Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_140931114928728713640.0
H310_11728111492912747041e-91
H257_12786111492782786952e-90
SPRG_03281111491531266553e-86
PYIW_14749111493142215462e-67
PYAP_24882111491791414872e-60
PYIR_15197111492842114806e-58
PHYCA_60964111491771754602e-56
PYAR_22689111493041414592e-54
CCA17990111492832504251e-49
PHYSO_315015111492061864163e-49
PITG_13744111491781753752e-43
PHYRA_81677111491731413412e-38
PYU1_G00596511149117943004e-33
PHYKE_64081114991682366e-24
PPTG_09254111493071432402e-22
H310_14476128364901491312e-07
SDRG_14076128364711201302e-07
PYU1_G000982128365281271241e-06
SPRG_09603128364671201187e-06
H310_04812159053703891198e-06
PHYSO_249618128364851981161e-05
PHYCA_505767128364601601142e-05
H257_13329128364451041107e-05
PYAR_14105128364942231044e-04
PHYRA_741511283511271121036e-04
PITG_15925128364551491018e-04
PYIW_2137812836496126990.002
PHALS_0984612836481159950.005
H310_0024210697392553940.009
PYIR_1811612836532122930.011
PPTG_1271712836496182920.011
H257_02435227540958910.014
PYAP_13463208110051920.015
CCA181442240274888910.021
PYVX_1752612836521134900.022
PYU1_G0112946096283936900.025
SDRG_13591134249216977900.026
H257_0674110697393253890.034
PHYKE_62591283623069870.036
SDRG_0218313428323023860.048
SPRG_0028712224097227880.049
PYAR_2050110401219527850.056
PYAR_21511657140053850.073
PYIR_1879315905461442860.082
PYU1_G00864915905155024860.094
CCA14621337060341850.10
PYVX_178965408506629850.11
HYAP_061676403116130810.14
PYIR_18271657142227830.16
PPTG_010739447029021820.16
PYIW_20348292862929830.17
SPRG_20584134249212261830.17
PYIW_1470465835131547830.20
HYAP_079381634241059820.20
CCA19146439753340820.21
PYIW_143006096292021830.21
PHALS_128945408722143820.24
PHYSO_3292151684129825820.25
PYU1_G011459657145721810.25
PPTG_08367657140837810.29
SDRG_10426439748623810.31
PYIR_1896510697424747810.32
PHYRA_763188843197723810.34
PYAP_143466096251327810.37
H257_110461634245229800.39
H310_02310227532626790.39
PYVX_173546096279655800.40
PHYKE_8603168458922800.43
H310_076661684105524800.44
SPRG_10085439746322790.44
SDRG_0572412337269429800.44
PPTG_132595408500934800.48
PYIR_132986096296730800.48
PYAR_2467220875935790.48
PITG_07879657136345780.59
H257_0314215905379143790.62
SDRG_12446134465493621790.63
PYVX_21442208111575780.72
PYU1_G00039410697114747780.73
PYVX_1828310697429343780.77
SPRG_046802240237627780.77
SPRG_2009010697405857780.81
PPTG_124691634243626770.83
PHYSO_5570281306974524770.83
PITG_025612240262226780.86
PYVX_170879447011020720.91
PYAR_1814315905217856770.93
PHYSO_31799617505105721770.94
SPRG_0085715905304025770.94
PYVX_15183657145820770.96
H257_0753013167137138760.96
PYVX_183832240276654771.0
PYIW_173595408502429771.0
PHYSO_4540285596384021771.0
SDRG_075662240239227771.0
PYIW_151441306974332761.2
PHYSO_3122076096256120771.2
CCI42575244330123751.2
PHYSO_4759572240265626761.2
PITG_162141306977724761.3
PITG_072306096255020761.3
PPTG_042146096272020761.3
CCA173928739165321761.3
CCA24367156328165321761.3
SDRG_1068913495961439761.4
PYVX_1763015905220528761.4
PYIW_1634815905461036761.5
CCI425692240373724761.6
PYAP_179531306973936751.6
PHYCA_123901657137421741.7
SPRG_2222213495957939751.7
PHYSO_528227657137420741.8
PHALS_054768739196323751.8
PYIW_202652240268238751.9
PYIW_20430346832625741.9
PPTG_052962240268341751.9
CCI1172215960047444742.0
PYU1_G008514244353138742.0
PYIR_212761306973031742.0
H310_023965408455425742.2
H310_02399337060736742.2
PYIW_190611684121528742.2
PHYCA_5066441069779945742.4
H257_143452240249434742.4
PITG_2285717505103621742.4
PHALS_091551306970421742.5
PYAR_21038137668976732.5
PYIR_21711337079128742.5
PITG_064295408481434742.5
PHYRA_84590168499523732.6
SPRG_21096134465396331742.6
PHYSO_31713610697432544742.8
PITG_05170439756624732.8
HYAP_068176435411642692.8
PYIR_20354439751626732.8
PYU1_G0056358188579732732.8
PYIR_18820226065925733.0
PITG_1316810697428445733.0
PYIR_142218188584930733.0
SDRG_0362112224097927733.1
PHYCA_5434261306974324733.1
PHYSO_3618665408583629733.3
PYAP_2476310148266750723.4
PYVX_19970435861947723.4
SPRG_1718213202921729713.6
PYIW_17005337078528723.8
SDRG_0144215905366022723.8
PPTG_007358448371786723.9
H257_074281684106928724.0
PYAP_1679610697427824724.1
PHALS_102551634243223714.2
SDRG_117185408440727724.3
H257_0503514036843722714.3
PHALS_05049996150945714.5
H257_121216096210222724.5
H310_04559134465492224724.5
HYAP_046192240271239724.5
H257_12440244342529714.6
PYU1_G0037521272952024714.7
PYVX_23057132839424664.8
HYAP_107221684126120714.9
SDRG_1278710697407156724.9
PHYCA_56894620887626714.9
PYIW_186808188575530714.9
SPRG_120591684101522715.1
H310_0794714274763424715.1
HYAP_017751306976524715.1
PYIR_24101806741493715.1
PYIR_22040244345727715.2
SDRG_050551684101522715.2
H310_056801328310426665.3
SDRG_07504128851109727715.3
PHYCA_5570651178824265695.5
PPTG_1752375373965715.6
PPTG_181932421914624685.6
H257_12425218670622715.6
PHYCA_541576439758324705.6
PYIW_20686244352621705.7
H257_015301738166639715.7
PPTG_1223910697432221715.7
PHALS_11109208107337715.8
PYAP_163291684120123715.8
H310_118982240242826715.9
SPRG_12726128851108927716.0
PYIR_2296284306136639716.0
H310_05197244341034706.0
PYAP_14575891962443706.1
PITG_00223208107642716.1
PYAP_134012240205427716.1
PHALS_06460292872839706.1
HYAP_095986583584042706.1
PPTG_18194439753424706.1
PHYRA_9467913465443121706.3
PYAP_191279942164947706.4
H257_0153914919766139706.5
PPTG_14855292876032706.5
PPTG_057001306974424706.6
H310_11750316591027706.9
PPTG_10950208107926707.1
PHALS_12522349587531647.3
H310_1338213428324138687.4
PYAR_131768274621103707.4
PYAR_153851069649754697.6
PYVX_216258188578530707.6
SPRG_1644413143062927697.8
H310_012651272943030697.8
PPTG_06518337068723697.8
CCA232376096217924707.9
PPTG_1928517505111520708.1
SDRG_01371244344328698.1
PYAP_15290435870134698.3
PYU1_G004545226066525698.4
PYAR_18001226066826698.7
SDRG_11726337066922698.7
H310_12417657126831688.7
PHYSO_4927701322918422678.9
PITG_164941328310227649.1
PYU1_G0041019399816289679.2
H257_016431306969620699.7
H310_118571634245222689.7
SPRG_21525134654111944699.8
PYAR_13796337072722699.9
PYVX_211561306977424699.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_14093

