFHQNCISETERECITCAP  939
            Q   +    +  Q T C +C   +           H  CGH FH  CI E  +   TC  
Sbjct  132  QSLTIHDNCLQIQTTSCSICWDSVTDNRGKCNAAHHLPCGHGFHLQCIREWMKRDSTCPL  191

Query  940  EHRHLLSLKQSLEV  953
              R L S++ + E+
Sbjct  192  CRRSLPSVQDTFEI  205

>H310_06692
Length=358

 Score = 33.5 bits (75),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  899  ATKCDLCSHDL---DLPVVHFMCGHSFHQNCISETERECITC  937
            A +C +C  D+   D  +V  +CGHSFH+ C+ +  +   TC
Sbjct  196  AVECAICLDDMERGDATIVVLLCGHSFHKACVEDWIKSHSTC  237

>H257_05326
Length=273

 Score = 33.5 bits (75),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 20/77 (26%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query  873  IKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDLP------VVHFMCGHSFHQNC  926
            +K YK  +  +  ++   +  ++      C +C   + +P      VV   C H+FH +C
Sbjct  53   LKSYKPTSQSILEKLATWTVSSVPRVDESCAICMSSM-MPDDNKANVVALPCSHTFHSDC  111

Query  927  ISETERECITCAPEHRH  943
            I +    C TC P  RH
Sbjct  112  IRQWLTRCNTC-PYCRH  127

>PYU1_G012330
Length=248

 Score = 33.1 bits (74),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 0/41 (0%)

Query  897  FQATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITC  937
            F+   C +C H++D       CGH FH  CI     E + C
Sbjct  198  FEDMFCAICDHEVDGYKTRLRCGHEFHDECILPKLNESMKC  238

>PHYRA_87105
Length=321

 Score = 33.5 bits (75),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++   +  +SD +  RVA  L  + G +        + +  TL
Sbjct  83   AFEGKEGENLHFWIREVEIAMRAGLISD-QGLRVAFGLSNLSGRA--------KNWAYTL  133

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  134  ETTSPG-CFASWEQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASS  191

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  192  LVGNPLPEDV  201

>PITG_10420
Length=1551

 Score = 33.9 bits (76),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 7/41 (17%)

Query  902   CDL-----CSHDLDLPVVHFMCGHSFHQNCISETERECITC  937
             CDL       ++ +L V+   CGH+FH+NC+ E    C  C
Sbjct  1502  CDLPVVIISDNNTNLDVILLPCGHAFHENCLEEN--SCPVC  1540

>PHYSO_488734
Length=379

 Score = 33.5 bits (75),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (46%), Gaps = 4/48 (8%)

Query  891  SSKAMVFQATKCDLCSHDLDLP----VVHFMCGHSFHQNCISETEREC  934
            +  A + +  KC LC     L     V+   CGHSFH +CI E    C
Sbjct  311  TKSAGLAKEAKCTLCWSTFGLTKPGFVITIGCGHSFHCSCIDEWSGWC  358

>SPRG_10711
Length=227

 Score = 33.1 bits (74),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 31/77 (40%), Gaps = 7/77 (9%)

Query  871  DEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLC----SHDLDLPVVHFMCGHSFHQNC  926
            +EI +       + T+M +  +   V     C +C     H +   V    CGH FHQ C
Sbjct  144  NEIYRLLGHALAVPTRMNSRPTTTTVATTEPCAICLEDHGHGVKDSVFQLPCGHEFHQEC  203

Query  927  ISE---TERECITCAPE  940
            I E   T+  C  C  E
Sbjct  204  ILEWFDTQHTCPMCRTE  220

>PHYRA_84653
Length=321

 Score = 33.1 bits (74),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 13/130 (10%)

Query  560  ALAKKHGE--HSWYLKIQLDRISDTLSDAEHARVADALDYIRGLSFAEADMNLRKYGRTL  617
            A   K GE  H W  ++++   +  +SD +  RVA  L  + G +        + +  TL
Sbjct  83   AFEGKEGENLHFWIREVEIAMRAGLISD-QGLRVAFGLSNLSGRA--------KNWAYTL  133

