Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SPRG_03281111491531538151e-112
SDRG_14093111492871266552e-86
H257_12786111492781305474e-70
H310_11728111492911295467e-70
PYAP_24882111491791264561e-57
PYIW_14749111493141274567e-56
PYIR_15197111492841504424e-54
PHYCA_60964111491771244031e-49
PYAR_22689111493041264025e-48
PHYSO_315015111492061263591e-42
PITG_13744111491781243301e-38
PYU1_G00596511149117943061e-35
PHYRA_81677111491731512961e-33
CCA17990111492831293007e-33
PHYKE_64081114991692404e-26
PPTG_0925411149307551312e-08
H310_14476128364901291312e-08
SDRG_14076128364711201232e-07
H257_13329128364451291189e-07
PYU1_G000982128365281271181e-06
SPRG_09603128364671201171e-06
PHYCA_505767128364601451101e-05
PHYRA_741511283511271121073e-05
PHYSO_249618128364851091055e-05
PYIW_21378128364961081021e-04
PHALS_09846128364811511002e-04
PITG_15925128364551101002e-04
PYIR_1811612836532104966e-04
PYAR_1410512836494168890.006
PHYKE_62591283623069870.007
PPTG_1271712836496147860.014
PYVX_1752612836521156850.018
PHYCA_5570651178824248691.8
PYIR_190408303955829702.0
PPTG_089361267313633672.5
PHYSO_5117921178824648673.3
PYU1_G0079271178825941674.0
PYIR_241951126334444674.1
SPRG_041581319457933674.8
H310_0792713435526261664.8
PYAR_1735711178112172665.8
PYIR_241978484139242658.0
PHYKE_14911178772846658.8
PYVX_133729108140554659.1
PHYCA_120484908732994649.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SPRG_03281

Length=153
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPRG_03281                                                            318     1e-112
SDRG_14093                                                            256     2e-86 
H257_12786                                                            215     4e-70 
H310_11728                                                            214     7e-70 
PYAP_24882                                                            180     1e-57 
PYIW_14749                                                            180     7e-56 
PYIR_15197                                                            174     4e-54 
PHYCA_60964                                                           159     1e-49 
PYAR_22689                                                            159     5e-48 
PHYSO_315015                                                          142     1e-42 
PITG_13744                                                            131     1e-38 
PYU1_G005965                                                          122     1e-35 
PHYRA_81677                                                           118     1e-33 
CCA17990                                                              120     7e-33 
PHYKE_6408                                                            97.1    4e-26 
PPTG_09254                                                            55.1    2e-08 
H310_14476                                                            55.1    2e-08 
SDRG_14076                                                            52.0    2e-07 
H257_13329                                                            50.1    9e-07 
PYU1_G000982                                                          50.1    1e-06 
SPRG_09603                                                            49.7    1e-06 
PHYCA_505767                                                          47.0    1e-05 
PHYRA_74151                                                           45.8    3e-05 
PHYSO_249618                                                          45.1    5e-05 
PYIW_21378                                                            43.9    1e-04 
PHALS_09846                                                           43.1    2e-04 
PITG_15925                                                            43.1    2e-04 
PYIR_18116                                                            41.6    6e-04 
PYAR_14105                                                            38.9    0.006 
PHYKE_6259                                                            38.1    0.007 
PPTG_12717                                                            37.7    0.014 
PYVX_17526                                                            37.4    0.018 
PHYCA_557065                                                          31.2    1.8   
PYIR_19040                                                            31.6    2.0   
PPTG_08936                                                            30.4    2.5   
PHYSO_511792                                                          30.4    3.3   
PYU1_G007927                                                          30.4    4.0   
PYIR_24195                                                            30.4    4.1   
SPRG_04158                                                            30.4    4.8   
H310_07927                                                            30.0    4.8   
PYAR_17357                                                            30.0    5.8   
PYIR_24197                                                            29.6    8.0   
PHYKE_1491                                                            29.6    8.8   
PYVX_13372                                                            29.6    9.1   
PHYCA_120484                                                          29.3    9.7   

>SPRG_03281
Length=153

 Score = 318 bits (815),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV
Sbjct  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM
Sbjct  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120