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDRG_14093                                                            530     0.0  
H310_11728                                                            275     1e-91
H257_12786                                                            272     2e-90
SPRG_03281                                                            256     3e-86
PYIW_14749                                                            214     2e-67
PYAP_24882                                                            192     2e-60
PYIR_15197                                                            189     6e-58
PHYCA_60964                                                           181     2e-56
PYAR_22689                                                            181     2e-54
CCA17990                                                              168     1e-49
PHYSO_315015                                                          164     3e-49
PITG_13744                                                            149     2e-43
PHYRA_81677                                                           135     2e-38
PYU1_G005965                                                          120     4e-33
PHYKE_6408                                                            95.5    6e-24
PPTG_09254                                                            97.1    2e-22
H310_14476                                                            55.1    2e-07
SDRG_14076                                                            54.7    2e-07
PYU1_G000982                                                          52.4    1e-06
SPRG_09603                                                            50.1    7e-06
H310_04812                                                            50.4    8e-06
PHYSO_249618                                                          49.3    1e-05
PHYCA_505767                                                          48.5    2e-05
H257_13329                                                            47.0    7e-05
PYAR_14105                                                            44.7    4e-04
PHYRA_74151                                                           44.3    6e-04
PITG_15925                                                            43.5    8e-04
PYIW_21378                                                            42.7    0.002
PHALS_09846                                                           41.2    0.005
H310_00242                                                            40.8    0.009
PYIR_18116                                                            40.4    0.011
PPTG_12717                                                            40.0    0.011
H257_02435                                                            39.7    0.014
PYAP_13463                                                            40.0    0.015
CCA18144                                                              39.7    0.021
PYVX_17526                                                            39.3    0.022
PYU1_G011294                                                          39.3    0.025
SDRG_13591                                                            39.3    0.026
H257_06741                                                            38.9    0.034
PHYKE_6259                                                            38.1    0.036
SDRG_02183                                                            37.7    0.048
SPRG_00287                                                            38.5    0.049
PYAR_20501                                                            37.4    0.056
PYAR_21511                                                            37.4    0.073
PYIR_18793                                                            37.7    0.082
PYU1_G008649                                                          37.7    0.094
CCA14621                                                              37.4    0.10 
PYVX_17896                                                            37.4    0.11 
HYAP_06167                                                            35.8    0.14 
PYIR_18271                                                            36.6    0.16 
PPTG_01073                                                            36.2    0.16 
PYIW_20348                                                            36.6    0.17 
SPRG_20584                                                            36.6    0.17 
PYIW_14704                                                            36.6    0.20 
HYAP_07938                                                            36.2    0.20 
CCA19146                                                              36.2    0.21 
PYIW_14300                                                            36.6    0.21 
PHALS_12894                                                           36.2    0.24 
PHYSO_329215                                                          36.2    0.25 
PYU1_G011459                                                          35.8    0.25 
PPTG_08367                                                            35.8    0.29 
SDRG_10426                                                            35.8    0.31 
PYIR_18965                                                            35.8    0.32 
PHYRA_76318                                                           35.8    0.34 
PYAP_14346                                                            35.8    0.37 
H257_11046                                                            35.4    0.39 
H310_02310                                                            35.0    0.39 
PYVX_17354                                                            35.4    0.40 
PHYKE_8603                                                            35.4    0.43 
H310_07666                                                            35.4    0.44 
SPRG_10085                                                            35.0    0.44 
SDRG_05724                                                            35.4    0.44 
PPTG_13259                                                            35.4    0.48 
PYIR_13298                                                            35.4    0.48 
PYAR_24672                                                            35.0    0.48 
PITG_07879                                                            34.7    0.59 
H257_03142                                                            35.0    0.62 
SDRG_12446                                                            35.0    0.63 
PYVX_21442                                                            34.7    0.72 
PYU1_G000394                                                          34.7    0.73 
PYVX_18283                                                            34.7    0.77 
SPRG_04680                                                            34.7    0.77 
SPRG_20090                                                            34.7    0.81 
PPTG_12469                                                            34.3    0.83 
PHYSO_557028                                                          34.3    0.83 
PITG_02561                                                            34.7    0.86 
PYVX_17087                                                            32.3    0.91 
PYAR_18143                                                            34.3    0.93 
PHYSO_317996                                                          34.3    0.94 
SPRG_00857                                                            34.3    0.94 
PYVX_15183                                                            34.3    0.96 
H257_07530                                                            33.9    0.96 
PYVX_18383                                                            34.3    1.0  
PYIW_17359                                                            34.3    1.0  
PHYSO_454028                                                          34.3    1.0  
SDRG_07566                                                            34.3    1.0  
PYIW_15144                                                            33.9    1.2  
PHYSO_312207                                                          34.3    1.2  
CCI42575                                                              33.5    1.2  
PHYSO_475957                                                          33.9    1.2  
PITG_16214                                                            33.9    1.3  
PITG_07230                                                            33.9    1.3  
PPTG_04214                                                            33.9    1.3  
CCA17392                                                              33.9    1.3  
CCA24367                                                              33.9    1.3  
SDRG_10689                                                            33.9    1.4  
PYVX_17630                                                            33.9    1.4  
PYIW_16348                                                            33.9    1.5  
CCI42569                                                              33.9    1.6  
PYAP_17953                                                            33.5    1.6  
PHYCA_123901                                                          33.1    1.7  
SPRG_22222                                                            33.5    1.7  
PHYSO_528227                                                          33.1    1.8  
PHALS_05476                                                           33.5    1.8  
PYIW_20265                                                            33.5    1.9  
PYIW_20430                                                            33.1    1.9  
PPTG_05296                                                            33.5    1.9  
CCI11722                                                              33.1    2.0  
PYU1_G008514                                                          33.1    2.0  
PYIR_21276                                                            33.1    2.0  
H310_02396                                                            33.1    2.2  
H310_02399                                                            33.1    2.2  
PYIW_19061                                                            33.1    2.2  
PHYCA_506644                                                          33.1    2.4  
H257_14345                                                            33.1    2.4  
PITG_22857                                                            33.1    2.4  
PHALS_09155                                                           33.1    2.5  
PYAR_21038                                                            32.7    2.5  
PYIR_21711                                                            33.1    2.5  
PITG_06429                                                            33.1    2.5  
PHYRA_84590                                                           32.7    2.6  
SPRG_21096                                                            33.1    2.6  
PHYSO_317136                                                          33.1    2.8  
PITG_05170                                                            32.7    2.8  
HYAP_06817                                                            31.2    2.8  
PYIR_20354                                                            32.7    2.8  
PYU1_G005635                                                          32.7    2.8  
PYIR_18820                                                            32.7    3.0  
PITG_13168                                                            32.7    3.0  
PYIR_14221                                                            32.7    3.0  
SDRG_03621                                                            32.7    3.1  
PHYCA_543426                                                          32.7    3.1  
PHYSO_361866                                                          32.7    3.3  
PYAP_24763                                                            32.3    3.4  
PYVX_19970                                                            32.3    3.4  
SPRG_17182                                                            32.0    3.6  
PYIW_17005                                                            32.3    3.8  
SDRG_01442                                                            32.3    3.8  
PPTG_00735                                                            32.3    3.9  
H257_07428                                                            32.3    4.0  
PYAP_16796                                                            32.3    4.1  
PHALS_10255                                                           32.0    4.2  
SDRG_11718                                                            32.3    4.3  
H257_05035                                                            32.0    4.3  
PHALS_05049                                                           32.0    4.5  
H257_12121                                                            32.3    4.5  
H310_04559                                                            32.3    4.5  
HYAP_04619                                                            32.3    4.5  
H257_12440                                                            32.0    4.6  
PYU1_G003752                                                          32.0    4.7  
PYVX_23057                                                            30.0    4.8  
HYAP_10722                                                            32.0    4.9  
SDRG_12787                                                            32.3    4.9  
PHYCA_568946                                                          32.0    4.9  
PYIW_18680                                                            32.0    4.9  
SPRG_12059                                                            32.0    5.1  
H310_07947                                                            32.0    5.1  
HYAP_01775                                                            32.0    5.1  
PYIR_24101                                                            32.0    5.1  
PYIR_22040                                                            32.0    5.2  
SDRG_05055                                                            32.0    5.2  
H310_05680                                                            30.0    5.3  
SDRG_07504                                                            32.0    5.3  
PHYCA_557065                                                          31.2    5.5  
PPTG_17523                                                            32.0    5.6  
PPTG_18193                                                            30.8    5.6  
H257_12425                                                            32.0    5.6  
PHYCA_541576                                                          31.6    5.6  
PYIW_20686                                                            31.6    5.7  
H257_01530                                                            32.0    5.7  
PPTG_12239                                                            32.0    5.7  
PHALS_11109                                                           32.0    5.8  
PYAP_16329                                                            32.0    5.8  
H310_11898                                                            32.0    5.9  
SPRG_12726                                                            32.0    6.0  
PYIR_22962                                                            32.0    6.0  
H310_05197                                                            31.6    6.0  
PYAP_14575                                                            31.6    6.1  
PITG_00223                                                            32.0    6.1  
PYAP_13401                                                            32.0    6.1  
PHALS_06460                                                           31.6    6.1  
HYAP_09598                                                            31.6    6.1  
PPTG_18194                                                            31.6    6.1  
PHYRA_94679                                                           31.6    6.3  
PYAP_19127                                                            31.6    6.4  
H257_01539                                                            31.6    6.5  
PPTG_14855                                                            31.6    6.5  
PPTG_05700                                                            31.6    6.6  
H310_11750                                                            31.6    6.9  
PPTG_10950                                                            31.6    7.1  
PHALS_12522                                                           29.3    7.3  
H310_13382                                                            30.8    7.4  
PYAR_13176                                                            31.6    7.4  
PYAR_15385                                                            31.2    7.6  
PYVX_21625                                                            31.6    7.6  
SPRG_16444                                                            31.2    7.8  
H310_01265                                                            31.2    7.8  
PPTG_06518                                                            31.2    7.8  
CCA23237                                                              31.6    7.9  
PPTG_19285                                                            31.6    8.1  
SDRG_01371                                                            31.2    8.1  
PYAP_15290                                                            31.2    8.3  
PYU1_G004545                                                          31.2    8.4  
PYAR_18001                                                            31.2    8.7  
SDRG_11726                                                            31.2    8.7  
H310_12417                                                            30.8    8.7  
PHYSO_492770                                                          30.4    8.9  
PITG_16494                                                            29.3    9.1  
PYU1_G004101                                                          30.4    9.2  
H257_01643                                                            31.2    9.7  
H310_11857                                                            30.8    9.7  
SPRG_21525                                                            31.2    9.8  
PYAR_13796                                                            31.2    9.9  
PYVX_21156                                                            31.2    9.9  

>SDRG_14093
Length=287

 Score = 530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/287 (100%), Positives = 287/287 (100%), Gaps = 0/287 (0%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV
Sbjct  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM
Sbjct  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120

Query  121  AQGLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRMRHQALVGANGSCRLGGDAS  180
            AQGLIGITGAQFQNAGQGHALGGANARNVAKAAADAAIQRMRHQALVGANGSCRLGGDAS
Sbjct  121  AQGLIGITGAQFQNAGQGHALGGANARNVAKAAADAAIQRMRHQALVGANGSCRLGGDAS  180

Query  181  ATAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLND  240
            ATAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLND
Sbjct  181  ATAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLND  240

Query  241  ERQSVCAMCGAGTKKRKRSMGAVVNLaaspprpprqppgapTVIDLT  287
            ERQSVCAMCGAGTKKRKRSMGAVVNLAASPPRPPRQPPGAPTVIDLT
Sbjct  241  ERQSVCAMCGAGTKKRKRSMGAVVNLAASPPRPPRQPPGAPTVIDLT  287

>H310_11728
Length=291

 Score = 275 bits (704),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/274 (56%), Positives = 186/274 (68%), Gaps = 27/274 (10%)

Query  2    EWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVN  61
            EW IPTI+ LKRQS+ DEAQRILERIA +VLPI TKRQ++V+ LLEFFPKN NLLGMNVN
Sbjct  6    EWMIPTIQVLKRQSKKDEAQRILERIADHVLPICTKRQFKVRNLLEFFPKNGNLLGMNVN  65

Query  62   HGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMA  121
             GWKI++RLRPA +PT+FLPFE +LGTMLHELVHMKIGPHNA+FYK+LDELT EME+L+ 
Sbjct  66   QGWKIFLRLRPASQPTTFLPFEDILGTMLHELVHMKIGPHNASFYKMLDELTREMENLLE  125

Query  122  QGLIGITGAQFQNAGQGHALGGana--rnvakaaadaaIQRMRHQALVGANGSCRLGGDA  179
            +GL+G  GA FQ+AG G +LGG +     V++  A AA+ R +HQA++  N   RLGG  
Sbjct  126  RGLLGAAGAAFQDAGNGQSLGGMHVLPSQVSRVRASAALNRQKHQAIMSTN---RLGG--  180

Query  180  SATAASLTPAMLRQKALKAAERRRHDQLTCG----THDE--PSRQIGEAAP-----EPYD  228
            SA AAS     LR K L+AAE+R  D   C     TH++  PS   G+  P     E ++
Sbjct  181  SAVAAS----DLRAKMLEAAEKRLLDSRACANITCTHEKSVPSTPAGQPHPTNTTREQFN  236