Query  618  VTHLPGPTTELLQQLCTGRFSATTNAKSDPGDFLHLFVSHRTQLRDFLEYIVQVESVSNT  677
             T  PG      +QLC  R  A     +D       F++ +   R+  EY+ ++ +++++
Sbjct  134  ETTSPG-CFASWKQLCE-RLRAAFLPANDAFRQRSRFLACKQGKRELYEYVQEMRTLASS  191

Query  678  SIGNTLLEMV  687
             +GN L E V
Sbjct  192  LVGNPLPEDV  201

>H257_01333
Length=353

 Score = 33.1 bits (74),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  901  KCDLCSHDL--DLPVVHFMCGHSFHQNCISETERECITC  937
            +C +C  DL  D  +V   CGH+FH+NC+    +   TC
Sbjct  197  ECSICLEDLAGDERLVQLTCGHTFHKNCVGGWTKCHFTC  235

>PHYSO_307351
Length=281

 Score = 33.1 bits (74),  Expect = 8.4, Method: Composition-based stats.
 Identities = 24/84 (29%), Positives = 32/84 (38%), Gaps = 16/84 (19%)

Query  863  QAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDLDL---------PV  913
            Q  ID   D  KK K     M T  +  +         +C  C  D+DL          V
Sbjct  153  QVFIDNCQDVWKKVKVGFKAMETSHSKWTK-------VRCSFCQCDVDLTRDLPQCKSAV  205

Query  914  VHFMCGHSFHQNCISETERECITC  937
            V   C H+FH+ C+ +  R  I C
Sbjct  206  VVLPCKHTFHRKCVFQWLRFQIHC  229

>H310_05086
Length=379

 Score = 33.1 bits (74),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (46%), Gaps = 2/68 (3%)

Query  868  ADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHDL-DLPVVHFMCGHSFHQNC  926
            A+ +   +YK + + M     +L   A   +  +C +C  +L DL V   +C H  H  C
Sbjct  296  AEGNVFHQYKSEGSSM-VAWESLVVVARALKMKECVVCFEELRDLGVTSLLCNHRIHSTC  354

Query  927  ISETEREC  934
            +++    C
Sbjct  355  LTQWTSSC  362

>PYVX_22996
Length=186

 Score = 32.3 bits (72),  Expect = 9.1, Method: Composition-based stats.
 Identities = 17/45 (38%), Positives = 22/45 (49%), Gaps = 7/45 (16%)

Query  902  CDLCSHDLDL---PVVHFMCGHSFHQNCIS---ETERECITC-AP  939
            C +C  D D    P V   CGH FH +C+    E +  C +C AP
Sbjct  70   CAICLDDDDDAAGPSVTLACGHDFHADCVRRWLEVQSSCPSCRAP  114

>PHYCA_527156
Length=262

 Score = 32.7 bits (73),  Expect = 9.3, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 42/98 (43%), Gaps = 14/98 (14%)

Query  849  SVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQATKCDLCSHD  908
            S++R Y++ QL +      A  + ++K K + A +R Q           ++  C +C   
Sbjct  34   SIIR-YIIPQLNRVSP---AAMNLVEKLKSNPADVRQQQDG--------ESAVCVVCMEA  81

Query  909  LDLPVVHF-MCGHSFHQNCISETERECITCAPEHRHLL  945
            L  P      C H FH +CI    +   TC P  RH L
Sbjct  82   LTSPCAELPTCCHQFHDHCIEPWLKMHSTC-PTCRHQL  118

>PITG_03761
Length=431

 Score = 33.1 bits (74),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 20/40 (50%), Gaps = 3/40 (8%)

Query  901  KCDLCSHDLDLPVVHFMCGHSFHQNCISET---ERECITC  937
            +C +C  DL   +V   CGH FH  C+ +     ++C  C
Sbjct  8    ECHICLEDLRSNLVAAPCGHVFHHACVIQALQFNKQCPIC  47

>PYIW_16281
Length=261

 Score = 32.7 bits (73),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 18/38 (47%), Gaps = 0/38 (0%)

Query  900  TKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITC  937
            + C +C  DL   +V   CGH FHQ C +     C  C
Sbjct  8    SSCAVCLEDLRSDLVALRCGHVFHQPCAAHALDLCAKC  45

Lambda      K        H        a         alpha
   0.319    0.133    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 83677504650

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40