Query  121  AQGLIGGLASLARSSKTLAKDMCVALYSVRKYI  153
            AQGLIGGLASLARSSKTLAKDMCVALYSVRKYI
Sbjct  121  AQGLIGGLASLARSSKTLAKDMCVALYSVRKYI  153

>SDRG_14093
Length=287

 Score = 256 bits (655),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/126 (96%), Positives = 123/126 (98%), Gaps = 0/126 (0%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            MEWQIPTIRALKRQ QVDEAQRILERIASYVLPIM+KRQYRVQQLLEFFPKNANLLGMNV
Sbjct  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            NHGWKIYVRLRPA RPTSFLPFE LLGTMLHELVHMKIGPHNAAFYKLLDELTSEME+LM
Sbjct  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120

Query  121  AQGLIG  126
            AQGLIG
Sbjct  121  AQGLIG  126

>H257_12786
Length=278

 Score = 215 bits (547),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 117/130 (90%), Gaps = 0/130 (0%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            MEW IPTI+ALK+Q + DEAQRILERIA +VLPI +KR+++V+ LLEFFPKNANLLGMNV
Sbjct  1    MEWTIPTIQALKKQTKNDEAQRILERIAEHVLPICTKRRFKVRNLLEFFPKNANLLGMNV  60

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            N GWKI++RLRPA+ PT+FLPFE++LGTMLHELVHMKIGPH+A+FYK+LDELT +ME LM
Sbjct  61   NEGWKIFLRLRPASHPTTFLPFEEILGTMLHELVHMKIGPHDASFYKMLDELTEDMENLM  120

Query  121  AQGLIGGLAS  130
            A+GL+G   +
Sbjct  121  ARGLLGATGA  130

>H310_11728
Length=291

 Score = 214 bits (546),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 114/129 (88%), Gaps = 0/129 (0%)

Query  2    EWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVN  61
            EW IPTI+ LKRQ + DEAQRILERIA +VLPI +KRQ++V+ LLEFFPKN NLLGMNVN
Sbjct  6    EWMIPTIQVLKRQSKKDEAQRILERIADHVLPICTKRQFKVRNLLEFFPKNGNLLGMNVN  65

Query  62   HGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMA  121
             GWKI++RLRPA++PT+FLPFED+LGTMLHELVHMKIGPHNA+FYK+LDELT EME L+ 
Sbjct  66   QGWKIFLRLRPASQPTTFLPFEDILGTMLHELVHMKIGPHNASFYKMLDELTREMENLLE  125

Query  122  QGLIGGLAS  130
            +GL+G   +
Sbjct  126  RGLLGAAGA  134

>PYAP_24882
Length=179

 Score = 180 bits (456),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 103/126 (82%), Gaps = 0/126 (0%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            M ++IP +RAL R+P+ ++AQR+LERIA+ VLPI+SKR++RV+ L EFFPK+  LLGMNV
Sbjct  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            N G  IY+RLRPA+RPTSF P+E LL TMLHEL HM  GPHN AFYK LDEL  EME+LM
Sbjct  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126

Query  121  AQGLIG  126
             +GL+G
Sbjct  127  TRGLVG  132

>PYIW_14749
Length=314

 Score = 180 bits (456),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            M ++I  +RAL R+P+ DEAQ++LERIAS+VLPI+++R++RV +L EFFP +A+LLGMNV
Sbjct  1    MSFKIGEVRALVRRPRRDEAQQLLERIASHVLPILTQRRFRVLRLQEFFPTSAHLLGMNV  60

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            N G+KIY+RLRPAA+P +F PFE LL TMLHEL HM  GPHN AFYK LDEL +EME LM
Sbjct  61   NRGYKIYLRLRPAAQPAAFYPFEALLETMLHELTHMVHGPHNQAFYKYLDELKTEMEALM  120

Query  121  AQGLIGG  127
             QGLIG 
Sbjct  121  IQGLIGA  127

>PYIR_15197
Length=284

 Score = 174 bits (442),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 0/150 (0%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            M ++I  +RAL R+P+ DEAQ++L+RIAS+VLPI+++R++RV +L EFFP NA+LLGMNV
Sbjct  1    MSFEILEVRALVRRPRRDEAQQLLDRIASHVLPILAQRRFRVLRLQEFFPTNAHLLGMNV  60