Query  229  G-----WSCDQCTFLNDERQSVCAMCGAGTKKRK  257
                  W C  CTF N      C MC     KRK
Sbjct  237  DDDDIEWQCPHCTFWNKTTADACEMCQTRLSKRK  270

>H257_12786
Length=278

 Score = 272 bits (695),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 189/278 (68%), Gaps = 31/278 (11%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            MEW IPTI+ALK+Q++ DEAQRILERIA +VLPI TKR+++V+ LLEFFPKNANLLGMNV
Sbjct  1    MEWTIPTIQALKKQTKNDEAQRILERIAEHVLPICTKRRFKVRNLLEFFPKNANLLGMNV  60

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            N GWKI++RLRPA  PT+FLPFE +LGTMLHELVHMKIGPH+A+FYK+LDELT +ME+LM
Sbjct  61   NEGWKIFLRLRPASHPTTFLPFEEILGTMLHELVHMKIGPHDASFYKMLDELTEDMENLM  120

Query  121  AQGLIGITGAQFQNAGQGHALGGana--rnvakaaadaaIQRMRHQALVGANGSCRLGGD  178
            A+GL+G TGA FQ+ G G +LGG       +A   A AA +R++HQA++  N   RLGG 
Sbjct  121  ARGLLGATGAAFQDTGDGQSLGGTRVLPSQLASVRAAAAAKRIQHQAIMSTN---RLGG-  176

Query  179  ASATAASLTPAMLRQKALKAAERRRHDQLTCG----THDEPSRQIGEAA---------PE  225
                 AS++P+ LR K L+AAE+R  D + C     THD PS     A           E
Sbjct  177  -----ASISPSQLRGKVLEAAEKRLRDAVACATVTCTHDVPSSSQTHAPNHIKPIVCIQE  231

Query  226  PYDG-----WSCDQCTFLNDERQSVCAMCGAGTKKRKR  258
             YD      W C  C+  +    S   +C +  +KRKR
Sbjct  232  EYDEQDAIQWQCPTCSEWHS--TSRLHICDSVLRKRKR  267

>SPRG_03281
Length=153

 Score = 256 bits (655),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/126 (96%), Positives = 123/126 (98%), Gaps = 0/126 (0%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            MEWQIPTIRALKRQ QVDEAQRILERIASYVLPIM+KRQYRVQQLLEFFPKNANLLGMNV
Sbjct  1    MEWQIPTIRALKRQPQVDEAQRILERIASYVLPIMSKRQYRVQQLLEFFPKNANLLGMNV  60

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            NHGWKIYVRLRPA RPTSFLPFE LLGTMLHELVHMKIGPHNAAFYKLLDELTSEME+LM
Sbjct  61   NHGWKIYVRLRPAARPTSFLPFEDLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMETLM  120

Query  121  AQGLIG  126
            AQGLIG
Sbjct  121  AQGLIG  126

>PYIW_14749
Length=314

 Score = 214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 153/221 (69%), Gaps = 14/221 (6%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            M ++I  +RAL R+ + DEAQ++LERIAS+VLPI+T+R++RV +L EFFP +A+LLGMNV
Sbjct  1    MSFKIGEVRALVRRPRRDEAQQLLERIASHVLPILTQRRFRVLRLQEFFPTSAHLLGMNV  60

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            N G+KIY+RLRPA +P +F PFE LL TMLHEL HM  GPHN AFYK LDEL +EME+LM
Sbjct  61   NRGYKIYLRLRPAAQPAAFYPFEALLETMLHELTHMVHGPHNQAFYKYLDELKTEMEALM  120

Query  121  AQGLIGITGAQFQNAGQGHALGGanarnvakaaadaaI-----QRMRHQALVGANGSCRL  175
             QGLIG  GA+F +AG+G  +  + + +V     +AA      +R ++Q L+G   S RL
Sbjct  121  IQGLIGAEGAKFHSAGEGRVIKASRSISVRFQNDNAAAVLVAKRRAQYQQLLGDQTSQRL  180

Query  176  GGDASATAASLTPAM------LRQKALKAAERRRHDQLTCG  210
            G   S T   LTP+       LR+K L+AAERRR D   C 
Sbjct  181  G---SRTGVDLTPSSLMPPDELRRKMLEAAERRRQDNERCS  218

>PYAP_24882
Length=179

 Score = 192 bits (487),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 0/141 (0%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            M ++IP +RAL R+ + ++AQR+LERIA+ VLPI++KR++RV+ L EFFPK+  LLGMNV
Sbjct  7    MTFEIPDVRALVRRPEREQAQRLLERIAAQVLPILSKRRFRVRCLREFFPKDGQLLGMNV  66

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            N G  IY+RLRPA RPTSF P+E LL TMLHEL HM  GPHN AFYK LDEL  EMESLM
Sbjct  67   NRGATIYIRLRPASRPTSFFPYEALLETMLHELTHMVHGPHNQAFYKYLDELKEEMESLM  126

Query  121  AQGLIGITGAQFQNAGQGHAL  141
             +GL+G  GA+FQ+AGQ +++
Sbjct  127  TRGLVGHEGARFQDAGQAYSI  147

>PYIR_15197
Length=284

 Score = 189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 128/211 (61%), Gaps = 34/211 (16%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            M ++I  +RAL R+ + DEAQ++L+RIAS+VLPI+ +R++RV +L EFFP NA+LLGMNV
Sbjct  1    MSFEILEVRALVRRPRRDEAQQLLDRIASHVLPILAQRRFRVLRLQEFFPTNAHLLGMNV  60

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            N G KIY+RLRPA RP SFLPFE LL TMLHEL HM  GPHN AFY  LDEL  EME+LM
Sbjct  61   NRGIKIYLRLRPAARPESFLPFEALLETMLHELTHMVHGPHNQAFYNYLDELKMEMEALM  120

Query  121  AQGLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRMRHQALVGANGSCRLGGDAS  180
             + L+G  GA+F +AG+G                               N +  L     
Sbjct  121  IRDLLGTEGAKFHSAGEGR----------------------------NDNAAAVLA----  148

Query  181  ATAASLTPAMLRQKALKAAERRRHDQLTCGT  211
              A       LR+K L+AAERRR D   C T
Sbjct  149  --AKHREQDQLRRKMLEAAERRRQDNECCTT  177

>PHYCA_60964
Length=177

 Score = 181 bits (460),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 128/175 (73%), Gaps = 1/175 (1%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVNH  62
            + I  I+AL RQ Q ++AQR+LER+A+ VLPIMT+R++RV++LLEFFPK+  LLGMNVN 
Sbjct  3    YAITEIKALVRQPQREDAQRLLERLAAAVLPIMTRRRFRVRRLLEFFPKDGALLGMNVNR  62

Query  63   GWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQ  122
            G KIYVRLRP   P SF  +E LLGT+LHEL HM  GPHN AFYK LDEL  +MESLM +
Sbjct  63   GAKIYVRLRPQRNPESFYSYEELLGTLLHELTHMVHGPHNQAFYKYLDELKHDMESLMVR  122

Query  123  GLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRM-RHQALVGANGSCRLG  176
            GL+G  GA+F  AG+GH LGG++     + AA  A +R  ++ +L+G   S RLG
Sbjct  123  GLVGEEGAKFSEAGEGHRLGGSSVGVPIRVAAVLAAKRREQYHSLLGGETSRRLG  177

>PYAR_22689
Length=304

 Score = 181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 6/141 (4%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            ME++IP +RAL R++  D AQR+LE+IA  VLPI+TKR++RV++L EFFP +ANLLGMNV
Sbjct  1    MEFEIPVVRALVRRADRDAAQRLLEKIALQVLPILTKRRFRVKRLHEFFPSDANLLGMNV  60

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            N G  IY+RLRP  RP SFLP+E LL TMLHEL HM  GPHN AFYK       E+ESLM
Sbjct  61   NRGATIYIRLRPQHRPESFLPYEALLETMLHELTHMVHGPHNQAFYK------DEVESLM  114

Query  121  AQGLIGITGAQFQNAGQGHAL  141
             +GL G  GA+FQ+AG G+++
Sbjct  115  LRGLTGHEGARFQDAGDGYSI  135

>CCA17990
Length=283

 Score = 168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 143/250 (57%), Gaps = 9/250 (4%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVNH  62
            +++  I+AL +Q    +AQR+L+R+A  ++PI+TK +++V+ L EFFPK+A LLGMN+N 
Sbjct  4    YEVEAIKALAKQRNPTQAQRLLKRLADQIVPILTKHKFQVRHLQEFFPKDARLLGMNLNR  63

Query  63   GWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQ  122
            GWK+++RLRP+ +P +F P+E LL T+LHEL H   G H+ AFYK   +L  E E LM  
Sbjct  64   GWKVFIRLRPSRKPDTFYPYEALLETLLHELTHNVYGQHDEAFYKFFAQLKKEAEDLMMN  123

Query  123  GLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRMRHQALVGANGSCRL--GGDAS  180
            GL G +GA F  +G+GH L   +          A    +R +  +    S     G D  
Sbjct  124  GLSGRSGALFMGSGRGHVLQPNSTSAGDYRHKAALAADIRAKRTLLTKRSAHFLQGLDGQ  183

Query  181  A-TAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLN  239
            A      TP+ LR+KA +AA++RR D + C   ++ S      A      W C QCTF N
Sbjct  184  ARKQPKFTPSQLREKAYEAAKKRRLDAMQCVIVEDSSDTTALTA------WICSQCTFRN  237

Query  240  DERQSVCAMC  249
             +  + C MC
Sbjct  238  LKDNTYCEMC  247

>PHYSO_315015
Length=206

 Score = 164 bits (416),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 3/186 (2%)

Query  3    WQIPTIRALKRQSQVDEA--QRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNV  60
            + IP ++AL RQ Q   A  Q++LER+A+ VLPI+TKR++RV+ LLEFFPK+  LLGMNV
Sbjct  5    FAIPEVKALVRQPQPQRARAQQLLERLAAAVLPILTKRRFRVRWLLEFFPKDGCLLGMNV  64

Query  61   NHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLM  120
            N G KIYVRLRP   P SFLP+E LL T+LHEL HM  GPHN AFY+ LDEL  EMESLM
Sbjct  65   NRGAKIYVRLRPQRSPQSFLPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLM  124

Query  121  AQGLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRM-RHQALVGANGSCRLGGDA  179
             +GL+G  GA+F +AG G  LGG +A    + AA  A +R  ++ +L+G   S RLG + 
Sbjct  125  VRGLVGEEGAKFADAGAGQRLGGNSAGVPIRVAAVLAAKRREQYHSLLGGETSRRLGSNT  184

Query  180  SATAAS  185
            S    S
Sbjct  185  SNGTTS  190

>PITG_13744
Length=178

 Score = 149 bits (375),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 1/175 (1%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVNH  62
            + I  I+AL RQ Q  +AQ++LER+A+ VLPI+T+R++ V++L EFFPK+  LLGMNVN 
Sbjct  4    FAIAEIKALVRQPQRVQAQQLLERLAAAVLPILTRRRFHVRRLHEFFPKDGALLGMNVNR  63

Query  63   GWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQ  122
            G KIYVRLR    P +F P+E LL T+LHEL HM  GPHN AFY  L+EL +EMESLM +
Sbjct  64   GAKIYVRLRLKHAPDTFYPYEALLETLLHELTHMVHGPHNEAFYTYLEELKAEMESLMVR  123

Query  123  GLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRM-RHQALVGANGSCRLG  176
            GL+G  GA+F +AG G  LGG+     A+ AA  A +R  ++ +L+G   + RLG
Sbjct  124  GLVGEEGAKFADAGTGQRLGGSRVSAPARVAAVLAAKRREQYTSLLGGKINHRLG  178

>PHYRA_81677
Length=173

 Score = 135 bits (341),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 103/141 (73%), Gaps = 0/141 (0%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVNH  62
            +    ++AL  + Q ++AQ++LER+A+ VLPI+T+R++RV++LLEFFP +  LLGMNVN 
Sbjct  5    FAFAEVKALVLRRQREQAQQLLERLAAAVLPILTRRRFRVRRLLEFFPTDGALLGMNVNR  64

Query  63   GWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQ  122
            G KIYVRLRP   P SF P+E LL T+LHEL HM  GPHN AFY+ LDEL  EMESLM +
Sbjct  65   GAKIYVRLRPKRTPESFYPYEALLETLLHELTHMVHGPHNQAFYQYLDELKQEMESLMVR  124

Query  123  GLIGITGAQFQNAGQGHALGG  143
            GL G    +F +AG G  LGG
Sbjct  125  GLEGQEAVKFADAGAGQRLGG  145

>PYU1_G005965
Length=117

 Score = 120 bits (300),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVNH  62
            + I  +RAL R+ + D+AQ++LE+IA++VLPI+T+R +RV++L EFFP N +LLGMNVN 
Sbjct  12   FAIGKVRALVRRPRRDDAQKLLEQIAAHVLPILTQRCFRVRRLQEFFPTNPHLLGMNVNK  71

Query  63   GWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHM  96
            G KIY+RLRPA  P +F PFE LL TMLHEL HM
Sbjct  72   GVKIYIRLRPANAPGTFFPFEALLETMLHELTHM  105

>PHYKE_6408
Length=91

 Score = 95.5 bits (236),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 58/68 (85%), Gaps = 0/68 (0%)

Query  3   WQIPTIRALKRQSQVDEAQRILERIASYVLPIMTKRQYRVQQLLEFFPKNANLLGMNVNH  62
           + IP ++AL RQ + D AQ++LER+A+ VLPIMT+R++RV +L+EFFPK+ +LLGMNVNH
Sbjct  5   FAIPEVKALVRQPRRDHAQQLLERLATAVLPIMTQRRFRVHRLIEFFPKDGSLLGMNVNH  64

Query  63  GWKIYVRL  70
           G KIY+RL
Sbjct  65  GAKIYIRL  72

>PPTG_09254
Length=307

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 86/143 (60%), Gaps = 1/143 (1%)

Query  68   VRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQGLIGI  127
            +R  P   P SF P+E LL T+LHEL HM  GPHN AFYK LDEL  EME LM +GL+G 
Sbjct  70   LRPLPKRTPKSFYPYEALLETLLHELTHMVHGPHNEAFYKYLDELKHEMEMLMVRGLVGE  129

Query  128  TGAQFQNAGQGHALGGanarnvakaaadaaIQRM-RHQALVGANGSCRLGGDASATAASL  186
             G +F  AG G  LGG N     + AA  A +R  ++ +L+G   S RLG  ++A+    
Sbjct  130  EGVRFAAAGTGQRLGGDNISVPIRVAAVLAAKRREQYNSLLGGETSRRLGSLSAASNEIF  189

Query  187  TPAMLRQKALKAAERRRHDQLTC  209
             P  LR+K L+AAERRR D   C
Sbjct  190  NPQALRRKILEAAERRRRDNEHC  212

>H310_14476
Length=490

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 70/149 (47%), Gaps = 10/149 (7%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------AN  54
            ++   I  L        A+ ILE +A+   +L ++ + ++ V  L+E FP          
Sbjct  122  YKFHAIETLPNMPNEATARNILESLATDPGILAVLAQHKWHVGALVEMFPDGKVGVDPVC  181

Query  55   LLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTS  114
            +LG+N N G +I +RLR  +    F  F  +   + HEL H  +  HN  FY+L+ ++ +
Sbjct  182  VLGLNENKGQRIRLRLR-TDDLLGFRKFLTIKQVLFHELSHNDVSDHNPEFYQLMRQVEA  240

Query  115  EMESL-MAQGLIGITGAQFQNAGQGHALG  142
            E  ++ M +    +     Q +  GH LG
Sbjct  241  ECNAIPMTRTTPLVRSVVQQQSSVGHRLG  269

>SDRG_14076
Length=471

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 8/120 (7%)

Query  31   VLPIMTKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLRPAERPTSFLPFEH  84
            +L +M K ++ V  L E FP          +LG+N N G +I +RLR  +    F  +  
Sbjct  147  ILHVMAKHKWTVGALAEMFPDGKVGVDPVCVLGLNENKGQRILLRLR-TDDLQGFRKYLT  205

Query  85   LLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQGL-IGITGAQFQNAGQGHALGG  143
            +   + HEL H  +  HN  FY+L+ ++ +E  ++      I +      +A +GH LGG
Sbjct  206  IKKVLYHELTHNDVSDHNNEFYQLMRQVEAECNTVPGTTTSIQVPTTSPTHAARGHVLGG  265

>PYU1_G000982
Length=528

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query  1    MEWQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------  52
            ++++   I  L   S  D A+ ILER+A+   +L +M K ++ V  L E +P        
Sbjct  124  IDYRFHAIEVLPNFSDKDRAREILERLANDRGILAVMAKHKWTVGTLAEMYPDGKVGVDP  183

Query  53   ANLLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDEL  112
              +LG+N N G KI +RLR  +    F  + ++   + HEL H     H+A F+ L+ ++
Sbjct  184  VCVLGLNQNKGQKILLRLRTDDL-LGFRKYLNIKKVLFHELTHNVYSEHDAKFFTLMSQV  242

Query  113  TSEMESL  119
              E  +L
Sbjct  243  EKECAAL  249

>SPRG_09603
Length=467

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 56/120 (47%), Gaps = 8/120 (7%)

Query  31   VLPIMTKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLRPAERPTSFLPFEH  84
            +L +M K ++ V  L E +P          +LG+N N G +I +RLR  +    F  +  
Sbjct  147  ILHVMAKHKWSVGALAEMYPDGKVGVDPVCVLGLNENKGQRILLRLR-TDDLQGFRKYLT  205

Query  85   LLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQGL-IGITGAQFQNAGQGHALGG  143
            +   + HEL H  +  HN  FY+L+ ++ +E  ++      +         A +GH LGG
Sbjct  206  IKKVLYHELTHNDVSDHNNEFYQLMRQVEAECNTVPGTTTSLDAPTTSPTVAARGHVLGG  265

>H310_04812
Length=3703

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 16/89 (18%)

Query  169   ANGSCRLGGDASATAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYD  228
             A  SC    +A +T  +L   +   KA                   P       AP P D
Sbjct  3015  ACASCTFENNADSTVCNLCGTLNPNKAASP----------------PESDASTNAPGPSD  3058

Query  229   GWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
             GW+C  CTFLND   S C++CG+   + +
Sbjct  3059  GWTCSACTFLNDWNNSTCSICGSECDQER  3087

 Score = 32.7 bits (73),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  230   WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
             W+C  CTF N+   +VC +CG     +  S
Sbjct  3014  WACASCTFENNADSTVCNLCGTLNPNKAAS  3043

>PHYSO_249618
Length=485

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 89/198 (45%), Gaps = 38/198 (19%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------AN  54
            ++   I  L+  +   +AQ ILE++A+   +L +M K ++ V  L E  P          
Sbjct  126  YRFHAIEPLQNFADKHKAQEILEKLANDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVC  185

Query  55   LLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTS  114
            +LG+N N G KI +RLR  +    F  F  +   + HEL H     H++ FY+L+ ++ +
Sbjct  186  VLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDSKFYQLMRQIEN  244

Query  115  EMESLMAQGLIGITGAQFQNAGQGHALGGanarnvakaaadaaIQRMRHQALVGANGSC-  173
            E   L            + ++G G A+GG+              Q M H      +GS  
Sbjct  245  ECNEL-----------DWTSSG-GAAVGGS--------------QAMPHNESNSDSGSTS  278

Query  174  --RLGGDASATAASLTPA  189
              RLGG ++ T+  L PA
Sbjct  279  GHRLGGGSAGTSRLLNPA  296

>PHYCA_505767
Length=460

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 73/160 (46%), Gaps = 20/160 (13%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------AN  54
            ++   I  LK  +  ++AQ ILE +A+   +L +M K ++ V  L E  P          
Sbjct  100  YRFHAIEPLKNFADSEKAQEILENLANDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVC  159

Query  55   LLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTS  114
            +LG+N N G KI +RLR  +    F  F  +   + HEL H     H+  FY+L+ ++  
Sbjct  160  VLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVEK  218

Query  115  EMESL----MAQGLIGITGAQFQNAGQ-------GHALGG  143
            E   L     +   IG +GA  ++ G        G  LGG
Sbjct  219  ECNELDWTNSSGAAIGGSGAILRDDGDFGTSASSGQRLGG  258

>H257_13329
Length=445

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 55/104 (53%), Gaps = 9/104 (9%)

Query  20   AQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLR  71
            A+ IL  +AS   +L ++   +++V  L+E +P          +LG+N N G +I +RLR
Sbjct  139  ARNILVSLASDPGILAVLAHHKWQVGALVEMYPDGKVGVDPVCVLGLNENKGQRIRLRLR  198

Query  72   PAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSE  115
              +    F  F  +   + HEL H ++  HN  FY+L+ ++ +E
Sbjct  199  -TDDLLGFRKFLTIKQVLFHELSHNEVSDHNNDFYQLMRQVETE  241