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            N G KIY+RLRPAARP SFLPFE LL TMLHEL HM  GPHN AFY  LDEL  EME LM
Sbjct  61   NRGIKIYLRLRPAARPESFLPFEALLETMLHELTHMVHGPHNQAFYNYLDELKMEMEALM  120

Query  121  AQGLIGGLASLARSSKTLAKDMCVALYSVR  150
             + L+G   +   S+     D   A+ + +
Sbjct  121  IRDLLGTEGAKFHSAGEGRNDNAAAVLAAK  150

>PHYCA_60964
Length=177

 Score = 159 bits (403),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 0/124 (0%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNH  62
            + I  I+AL RQPQ ++AQR+LER+A+ VLPIM++R++RV++LLEFFPK+  LLGMNVN 
Sbjct  3    YAITEIKALVRQPQREDAQRLLERLAAAVLPIMTRRRFRVRRLLEFFPKDGALLGMNVNR  62

Query  63   GWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQ  122
            G KIYVRLRP   P SF  +E+LLGT+LHEL HM  GPHN AFYK LDEL  +ME+LM +
Sbjct  63   GAKIYVRLRPQRNPESFYSYEELLGTLLHELTHMVHGPHNQAFYKYLDELKHDMESLMVR  122

Query  123  GLIG  126
            GL+G
Sbjct  123  GLVG  126

>PYAR_22689
Length=304

 Score = 159 bits (402),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 6/126 (5%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            ME++IP +RAL R+   D AQR+LE+IA  VLPI++KR++RV++L EFFP +ANLLGMNV
Sbjct  1    MEFEIPVVRALVRRADRDAAQRLLEKIALQVLPILTKRRFRVKRLHEFFPSDANLLGMNV  60

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            N G  IY+RLRP  RP SFLP+E LL TMLHEL HM  GPHN AFYK       E+E+LM
Sbjct  61   NRGATIYIRLRPQHRPESFLPYEALLETMLHELTHMVHGPHNQAFYK------DEVESLM  114

Query  121  AQGLIG  126
             +GL G
Sbjct  115  LRGLTG  120

>PHYSO_315015
Length=206

 Score = 142 bits (359),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 2/126 (2%)

Query  3    WQIPTIRALKRQPQVDEA--QRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60
            + IP ++AL RQPQ   A  Q++LER+A+ VLPI++KR++RV+ LLEFFPK+  LLGMNV
Sbjct  5    FAIPEVKALVRQPQPQRARAQQLLERLAAAVLPILTKRRFRVRWLLEFFPKDGCLLGMNV  64

Query  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120
            N G KIYVRLRP   P SFLP+E LL T+LHEL HM  GPHN AFY+ LDEL  EME+LM
Sbjct  65   NRGAKIYVRLRPQRSPQSFLPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLM  124

Query  121  AQGLIG  126
             +GL+G
Sbjct  125  VRGLVG  130

>PITG_13744
Length=178

 Score = 131 bits (330),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (77%), Gaps = 0/124 (0%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNH  62
            + I  I+AL RQPQ  +AQ++LER+A+ VLPI+++R++ V++L EFFPK+  LLGMNVN 
Sbjct  4    FAIAEIKALVRQPQRVQAQQLLERLAAAVLPILTRRRFHVRRLHEFFPKDGALLGMNVNR  63

Query  63   GWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQ  122
            G KIYVRLR    P +F P+E LL T+LHEL HM  GPHN AFY  L+EL +EME+LM +
Sbjct  64   GAKIYVRLRLKHAPDTFYPYEALLETLLHELTHMVHGPHNEAFYTYLEELKAEMESLMVR  123

Query  123  GLIG  126
            GL+G
Sbjct  124  GLVG  127

>PYU1_G005965
Length=117

 Score = 122 bits (306),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 76/94 (81%), Gaps = 0/94 (0%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNH  62
            + I  +RAL R+P+ D+AQ++LE+IA++VLPI+++R +RV++L EFFP N +LLGMNVN 
Sbjct  12   FAIGKVRALVRRPRRDDAQKLLEQIAAHVLPILTQRCFRVRRLQEFFPTNPHLLGMNVNK  71