>PYAR_14105
Length=494

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 96/223 (43%), Gaps = 58/223 (26%)

Query  2    EWQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------A  53
            +++   I  L+  +    A+ ILE++A+   +L +M K ++ V  L E +P         
Sbjct  130  DYRFHAIEVLENFTDAHRARSILEQLANDRGILAVMAKHKWSVGCLAEMYPDGKVGVDPV  189

Query  54   NLLGMNVNHGWKIYVRLRP---------------AER---------PTSFLPFEHLLGTM  89
             +LG+N N G KI +RLR                AER           S   F + +  +
Sbjct  190  CVLGLNQNKGQKILLRLRTDDLQGFRKFLKYAIFAERFLYPRFSKHSRSRFAFGYSIKKV  249

Query  90   L-HELVHMKIGPHNAAFYKLLDELTSEMESLMAQGLIGITGAQFQNAGQGHALGGanarn  148
            L HEL H     H++ FY+L+  +  E + L            + N+G G A+GG  +  
Sbjct  250  LFHELSHNVHSEHDSQFYQLMRLVERECDEL-----------DWSNSG-GRAVGGEGSIA  297

Query  149  vakaaadaaIQRMRHQALVGANGSCRLGGDASATAASL--TPA  189
            +             H+ + G++G  RLGG ++A +  L  TPA
Sbjct  298  IIPD----------HEEVSGSSGQ-RLGGGSTAISRLLRDTPA  329

>PHYRA_74151
Length=1127

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (51%), Gaps = 9/112 (8%)

Query  16   QVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------ANLLGMNVNHGWKIY  67
             VD+A+ IL+++A+   +L +M K ++ V  L E  P          +LG+N N G KI 
Sbjct  153  DVDKAREILDKLANDRGILAVMDKHKWSVGVLAEMPPDGKVGVDPVCVLGLNQNKGQKIL  212

Query  68   VRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESL  119
            +RLR  +    F  F  +   + HEL H     H++ FY+L+ ++  E   L
Sbjct  213  LRLRTDDL-LGFRKFLSIKNVLFHELSHNVHSEHDSKFYQLMRQVEKECNEL  263

>PITG_15925
Length=455

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 69/149 (46%), Gaps = 21/149 (14%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------AN  54
            ++   I  L   +  ++AQ ILE++A+   +L +M K ++ V  L E  P          
Sbjct  124  YRFHVIEPLNNFADKNKAQEILEKLANDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVC  183

Query  55   LLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTS  114
            +LG+N N G KI +RLR  +    F  F  +   + HEL H     H+  FY+L+ ++  
Sbjct  184  VLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHELSHNVHSEHDNKFYQLMRQVER  242

Query  115  EMESLMAQGLIGITGAQFQNAGQGHALGG  143
            E   L            + N+G G A+GG
Sbjct  243  ECSEL-----------DWTNSG-GAAVGG  259

>PYIW_21378
Length=496

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (48%), Gaps = 9/126 (7%)

Query  2    EWQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------A  53
            +++   I  L   S    A+ ILER+A+   +L +M K ++ V  L E  P         
Sbjct  136  DYRFHAIEELPNFSDRSRAREILERLANDRGILAVMDKHKWSVGTLAEMHPDGKVGVDPV  195

Query  54   NLLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELT  113
             +LG+N N G KI +RLR  +    F  +  +   + HEL H     H++ FY+L+ ++ 
Sbjct  196  CVLGLNQNKGQKILLRLRTDDL-LGFRKYLGIKKVLFHELTHNVHSEHDSKFYQLMRQVE  254

Query  114  SEMESL  119
             E   L
Sbjct  255  KECSEL  260

>PHALS_09846
Length=481

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 77/159 (48%), Gaps = 19/159 (12%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------AN  54
            ++   I  L+  +  ++A  ILE++A+   +L +M K ++ V  L E  P          
Sbjct  124  YRFHAIEPLENFADKEKAHEILEKLATDRGILAVMAKHKWSVGVLAEMPPDGKVGVDPVC  183

Query  55   LLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELT-  113
            +LG+N N G KI +RLR  +    F  +  +   + HEL H     H+  FY+L+ ++  
Sbjct  184  ILGLNQNKGQKILLRLR-TDDLLGFRKYLSIKKVLFHELSHNVHSEHDNKFYQLMRQVER  242

Query  114  --SEMESLMAQG-LIGITGAQFQNAG------QGHALGG  143
              SE++   + G ++G + A  ++ G       G+ LGG
Sbjct  243  ECSELDWTQSGGSVVGGSPAIVEDDGTTLKNSTGYRLGG  281

>H310_00242
Length=3925

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (2%)

Query  205   DQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
             D  +C    EP R   +   E    W C+ CTF+N   ++ CA+C  G   R+
Sbjct  3832  DVTSCSMCSEP-RDHAKQVREVVQTWQCENCTFINPNSETTCAVCEIGVSGRR  3883

>PYIR_18116
Length=532

 Score = 40.4 bits (93),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 58/122 (48%), Gaps = 9/122 (7%)

Query  2    EWQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------A  53
            +++   I  L   S    A+ ILER+A+   +L +M K ++ V  L E  P         
Sbjct  129  DYRFHAIEELPNFSDRHRAREILERLANDRGILAVMDKHKWTVGTLAEMHPDGKVGVDPV  188

Query  54   NLLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELT  113
             +LG+N N G KI +RLR  +    F  +  +   + HEL H     H++ FY L+ ++ 
Sbjct  189  CVLGLNQNKGQKILLRLRTDDL-LGFRKYLSVKKVLFHELTHNVHSEHDSKFYTLMRQVE  247

Query  114  SE  115
             E
Sbjct  248  KE  249

>PPTG_12717
Length=496

 Score = 40.0 bits (92),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 71/182 (39%), Gaps = 42/182 (23%)

Query  3    WQIPTIRALKRQSQVDEAQRILERIASY--VLPIMTKRQY--------------------  40
            ++   I  LK  +  D+AQ ILER+A+   +L +M K +Y                    
Sbjct  124  YRFHAIEPLKNFADKDKAQEILERLANDRGILAVMAKHKYVFFNSHCIYWTIWDADIVDG  183

Query  41   --RVQQLLEFFPKN------ANLLGMNVNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHE  92
               V  L E  P          +LG+N N G KI +RLR  +    F  F  +   + HE
Sbjct  184  RWSVGVLAEMPPDGKVGVDPVCVLGLNQNKGQKILLRLRTDDL-LGFRKFLSIKKVLFHE  242

Query  93   LVHMKIGPHNAAFYKLLDELTSEMESL--MAQGLIGITG---------AQFQNAGQGHAL  141
            L H     H+  FY+L+ ++  E   L     G   + G         +   N   GH L
Sbjct  243  LSHNVHSEHDNKFYQLMRQVEKECNELDWTNSGGAAVGGSPAALHDDDSTSSNVSSGHRL  302

Query  142  GG  143
            GG
Sbjct  303  GG  304

>H257_02435
Length=409

 Score = 39.7 bits (91),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 11/58 (19%)

Query  208  TCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDER---QSVCAMCGAGTKKRKRSMGA  262
            TC     PSR  G       + W+CD+CTF+N  +    S+CAMC A  ++  RS GA
Sbjct  336  TCAMCGGPSRPPG-------NEWTCDKCTFVNTSKAPSSSICAMCQA-FRRSGRSSGA  385

 Score = 37.0 bits (84),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 0/29 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTK  254
            P   W C  CTF ND+    CAMCG  ++
Sbjct  317  PSGPWPCPACTFENDDEARTCAMCGGPSR  345

>PYAP_13463
Length=1100

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (55%), Gaps = 3/51 (6%)

Query  218   QIGEAAP---EPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVN  265
             ++ E+ P   EP DGW+C +CT  N     +CA CG   +K +  M  +++
Sbjct  1047  ELKESEPPNQEPPDGWNCTRCTLRNPSNLDLCAGCGLRFRKSRLQMPRIID  1097

>CCA18144
Length=2748

 Score = 39.7 bits (91),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 34/88 (39%), Gaps = 19/88 (22%)

Query  173   CRLGGDASATAASLTPAMLRQKALKAAERRRHDQLTCGTHDE-------PSRQIGEAAPE  225
             C  G D  AT+         Q    A   R  D   C T          P+ Q G  AP 
Sbjct  1084  CHSGHDLIATSV--------QSISCACHSRGSDLCQCTTQSPKITVDLFPTLQSGIVAP-  1134

Query  226   PYDGWSCDQCTFLNDERQSVCAMCGAGT  253
                 W CDQCT +N+   SVC +CG  T
Sbjct  1135  ---FWRCDQCTVVNEASASVCKVCGRKT  1159

>PYVX_17526
Length=521

 Score = 39.3 bits (90),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 62/134 (46%), Gaps = 23/134 (17%)

Query  8    IRALKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------ANLLGMN  59
            I  L++ S  D+A+ IL ++A+   +L +M K ++ V  L E +P          +LG+N
Sbjct  141  IEVLEKFSDADKARDILNQLANDRGILAVMEKHKWSVGVLAEMYPDGKVGVDPVCVLGLN  200

Query  60   VNHGWKIYVRLRPAERPTSFLPFEHLLGTMLHELVHMKI--------------GPHNAAF  105
             N G KI +RLR  +    F  +  +   + HEL H                   H++ F
Sbjct  201  QNKGQKILLRLR-TDDLLGFRKYLSIKKVLFHELSHNNSDRNQINAMLMVQVHSEHDSKF  259

Query  106  YKLLDELTSEMESL  119
            Y+L+ ++  E + L
Sbjct  260  YQLMRQVERECDEL  273

>PYU1_G011294
Length=2839

 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 19/36 (53%), Gaps = 0/36 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVN  265
            W C  CT+LND  + VC MCG       R +G + +
Sbjct  145  WGCPACTYLNDATRCVCEMCGTANPNPARRVGGLFS  180

 Score = 31.6 bits (70),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 23/46 (50%), Gaps = 4/46 (9%)

Query  209  CGTHD-EPSRQIG---EAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            CGT +  P+R++G     +      WSC  CT  N     +CA+CG
Sbjct  164  CGTANPNPARRVGGLFSGSAARKTEWSCVACTMKNAPGMRICAICG  209

>SDRG_13591
Length=2169

 Score = 39.3 bits (90),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 34/77 (44%), Gaps = 10/77 (13%)

Query  179   ASATAASLTPAMLRQKALKAAERRRHDQL-TCGTHDEPSRQIGEAAPEPYDGWS---CDQ  234
             A+ T+ +L P       L+A  R RHD L T G  DE       A P P        C +
Sbjct  2089  ATTTSTALVPV------LEATTRPRHDSLDTMGAFDEDESLPALADPTPNSSAEPRVCPR  2142

Query  235   CTFLNDERQSVCAMCGA  251
             CTF N+    +C MC A
Sbjct  2143  CTFHNEPYSILCDMCEA  2159

>H257_06741
Length=3932

 Score = 38.9 bits (89),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 7/53 (13%)

Query  208   TCGTHDEP---SRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
             +C   +EP   ++Q+ E A      W C+ CTF+N   ++ CA+C  G   R+
Sbjct  3842  SCVMCNEPRDHTKQVAEVA----QTWQCENCTFINPIAETTCAVCEMGASGRR  3890

>PHYKE_6259
Length=230

 Score = 38.1 bits (87),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 8/69 (12%)

Query  11   LKRQSQVDEAQRILERIASY--VLPIMTKRQYRVQQLLEFFPKN------ANLLGMNVNH  62
            LK+ +  D+A+ ILE++A+   +L +M K ++ V  L E  P          +LG+N N 
Sbjct  129  LKQFADADKAREILEKLANDRGILAVMAKYKWSVGVLAEMPPDGKVGVDPVCVLGLNQNK  188

Query  63   GWKIYVRLR  71
            G KI +RLR
Sbjct  189  GQKILLRLR  197

>SDRG_02183
Length=230

 Score = 37.7 bits (86),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMCGA  251
             WSCD CTF+N    S C+MCG+
Sbjct  201  SWSCDCCTFVNRTNLSTCSMCGS  223

>SPRG_00287
Length=972

 Score = 38.5 bits (88),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 1/27 (4%)

Query  229  GWSCDQCTFLNDERQSV-CAMCGAGTK  254
            GW CDQCT++N+    + CAMC A  K
Sbjct  639  GWECDQCTYVNENPNGLACAMCAAPRK  665

 Score = 33.1 bits (74),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAG  252
            W C  CT LN  ++  CA CGA 
Sbjct  26   WECSMCTLLNGYQRKTCAACGAA  48

>PYAR_20501
Length=195

 Score = 37.4 bits (85),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKR  256
            WSC  CT+LND  +  C MCG G   +
Sbjct  113  WSCPACTYLNDAARRFCEMCGTGNPTK  139

 Score = 31.6 bits (70),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  209  CGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            CGT + P++   E AP     WSC  CT  N      CA+CG
Sbjct  132  CGTGN-PTKPTAEKAPS---EWSCVACTMKNAPALRTCAVCG  169

>PYAR_21511
Length=400

 Score = 37.4 bits (85),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 28/53 (53%), Gaps = 4/53 (8%)

Query  197  KAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
            K AE +R D + C    +   + G+ A  P + WSC QCTF+N    S C +C
Sbjct  162  KLAESQR-DSMRCTIQRD---ETGDGARVPSETWSCGQCTFINRIEVSFCDIC  210

>PYIR_18793
Length=4614

 Score = 37.7 bits (86),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query  210   GTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGA  251
              TH EP + +  A PE   GW+C  CTF+N   +  C  C +
Sbjct  3850  STHSEPEQPV-VAEPETSSGWACQACTFVNAWSEMNCLACAS  3890

>PYU1_G008649
Length=1550

 Score = 37.7 bits (86),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGA  251
            DGW+C  CTFLN    S CA CG+
Sbjct  813  DGWACYACTFLNGWSDSQCAACGS  836

>CCA14621
Length=603

 Score = 37.4 bits (85),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 3/41 (7%)

Query  222  AAP-EPYDGWSCDQCTFLNDERQSVCAMCGA--GTKKRKRS  259
            AAP    + W C QCTFLN E  + C +C     T+KRKR+
Sbjct  6    AAPISSSNNWPCTQCTFLNPEALARCKVCSKLNITRKRKRA  46

>PYVX_17896
Length=5066

 Score = 37.4 bits (85),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTK  254
            P + W CD+C+F+N     +CA+C  G +
Sbjct  910  PTEEWYCDECSFVNKGSAKICALCHVGER  938

>HYAP_06167
Length=161

 Score = 35.8 bits (81),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
            DGW C+ C   N+  Q+ C +CGA T++ K
Sbjct  18   DGWRCEVCYHTNNSSQTSCVLCGATTEEIK  47

>PYIR_18271
Length=422

 Score = 36.6 bits (83),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  223  APEPYDGWSCDQCTFLNDERQSVCAMC  249
            AP P   W C QCT+LN   +S C MC
Sbjct  197  APIPIQQWGCRQCTYLNPISESFCEMC  223

>PPTG_01073
Length=290

 Score = 36.2 bits (82),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            W C  CTF+ND+  SVC MC 
Sbjct  263  WVCSACTFVNDDTDSVCEMCS  283

>PYIW_20348
Length=629

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  223  APEPYDGWSCDQCTFLNDERQSVCAMCGA  251
            A   Y+GW+CD C   ND  Q  C +CG+
Sbjct  61   AKRTYNGWACDVCYHSNDIAQLECVLCGS  89

>SPRG_20584
Length=2122

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 27/61 (44%), Gaps = 4/61 (7%)

Query  195   ALKAAERRRHDQL-TCGTHDEPSRQIGEAAPEPYDGWS---CDQCTFLNDERQSVCAMCG  250
              L+A  R RHD L T G  DE       A P P        C +CTF N+    +C MC 
Sbjct  2052  VLEATTRPRHDSLETMGAFDEDDSLPALADPTPTSSSEPRVCPRCTFHNEPFSILCDMCE  2111

Query  251   A  251
             A
Sbjct  2112  A  2112

>PYIW_14704
Length=1315

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 21/47 (45%), Gaps = 3/47 (6%)

Query  209   CGTHDEP---SRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAG  252
             CG  +EP   S     +A     GW C  CTF+N      CA+C  G
Sbjct  1222  CGACNEPNPLSHDEKASAGASQQGWRCGNCTFINQASDVACAICELG  1268

>HYAP_07938
Length=410

 Score = 36.2 bits (82),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 7/59 (12%)

Query  193  QKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGA  251
            Q+ L+     R  + T  + +EPS   G       D WSC  CTFLN  +   C +CG+
Sbjct  18   QEELRETHTPRLPERTITSPNEPSDAQG-------DAWSCRVCTFLNHPQLLDCELCGS  69

>CCA19146
Length=533

 Score = 36.2 bits (82),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 20/40 (50%), Gaps = 0/40 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVN  265
            P   W+C  CTFLN    S C +C +  +   R M  VV+
Sbjct  480  PQKTWNCSVCTFLNAPMMSKCDICQSRYRPEARGMAMVVD  519

>PYIW_14300
Length=2920

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            W C  CT+LND  +S C MCG
Sbjct  146  WGCPACTYLNDALRSFCEMCG  166

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 23/53 (43%), Gaps = 11/53 (21%)

Query  209  CGTHD--------EPSRQIGE---AAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            CGT +         PS  IG     +P+    WSC  CT  N     +CA+CG
Sbjct  165  CGTTNPTPPSRAKRPSVGIGALFAGSPDAKAVWSCAACTMTNPPGMRICAVCG  217

>PHALS_12894
Length=7221

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 22/43 (51%), Gaps = 4/43 (9%)

Query  225   EPY----DGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAV  263
             +PY      W C +C+F N     +CA+C  GT+   R++  V
Sbjct  3160  DPYLLSVKDWVCHKCSFSNKGFSKICAVCRFGTRDNSRTLNEV  3202

>PHYSO_329215
Length=1298

 Score = 36.2 bits (82),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)

Query  230   WSCDQCTFLNDERQSVCAMCGAGTK  254
             W C  CTF+NDE  ++C MC +G+K
Sbjct  1275  WVCPACTFVNDEADAICEMC-SGSK  1298

>PYU1_G011459
Length=457

 Score = 35.8 bits (81),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            WSC QCT+LN   +S C MC 
Sbjct  253  WSCRQCTYLNPMAESFCEMCA  273

>PPTG_08367
Length=408

 Score = 35.8 bits (81),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 20/37 (54%), Gaps = 5/37 (14%)

Query  214  EPS-RQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
            EPS R I E +      WSC QCT+LN    S C MC
Sbjct  239  EPSQRDISETS----GTWSCGQCTYLNPMTSSFCEMC  271

>SDRG_10426
Length=486

 Score = 35.8 bits (81),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMCGA  251
             W+C  CTFLN  ++  C MCGA
Sbjct  438  NWACSACTFLNVAKRKHCTMCGA  460

>PYIR_18965
Length=4247

 Score = 35.8 bits (81),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 22/47 (47%), Gaps = 3/47 (6%)

Query  209   CGTHDEPSRQIGE---AAPEPYDGWSCDQCTFLNDERQSVCAMCGAG  252
             CG  +EP+  + +   +      GW C  CTF+N      CA+C  G
Sbjct  4154  CGACNEPNPHLHDEKASTSTNQQGWRCGNCTFINQPSDVACAICELG  4200

 Score = 31.6 bits (70),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  217   RQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
             +Q G    E    WSC  CTF ND    +C  C 
Sbjct  4125  KQQGGGLKEELLTWSCPVCTFANDGSAEICGACN  4158

>PHYRA_76318
Length=1977

 Score = 35.8 bits (81),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  228   DGWSCDQCTFLNDERQSVCAMCG  250
             D WSC  CTFLN  + + C MCG
Sbjct  1628  DAWSCRVCTFLNHPQLAECEMCG  1650

>PYAP_14346
Length=2513

 Score = 35.8 bits (81),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (52%), Gaps = 0/27 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKR  256
            W C  CTFLND  +  C MCG     +
Sbjct  119  WGCPACTFLNDAARRFCEMCGTSNPTK  145

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  209  CGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            CGT + P++ + +  P     WSC  CT  N   Q  C +CG
Sbjct  138  CGTSN-PTKHVDDRQPTE---WSCVACTMKNAPTQRSCVVCG  175

>H257_11046
Length=452

 Score = 35.4 bits (80),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  221  EAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
            E +  P D W C  CTFLN    + C MC
Sbjct  77   EPSTSPSDTWECPMCTFLNHAALATCEMC  105

>H310_02310
Length=326

 Score = 35.0 bits (79),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGA  251
            P D W+CD CTF N     +CAMC +
Sbjct  241  PPDKWNCDACTFENAGDAKMCAMCDS  266

>PYVX_17354
Length=2796

 Score = 35.4 bits (80),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query  196  LKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            L   +  R D L  G   E  ++  + + EP + W C  CTFLN   +  C MCG
Sbjct  115  LLVVDDERGDDL--GEEQEAKQEARKESKEP-EQWGCSACTFLNGPTRHFCEMCG  166