Query  63   GWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHM  96
            G KIY+RLRPA  P +F PFE LL TMLHEL HM
Sbjct  72   GVKIYIRLRPANAPGTFFPFEALLETMLHELTHM  105

>PHYRA_81677
Length=173

 Score = 118 bits (296),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 8/151 (5%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNH  62
            +    ++AL  + Q ++AQ++LER+A+ VLPI+++R++RV++LLEFFP +  LLGMNVN 
Sbjct  5    FAFAEVKALVLRRQREQAQQLLERLAAAVLPILTRRRFRVRRLLEFFPTDGALLGMNVNR  64

Query  63   GWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQ  122
            G KIYVRLRP   P SF P+E LL T+LHEL HM  GPHN AFY+ LDEL  EME+LM +
Sbjct  65   GAKIYVRLRPKRTPESFYPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLMVR  124

Query  123  GLIGGLA---SLARSSKTLAKD-----MCVA  145
            GL G  A   + A + + L  D     +CVA
Sbjct  125  GLEGQEAVKFADAGAGQRLGGDSARVPICVA  155

>CCA17990
Length=283

 Score = 120 bits (300),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 91/129 (71%), Gaps = 0/129 (0%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNH  62
            +++  I+AL +Q    +AQR+L+R+A  ++PI++K +++V+ L EFFPK+A LLGMN+N 
Sbjct  4    YEVEAIKALAKQRNPTQAQRLLKRLADQIVPILTKHKFQVRHLQEFFPKDARLLGMNLNR  63

Query  63   GWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQ  122
            GWK+++RLRP+ +P +F P+E LL T+LHEL H   G H+ AFYK   +L  E E LM  
Sbjct  64   GWKVFIRLRPSRKPDTFYPYEALLETLLHELTHNVYGQHDEAFYKFFAQLKKEAEDLMMN  123

Query  123  GLIGGLASL  131
            GL G   +L
Sbjct  124  GLSGRSGAL  132

>PHYKE_6408
Length=91

 Score = 97.1 bits (240),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 59/69 (86%), Gaps = 0/69 (0%)

Query  2   EWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVN  61
            + IP ++AL RQP+ D AQ++LER+A+ VLPIM++R++RV +L+EFFPK+ +LLGMNVN
Sbjct  4   SFAIPEVKALVRQPRRDHAQQLLERLATAVLPIMTQRRFRVHRLIEFFPKDGSLLGMNVN  63

Query  62  HGWKIYVRL  70
           HG KIY+RL
Sbjct  64  HGAKIYIRL  72

>PPTG_09254
Length=307

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)

Query  72   PAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQGLIG  126
            P   P SF P+E LL T+LHEL HM  GPHN AFYK LDEL  EME LM +GL+G
Sbjct  74   PKRTPKSFYPYEALLETLLHELTHMVHGPHNEAFYKYLDELKHEMEMLMVRGLVG  128

>H310_14476
Length=490

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 61/129 (47%), Gaps = 27/129 (21%)

Query  8    IRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMN  59
            I  L   P    A+ ILE +A+   +L ++++ ++ V  L+E FP          +LG+N
Sbjct  127  IETLPNMPNEATARNILESLATDPGILAVLAQHKWHVGALVEMFPDGKVGVDPVCVLGLN  186

Query  60   VNHGWKIYVRLRPAARPTSFLPFEDLLG---------TMLHELVHMKIGPHNAAFYKLLD  110
             N G +I +RLR           +DLLG          + HEL H  +  HN  FY+L+ 
Sbjct  187  ENKGQRIRLRLR----------TDDLLGFRKFLTIKQVLFHELSHNDVSDHNPEFYQLMR  236

Query  111  ELTSEMETL  119
            ++ +E   +
Sbjct  237  QVEAECNAI  245

>SDRG_14076
Length=471

 Score = 52.0 bits (123),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 9/120 (8%)