 Score = 32.3 bits (72),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 12/22 (55%), Gaps = 0/22 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGA  251
            W C  CT  N  R  VC MCG+
Sbjct  197  WGCPACTMKNPPRARVCVMCGS  218

>PHYKE_8603
Length=589

 Score = 35.4 bits (80),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 14/22 (64%), Gaps = 0/22 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGA  251
            W C  CTF+ND+   VC MC +
Sbjct  564  WVCSACTFVNDDTDVVCEMCSS  585

>H310_07666
Length=1055

 Score = 35.4 bits (80),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 1/24 (4%)

Query  229   GWSCDQCTFLNDERQS-VCAMCGA  251
              W C++CTF+ND  QS VC MC A
Sbjct  1028  SWVCEECTFVNDTSQSNVCEMCLA  1051

>SPRG_10085
Length=463

 Score = 35.0 bits (79),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGA  251
            W+C  CTFLN  ++  C MCGA
Sbjct  416  WACTACTFLNVAKRKHCTMCGA  437

>SDRG_05724
Length=694

 Score = 35.4 bits (80),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGTKKR  256
            D W C  C FLN   + VC +CGA    R
Sbjct  87   DRWECPVCAFLNVVDRPVCCLCGAKKDSR  115

>PPTG_13259
Length=5009

 Score = 35.4 bits (80),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (53%), Gaps = 0/34 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            P + W+C  C+F+N     VC +C  GT+    +
Sbjct  863  PIEEWACSNCSFVNKGASKVCTVCRNGTRDESST  896

>PYIR_13298
Length=2967

 Score = 35.4 bits (80),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            W C  CT+LND  +  C MCG      KR+
Sbjct  137  WGCPACTYLNDVLRCFCEMCGTTNPTPKRA  166

 Score = 31.2 bits (69),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  223  APEPYDGWSCDQCTFLNDERQSVCAMCG  250
            +P+    WSC  CT  N     +CA+CG
Sbjct  180  SPDAKAEWSCVACTMTNPSGMRICAVCG  207

>PYAR_24672
Length=759

 Score = 35.0 bits (79),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGA  262
            DGWSC +CT +N  +  +C+ CG   ++ +  M +
Sbjct  719  DGWSCTRCTLVNPAKNVLCSGCGLRFRRSRLQMSS  753

>PITG_07879
Length=363

 Score = 34.7 bits (78),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (56%), Gaps = 6/45 (13%)

Query  211  THDEPSR--QIGEAAPEPYDG----WSCDQCTFLNDERQSVCAMC  249
            T ++PS   ++GE+  +   G    WSC QCT+LN    S C MC
Sbjct  181  TIEQPSYAVELGESTQQDASGTSGTWSCGQCTYLNPVTSSFCEMC  225

>H257_03142
Length=3791

 Score = 35.0 bits (79),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 22/43 (51%), Gaps = 3/43 (7%)

Query  209   CGTHDEPSRQIGEAAPEPYD-GWSCDQCTFLNDERQSVCAMCG  250
             CGT    + Q G   P   D GW+C  CTFLN      C++CG
Sbjct  3122  CGTPHPNTTQGGP--PSGADAGWTCAACTFLNGWTTPTCSVCG  3162

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (48%), Gaps = 2/40 (5%)

Query  211   THDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
             T  + SR   +  P P   W+C  CTF N    + C +CG
Sbjct  3086  TASQSSRDTPDLQPTPM--WACASCTFENSADAASCNLCG  3123

>SDRG_12446
Length=4936

 Score = 35.0 bits (79),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  229   GWSCDQCTFLNDERQSVCAMC  249
              WSCD CT LND   S C +C
Sbjct  4334  AWSCDACTMLNDPNLSKCQIC  4354

>PYVX_21442
Length=1115

 Score = 34.7 bits (78),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 30/75 (40%), Gaps = 7/75 (9%)

Query  178   DASATAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDG--WSCDQC  235
             D  A    L+ A+   +   +AE R          D+      E +P P D   WSC +C
Sbjct  1027  DFDAVQTGLSSAVAHDQLRPSAESR-----AIIDEDQKENAWYEESPRPTDDYRWSCSRC  1081

Query  236   TFLNDERQSVCAMCG  250
             T  N     VCA CG
Sbjct  1082  TLKNPLENDVCAGCG  1096

>PYU1_G000394
Length=1147

 Score = 34.7 bits (78),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 22/47 (47%), Gaps = 3/47 (6%)

Query  209   CGTHDEPSRQIGE---AAPEPYDGWSCDQCTFLNDERQSVCAMCGAG  252
             CG  +EP+  + +    +     GW C  CTF+N      CA+C  G
Sbjct  1054  CGACNEPNPHLHDDKAGSSGSQQGWRCGNCTFINQPGDVACAICELG  1100

>PYVX_18283
Length=4293

 Score = 34.7 bits (78),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 24/43 (56%), Gaps = 2/43 (5%)

Query  209   CGTHDEPSRQIG-EAAPEPYD-GWSCDQCTFLNDERQSVCAMC  249
             CG  +EP+  +  + A  P++  W C  CTF+N     +CA+C
Sbjct  4201  CGACNEPNPLLQHDDATTPHEQTWRCQNCTFINQGGDDICAIC  4243

>SPRG_04680
Length=2376

 Score = 34.7 bits (78),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 1/27 (4%)

Query  225  EP-YDGWSCDQCTFLNDERQSVCAMCG  250
            EP Y  W C QCT +N   ++VC++CG
Sbjct  963  EPTYSLWCCPQCTVINAVDKAVCSVCG  989

 Score = 32.0 bits (71),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%)

Query  230   WSCDQCTFLNDERQSVCAMC  249
             WSCD CT LN    + C +C
Sbjct  1017  WSCDACTMLNSASATKCTVC  1036

>SPRG_20090
Length=4058

 Score = 34.7 bits (78),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (46%), Gaps = 3/57 (5%)

Query  206   QLTCGTHDEPSRQIGEAAPEPYDG---WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
             +L    H +P+++   A     DG   W C  CT+ N+   + CAMC     K  ++
Sbjct  3927  KLCAAFHVDPTKEHHAAKTTTTDGDALWMCSVCTYTNEPLLTACAMCSEPRDKLAKT  3983

 Score = 31.6 bits (70),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 24/59 (41%), Gaps = 9/59 (15%)

Query  208   TCGTHDEPSRQIGEAAPEPYD---------GWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
              C   +EP         EP D          W+C+ CT +N   ++ C++C  G   R+
Sbjct  3958  VCTYTNEPLLTACAMCSEPRDKLAKTPQATTWTCENCTCVNPILETTCSVCEMGMSGRR  4016

>PPTG_12469
Length=436

 Score = 34.3 bits (77),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  225  EPYDGWSCDQCTFLNDERQSVCAMCG  250
            E  D W+C  CTFLN    + C MCG
Sbjct  52   EVQDAWTCRVCTFLNHPELAECEMCG  77

>PHYSO_557028
Length=745

 Score = 34.3 bits (77),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCG  250
            +  W+C +CT +N    S CA+CG
Sbjct  717  FQSWACPRCTLINKSEDSSCAVCG  740

>PITG_02561
Length=2622

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  224   PEPYDGWSCDQCTFLNDERQSVCAMC  249
             P+P   WSC+ CT LN+   + C++C
Sbjct  1068  PQPAVDWSCEACTMLNNATATKCSIC  1093

>PYVX_17087
Length=110

 Score = 32.3 bits (72),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            W C  CT++NDE    C MC
Sbjct  82   WVCSSCTYVNDEAMEACEMC  101

>PYAR_18143
Length=2178

 Score = 34.3 bits (77),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query  214   EPSRQIGEAAPEPYDG--WSCDQCTFLNDERQSVCAMCGA-------GTKKRKRSM  260
             E   ++G+    P D   WSC  CT  N   +  CA CG+       G ++R +SM
Sbjct  1363  EAESEVGDGVVSPSDDSVWSCGVCTLENPASEVECAACGSPMPSEAVGRRQRNQSM  1418

>PHYSO_317996
Length=1057

 Score = 34.3 bits (77),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMC  249
             WSC +CTF N+ R   CAMC
Sbjct  5    AWSCSRCTFENEPRVRQCAMC  25

>SPRG_00857
Length=3040

 Score = 34.3 bits (77),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  225   EPYDGWSCDQCTFLNDERQSVCAMC  249
             E  DGW+C  CTFLN    + C +C
Sbjct  2411  ETIDGWTCPACTFLNAWDNTHCCVC  2435

>PYVX_15183
Length=458

 Score = 34.3 bits (77),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC QCTFLN   ++ C +C
Sbjct  230  WSCGQCTFLNPISEAFCEIC  249

>H257_07530
Length=371

 Score = 33.9 bits (76),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query  214  EPSRQIGEAAP--EPYDGWSCDQCTFLNDERQSVCAMC  249
            E S    E+ P  +  DG SC  CTF+N    ++CAMC
Sbjct  15   ESSYTTAESPPIDDDIDGSSCPACTFINKPSSALCAMC  52

>PYVX_18383
Length=2766

 Score = 34.3 bits (77),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 23/54 (43%), Gaps = 5/54 (9%)

Query  213  DEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVNL  266
            D+ + Q+   A  P   W C  CT  N+   + CA CG       R  GAV  +
Sbjct  365  DKAASQVTPVATAPSPDWDCHACTMKNEGTATRCATCGT-----DRPAGAVTTV  413

>PYIW_17359
Length=5024

 Score = 34.3 bits (77),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTK  254
            P D W C +CTF N      C +C  G++
Sbjct  808  PLDEWVCTECTFTNKGAHKTCTVCRIGSR  836

>PHYSO_454028
Length=840

 Score = 34.3 bits (77),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMC  249
             WSC +CTF N+ R   CAMC
Sbjct  1    AWSCSRCTFENEPRVRQCAMC  21

>SDRG_07566
Length=2392

 Score = 34.3 bits (77),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 1/27 (4%)

Query  225  EP-YDGWSCDQCTFLNDERQSVCAMCG  250
            EP Y  W C QCT +N   ++VC++CG
Sbjct  966  EPTYGLWCCPQCTVINAVDKAVCSVCG  992

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230   WSCDQCTFLNDERQSVCAMC  249
             WSCD CT LN    + CA+C
Sbjct  1020  WSCDACTMLNSASATKCAVC  1039

>PYIW_15144
Length=743

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCGAGTKKRKR  258
            +  W+C++CT LND     C  CG   + R +
Sbjct  708  FQPWACEKCTLLNDANVLTCGACGYTVELRNK  739