Query  8    IRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMN  59
            I+ L   P   +A+ IL  +A    +L +M+K ++ V  L E FP          +LG+N
Sbjct  122  IQTLPGLPDEAKARAILTSLAQDKGILHVMAKHKWTVGALAEMFPDGKVGVDPVCVLGLN  181

Query  60   VNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETL  119
             N G +I +RLR       F  +  +   + HEL H  +  HN  FY+L+ ++ +E  T+
Sbjct  182  ENKGQRILLRLR-TDDLQGFRKYLTIKKVLYHELTHNDVSDHNNEFYQLMRQVEAECNTV  240

>H257_13329
Length=445

 Score = 50.1 bits (118),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 61/129 (47%), Gaps = 27/129 (21%)

Query  8    IRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMN  59
            I  L   P    A+ IL  +AS   +L +++  +++V  L+E +P          +LG+N
Sbjct  127  IETLPGLPNEPTARNILVSLASDPGILAVLAHHKWQVGALVEMYPDGKVGVDPVCVLGLN  186

Query  60   VNHGWKIYVRLRPAARPTSFLPFEDLLG---------TMLHELVHMKIGPHNAAFYKLLD  110
             N G +I +RLR           +DLLG          + HEL H ++  HN  FY+L+ 
Sbjct  187  ENKGQRIRLRLR----------TDDLLGFRKFLTIKQVLFHELSHNEVSDHNNDFYQLMR  236

Query  111  ELTSEMETL  119
            ++ +E   +
Sbjct  237  QVETECNAV  245

>PYU1_G000982
Length=528

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (49%), Gaps = 9/127 (7%)

Query  1    MEWQIPTIRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------  52
            ++++   I  L      D A+ ILER+A+   +L +M+K ++ V  L E +P        
Sbjct  124  IDYRFHAIEVLPNFSDKDRAREILERLANDRGILAVMAKHKWTVGTLAEMYPDGKVGVDP  183

Query  53   ANLLGMNVNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDEL  112
              +LG+N N G KI +RLR       F  + ++   + HEL H     H+A F+ L+ ++
Sbjct  184  VCVLGLNQNKGQKILLRLRTDDL-LGFRKYLNIKKVLFHELTHNVYSEHDAKFFTLMSQV  242

Query  113  TSEMETL  119
              E   L
Sbjct  243  EKECAAL  249

>SPRG_09603
Length=467

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 9/120 (8%)

Query  8    IRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMN  59
            I+ L   P    A  IL  +A    +L +M+K ++ V  L E +P          +LG+N
Sbjct  122  IQTLPGLPDEARATAILTSLAQDKGILHVMAKHKWSVGALAEMYPDGKVGVDPVCVLGLN  181

Query  60   VNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETL  119
             N G +I +RLR       F  +  +   + HEL H  +  HN  FY+L+ ++ +E  T+
Sbjct  182  ENKGQRILLRLR-TDDLQGFRKYLTIKKVLYHELTHNDVSDHNNEFYQLMRQVEAECNTV  240

>PHYCA_505767
Length=460

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 66/145 (46%), Gaps = 13/145 (9%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------AN  54
            ++   I  LK     ++AQ ILE +A+   +L +M+K ++ V  L E  P          
Sbjct  100  YRFHAIEPLKNFADSEKAQEILENLANDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVC  159

Query  55   LLGMNVNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTS  114
            +LG+N N G KI +RLR       F  F  +   + HEL H     H+  FY+L+ ++  
Sbjct  160  VLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVEK  218

Query  115  EMETL----MAQGLIGGLASLARSS  135
            E   L     +   IGG  ++ R  
Sbjct  219  ECNELDWTNSSGAAIGGSGAILRDD  243

>PHYRA_74151
Length=1127

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 9/112 (8%)

Query  16   QVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIY  67
             VD+A+ IL+++A+   +L +M K ++ V  L E  P          +LG+N N G KI 
Sbjct  153  DVDKAREILDKLANDRGILAVMDKHKWSVGVLAEMPPDGKVGVDPVCVLGLNQNKGQKIL  212

Query  68   VRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETL  119
            +RLR       F  F  +   + HEL H     H++ FY+L+ ++  E   L
Sbjct  213  LRLRTDDL-LGFRKFLSIKNVLFHELSHNVHSEHDSKFYQLMRQVEKECNEL  263

>PHYSO_249618
Length=485

 Score = 45.1 bits (105),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 9/109 (8%)

Query  19   EAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVRL  70
            +AQ ILE++A+   +L +M+K ++ V  L E  P          +LG+N N G KI +RL
Sbjct  142  KAQEILEKLANDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVCVLGLNQNKGQKILLRL  201

Query  71   RPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETL  119
            R       F  F  +   + HEL H     H++ FY+L+ ++ +E   L
Sbjct  202  RTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDSKFYQLMRQIENECNEL  249

>PYIW_21378
Length=496

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query  20   AQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLR  71
            A+ ILER+A+   +L +M K ++ V  L E  P          +LG+N N G KI +RLR
Sbjct  154  AREILERLANDRGILAVMDKHKWSVGTLAEMHPDGKVGVDPVCVLGLNQNKGQKILLRLR  213

Query  72   PAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETL  119
                   F  +  +   + HEL H     H++ FY+L+ ++  E   L
Sbjct  214  TDDL-LGFRKYLGIKKVLFHELTHNVHSEHDSKFYQLMRQVEKECSEL  260

>PHALS_09846
Length=481

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 72/151 (48%), Gaps = 13/151 (9%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------AN  54
            ++   I  L+     ++A  ILE++A+   +L +M+K ++ V  L E  P          
Sbjct  124  YRFHAIEPLENFADKEKAHEILEKLATDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVC  183

Query  55   LLGMNVNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDEL--  112
            +LG+N N G KI +RLR       F  +  +   + HEL H     H+  FY+L+ ++  
Sbjct  184  ILGLNQNKGQKILLRLR-TDDLLGFRKYLSIKKVLFHELSHNVHSEHDNKFYQLMRQVER  242

Query  113  -TSEMETLMAQG-LIGGLASLARSSKTLAKD  141
              SE++   + G ++GG  ++     T  K+
Sbjct  243  ECSELDWTQSGGSVVGGSPAIVEDDGTTLKN  273

>PITG_15925
Length=455

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 9/110 (8%)

Query  18   DEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVR  69
            ++AQ ILE++A+   +L +M+K ++ V  L E  P          +LG+N N G KI +R
Sbjct  139  NKAQEILEKLANDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVCVLGLNQNKGQKILLR  198

Query  70   LRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETL  119
            LR       F  F  +   + HEL H     H+  FY+L+ ++  E   L
Sbjct  199  LRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVERECSEL  247

>PYIR_18116
Length=532

 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 51/104 (49%), Gaps = 9/104 (9%)

Query  20   AQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLR  71
            A+ ILER+A+   +L +M K ++ V  L E  P          +LG+N N G KI +RLR
Sbjct  147  AREILERLANDRGILAVMDKHKWTVGTLAEMHPDGKVGVDPVCVLGLNQNKGQKILLRLR  206

Query  72   PAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSE  115
                   F  +  +   + HEL H     H++ FY L+ ++  E
Sbjct  207  TDDL-LGFRKYLSVKKVLFHELTHNVHSEHDSKFYTLMRQVEKE  249

>PYAR_14105
Length=494

 Score = 38.9 bits (89),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 68/168 (40%), Gaps = 37/168 (22%)

Query  2    EWQIPTIRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------A  53
            +++   I  L+       A+ ILE++A+   +L +M+K ++ V  L E +P         
Sbjct  130  DYRFHAIEVLENFTDAHRARSILEQLANDRGILAVMAKHKWSVGCLAEMYPDGKVGVDPV  189

Query  54   NLLGMNVNHGWKIYVRLRP------------------------AARPTSFLPFE-DLLGT  88
             +LG+N N G KI +RLR                         +    S   F   +   
Sbjct  190  CVLGLNQNKGQKILLRLRTDDLQGFRKFLKYAIFAERFLYPRFSKHSRSRFAFGYSIKKV  249

Query  89   MLHELVHMKIGPHNAAFYKLLDELTSEMETL----MAQGLIGGLASLA  132
            + HEL H     H++ FY+L+  +  E + L         +GG  S+A
Sbjct  250  LFHELSHNVHSEHDSQFYQLMRLVERECDELDWSNSGGRAVGGEGSIA  297

>PHYKE_6259
Length=230

 Score = 38.1 bits (87),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 8/69 (12%)

Query  11   LKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMNVNH  62
            LK+    D+A+ ILE++A+   +L +M+K ++ V  L E  P          +LG+N N 
Sbjct  129  LKQFADADKAREILEKLANDRGILAVMAKYKWSVGVLAEMPPDGKVGVDPVCVLGLNQNK  188

Query  63   GWKIYVRLR  71
            G KI +RLR
Sbjct  189  GQKILLRLR  197

>PPTG_12717
Length=496

 Score = 37.7 bits (86),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 60/147 (41%), Gaps = 31/147 (21%)

Query  3    WQIPTIRALKRQPQVDEAQRILERIASY--VLPIMSKRQY--------------------  40
            ++   I  LK     D+AQ ILER+A+   +L +M+K +Y                    
Sbjct  124  YRFHAIEPLKNFADKDKAQEILERLANDRGILAVMAKHKYVFFNSHCIYWTIWDADIVDG  183

Query  41   --RVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHE  92
               V  L E  P          +LG+N N G KI +RLR       F  F  +   + HE
Sbjct  184  RWSVGVLAEMPPDGKVGVDPVCVLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHE  242

Query  93   LVHMKIGPHNAAFYKLLDELTSEMETL  119
            L H     H+  FY+L+ ++  E   L
Sbjct  243  LSHNVHSEHDNKFYQLMRQVEKECNEL  269

>PYVX_17526
Length=521

 Score = 37.4 bits (85),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 68/156 (44%), Gaps = 24/156 (15%)

Query  8    IRALKRQPQVDEAQRILERIASY--VLPIMSKRQYRVQQLLEFFPKN------ANLLGMN  59
            I  L++    D+A+ IL ++A+   +L +M K ++ V  L E +P          +LG+N
Sbjct  141  IEVLEKFSDADKARDILNQLANDRGILAVMEKHKWSVGVLAEMYPDGKVGVDPVCVLGLN  200

Query  60   VNHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKI--------------GPHNAAF  105
             N G KI +RLR       F  +  +   + HEL H                   H++ F
Sbjct  201  QNKGQKILLRLR-TDDLLGFRKYLSIKKVLFHELSHNNSDRNQINAMLMVQVHSEHDSKF  259

Query  106  YKLLDELTSEMETLMAQGLIGGLASLARSSKTLAKD  141
            Y+L+ ++  E + L      GG A+   SS    +D
Sbjct  260  YQLMRQVERECDEL-DWTHSGGAATGGSSSSGAFED  294

>PHYCA_557065
Length=242

 Score = 31.2 bits (69),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 0/48 (0%)

Query  69   RLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEM  116
            R  P+  P+ +L  + +L  ML+E V      HN  + +L D+L S++
Sbjct  150  RATPSVLPSVYLKVDTMLANMLNEAVRSSQLEHNQQWQQLKDDLVSQL  197

>PYIR_19040
Length=558

 Score = 31.6 bits (70),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  11   LKRQPQVDEAQRILERIASYVLPIMSKRQ  39
            LK  P+VD +QRILE +AS V P    R+
Sbjct  489  LKHAPEVDTSQRILEFVASRVAPFKIVRE  517

>PPTG_08936
Length=136

 Score = 30.4 bits (67),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (55%), Gaps = 1/33 (3%)

Query  75   RPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYK  107
            R   F   ED+  T + + V M IGPH AAFY 
Sbjct  15   RHDEFSGLEDV-ATFMRDRVKMMIGPHGAAFYN  46

>PHYSO_511792
Length=246

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 0/48 (0%)

Query  69   RLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEM  116
            R +P+A P  ++    +L  ML+E V      HN  + +L D L S++
Sbjct  154  RTKPSAMPNVYMEVGTMLANMLNEAVRSSQLEHNRQWQELRDGLVSQL  201

>PYU1_G007927
Length=259

 Score = 30.4 bits (67),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  76   PTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEM  116
            P  ++  E LL +ML+E V      HNA + +  D L S+M
Sbjct  171  PNVYMEVETLLASMLNEAVRASHCEHNAKWRQYHDNLVSQM  211

>PYIR_24195
Length=344

 Score = 30.4 bits (67),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 27/44 (61%), Gaps = 3/44 (7%)

Query  11   LKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNAN  54
            LK  P+VD A++IL+ +AS + P    ++ R  + ++  PK+ +
Sbjct  276  LKHTPEVDTAKKILDFVASKIAPF---KKVREVEFIDAIPKSVS  316

>SPRG_04158
Length=579

 Score = 30.4 bits (67),  Expect = 4.8, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 1/33 (3%)

Query  9   RALKRQPQVDEAQRILERIASYVLPIMSKRQYR  41
           R L RQP  +E  RIL RI   + P MSK+Q++
Sbjct  35  RQLVRQP-TEELSRILVRIDRLLHPPMSKQQFK  66

>H310_07927
Length=262

 Score = 30.0 bits (66),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query  24   LERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNHGWKIYVRLRPAARPTSFLPFE  83
            L ++A+YV P+  K +  V ++ E       L      HGW + V  +   R T FLPF+
Sbjct  143  LMKLANYV-PLTRKNKTSVLRMFE-------LAKDRFAHGWSVVVFPQGTRRRTEFLPFK  194

Query  84   D  84
            D
Sbjct  195  D  195

>PYAR_17357
Length=1121

 Score = 30.0 bits (66),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (49%), Gaps = 10/72 (14%)

Query  72   PAARPTS---FLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLMAQGLIGGL  128
            P A P S   FL  E +   +LH+ V +    H+ A Y LLD + +E+E        GG 
Sbjct  779  PIALPLSNSRFLAIEYITQVILHDRVSVAPRLHDDAVYLLLDAIHAELEN-------GGT  831

Query  129  ASLARSSKTLAK  140
            AS + +   LA+
Sbjct  832  ASSSTALSPLAR  843

>PYIR_24197
Length=392

 Score = 29.6 bits (65),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 3/42 (7%)

Query  11   LKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKN  52
            LK  P+VD A++IL+ +AS V P    R+    + ++  PK+
Sbjct  324  LKHTPEVDTAKKILDFVASKVAPFKIVREV---EFIDAIPKS  362

>PHYKE_1491
Length=728

 Score = 29.6 bits (65),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  71   RPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEM  116
            +P+  P++FL  + LLG+ML E V       N  + +L D++  ++
Sbjct  497  KPSTLPSAFLEADTLLGSMLTEAVRAAQLEQNGRWQELRDDVVPQL  542

>PYVX_13372
Length=1405

 Score = 29.6 bits (65),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  87   GTMLHELVHMKIGPHNAA--FYKLLDELTSEMETLMAQGLIGGLASLARSSKTL  138
            G+ + +L  + IG   AA      LDE TS +++  A+ ++ G+  +ARS +T+
Sbjct  935  GSSMEQLKRLTIGVELAAQPSVLFLDEPTSGLDSFSAKAIMDGVQKVARSGRTV  988

>PHYCA_120484
Length=329

 Score = 29.3 bits (64),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 44/94 (47%), Gaps = 14/94 (15%)

Query  23   ILERIA-SYVLPIMSKRQYRVQQLLEFFPKNANLLGMNVNHGWKIYVRLRPA-----ARP  76
            + ERIA S V P M + QYR+   L  FP      GM +  G  +  R+R       AR 
Sbjct  110  LFERIAESGVAPSMLRVQYRMHPFLRDFPSKRFYGGM-LTDGPSVMERVRKVCPGVYAR-  167

Query  77   TSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLD  110
            TSF PF      +L+++ + +    N + Y  ++
Sbjct  168  TSFQPF------LLYDVSNSREEDMNGSKYNRVE  195

Lambda      K        H        a         alpha
   0.324    0.137    0.402    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4897064448

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40