>PHYSO_312207
Length=2561

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC  CTFLN+  +  C MC
Sbjct  55   WSCPTCTFLNEASRCFCEMC  74

>CCI42575
Length=301

 Score = 33.5 bits (75),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMCGA  251
             W+C +CT LN+  ++VC +CG 
Sbjct  257  SWNCQRCTLLNEAVRTVCGVCGV  279

>PHYSO_475957
Length=2656

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  224   PEPYDGWSCDQCTFLNDERQSVCAMC  249
             P+P   WSC+ CT LN+   + C++C
Sbjct  1082  PKPAVDWSCEACTMLNNATAAKCSIC  1107

>PITG_16214
Length=777

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCG  250
            +  W+C +CT LN+   S CA CG
Sbjct  747  FQPWACPRCTLLNNSIDSACAACG  770

>PITG_07230
Length=2550

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC  CTFLN+  +  C MC
Sbjct  64   WSCPACTFLNEASRCFCEMC  83

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query  216  SRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            SR++G A+ +    WSC  CT +N     VC +CG
Sbjct  93   SRELGAASSD----WSCAACTMVNPAAMRVCGVCG  123

>PPTG_04214
Length=2720

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC  CTFLN+  +  C MC
Sbjct  59   WSCPACTFLNEASRCFCEMC  78

 Score = 32.3 bits (72),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (56%), Gaps = 4/34 (12%)

Query  217  RQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            R++G A+ +    WSC  CT +N     VC +CG
Sbjct  89   RELGTASSD----WSCAACTMVNPAAMRVCGVCG  118

>CCA17392
Length=1653

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            W+C +CTFLN +  S C +CG
Sbjct  71   WACSKCTFLNAKTSSKCQVCG  91

>CCA24367
Length=1653

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            W+C +CTFLN +  S C +CG
Sbjct  71   WACSKCTFLNAKTSSKCQVCG  91

>SDRG_10689
Length=614

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (51%), Gaps = 1/39 (3%)

Query  213  DEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGA  251
            DEP  +     P+  + W+C +CTF N      C +CGA
Sbjct  186  DEPPLKRARVQPK-VNVWACSKCTFENPTNAPHCGICGA  223

>PYVX_17630
Length=2205

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  223   APEPYDGWSCDQCTFLNDERQSVCAMCG  250
             +P    GWSC  CTF+N+  Q+ C  C 
Sbjct  1462  SPPSEAGWSCTACTFVNNWAQTNCEACS  1489

>PYIW_16348
Length=4610

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (53%), Gaps = 0/36 (0%)

Query  216   SRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGA  251
             S Q   A P+  +GW C  CT+LN+  +  C  C +
Sbjct  3849  SAQASVAEPDRVNGWPCQSCTYLNEWLELNCLTCAS  3884

>CCI42569
Length=3737

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 14/24 (58%), Gaps = 0/24 (0%)

Query  230   WSCDQCTFLNDERQSVCAMCGAGT  253
             W CDQCT +N+     C +CG  T
Sbjct  1433  WRCDQCTIVNEANAVACKVCGRNT  1456

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  221   EAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
             E+A   +  WSC  CT LN+   + CA+C
Sbjct  1480  ESAKHAFSEWSCAACTMLNEPNATKCAVC  1508

>PYAP_17953
Length=739

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 18/36 (50%), Gaps = 7/36 (19%)

Query  223  APEP-------YDGWSCDQCTFLNDERQSVCAMCGA  251
            AP P       +  W+C +CT LN    S CA CGA
Sbjct  689  APNPVTLTFHRFLSWACPRCTLLNKADVSACAACGA  724

>PHYCA_123901
Length=374

 Score = 33.1 bits (74),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMC  249
             WSC QCT++N    S C MC
Sbjct  220  SWSCGQCTYMNPMTASFCEMC  240

>SPRG_22222
Length=579

 Score = 33.5 bits (75),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (51%), Gaps = 1/39 (3%)

Query  213  DEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGA  251
            DEP  +     P+  + W+C +CTF N      C +CGA
Sbjct  152  DEPPLKRARVQPK-VNVWACSKCTFENPTTAPHCGICGA  189

>PHYSO_528227
Length=374

 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC QCT++N    S C MC
Sbjct  215  WSCGQCTYMNPMTSSFCEMC  234

>PHALS_05476
Length=1963

 Score = 33.5 bits (75),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCG  250
            + WSC  CT LN+  ++ C +CG
Sbjct  45   EDWSCKSCTLLNNASKTACQVCG  67

>PYIW_20265
Length=2682

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (8%)

Query  213  DEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            + PS  +  AA  P   WSC  CT  ND     CA CG
Sbjct  386  NRPSMSVVSAASAP---WSCYACTMSNDASAVKCATCG  420

>PYIW_20430
Length=326

 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  232  CDQCTFLNDERQSVCAMCGAGTKKR  256
            C  CTF+N    +VCAMCGA   ++
Sbjct  27   CATCTFINAADATVCAMCGATVNRK  51

>PPTG_05296
Length=2683

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 2/41 (5%)

Query  224   PEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVV  264
             P P   WSC+ CT LN    + C++C   T + K++   VV
Sbjct  1105  PTPAADWSCEACTMLNSATATKCSIC--DTPRAKQAEPEVV  1143

 Score = 31.6 bits (70),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  230   WSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVV  264
             W C++CT +N      C++CG    +     GAV 
Sbjct  1057  WGCNKCTVINSIDLKTCSVCGNSAPELSTGSGAVT  1091

>CCI11722
Length=474

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 13/44 (30%), Positives = 23/44 (52%), Gaps = 8/44 (18%)

Query  207  LTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            + C + ++ S++  +        W+C  CTFLN +  S C +CG
Sbjct  33   IACTSKEQQSKETKQ--------WACTMCTFLNAKTSSKCEICG  68

>PYU1_G008514
Length=531

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (53%), Gaps = 7/38 (18%)

Query  230  WSCDQCTFLNDERQSVCAMCG-------AGTKKRKRSM  260
            W C +CT +N+   S+C  CG       +  +KR+R M
Sbjct  485  WDCPRCTLVNETSSSLCEACGYEAKPQQSSARKRQRKM  522

>PYIR_21276
Length=730

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 16/31 (52%), Gaps = 0/31 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
            +  W+C++CT LND     C  CG   + R 
Sbjct  692  FQPWACEKCTLLNDANVITCGACGHTVELRN  722

>H310_02396
Length=4554

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAG  252
            + W+C  CTF N    +VCA+C  G
Sbjct  864  NDWTCGACTFANKGTTTVCAVCHGG  888

>H310_02399
Length=607

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVN  265
            W+C  CTF+ND     C++C      R+R +    N
Sbjct  110  WTCQSCTFINDTPSLACSLCDT----RRRMIATASN  141

>PYIW_19061
Length=1215

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  224   PEPYDGWSCDQCTFLNDERQSVCAMCGA  251
             PE    W C  CT++N++  ++C MC  
Sbjct  1181  PEQSRVWVCSSCTYVNEDIDTICEMCST  1208

>PHYCA_506644
Length=799

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 21/45 (47%), Gaps = 3/45 (7%)

Query  208  TCGTHDEPSRQIGEAAPE---PYDGWSCDQCTFLNDERQSVCAMC  249
             CG   EP+ +  E   +      GW C  CTF+N   +  CA+C
Sbjct  705  VCGACSEPNPKHQEEDSQRLQQQQGWRCGNCTFINQPDEVCCAIC  749

>H257_14345
Length=2494

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 0/34 (0%)

Query  226   PYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
             P   WSC  CT LND   + C +C  G      S
Sbjct  1042  PAAEWSCPACTMLNDALSAKCTICDTGRPDSNTS  1075

>PITG_22857
Length=1036

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMC  249
             WSC  CTF N+E    CAMC
Sbjct  2    AWSCSLCTFENEESIGQCAMC  22

>PHALS_09155
Length=704

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            WSC +CT LN     VCA CG
Sbjct  672  WSCPRCTLLNKVTDVVCAACG  692

>PYAR_21038
Length=689

 Score = 32.7 bits (73),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 36/76 (47%), Gaps = 5/76 (7%)

Query  188  PAMLRQKALKAAERRRHDQLTC-GTHDEPSRQIGEAAPEPYDGWS-CDQCTFLNDERQSV  245
            P +L ++  K  +R R  ++    THD    ++  A  E   G++ C  C F N +R + 
Sbjct  20   PFVLLRRVRKKRDRLRQFRIPLLDTHDH---RLDAAVREAQSGFNVCAACGFDNFKRSAF  76

Query  246  CAMCGAGTKKRKRSMG  261
            C +CG   K   RS+ 
Sbjct  77   CTLCGDEIKDADRSVA  92

>PYIR_21711
Length=791

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRK  257
            W C +CTFLN+   ++C +C +    RK
Sbjct  132  WECLKCTFLNETSSNMCEICNSPCPTRK  159

>PITG_06429
Length=4814

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 0/34 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            P + W+C  C+F+N      C +C  GT+    +
Sbjct  808  PIEEWACSNCSFVNRGFSKACTVCRKGTRDESST  841

>PHYRA_84590
Length=995

 Score = 32.7 bits (73),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAG  252
            W C  CTF+ND+  + C MC   
Sbjct  970  WVCPACTFVNDDTDAACEMCSTA  992

>SPRG_21096
Length=3963

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 17/31 (55%), Gaps = 0/31 (0%)

Query  219   IGEAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
             + +A  E    WSC+ CT LND   S C +C
Sbjct  3351  LDQAPMEEEAAWSCEACTMLNDPNLSKCQIC  3381

>PHYSO_317136
Length=4325

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (7%)

Query  209   CGTHDEPS-RQIGEA--APEPYDGWSCDQCTFLNDERQSVCAMC  249
             CG  +EP+ +Q  E   + +   GW C  CTF+N      CA+C
Sbjct  4232  CGACNEPNPKQQDETLQSQQQQQGWRCGNCTFINQPDDVCCAIC  4275

>PITG_05170
Length=566

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMC  249
            P + WSC  CTF+N      C MC
Sbjct  464  PMESWSCPSCTFVNRPLSMQCEMC  487

>HYAP_06817
Length=116

 Score = 31.2 bits (69),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  212  HDE-PSRQIGEAAPEPYDGWSCDQCTFLN-DERQSVCAMCGA  251
            HD   ++  G AAP+   GW+C  CTF N +E   +C  C A
Sbjct  22   HDNLKAKSDGGAAPK--TGWACSTCTFYNANEATVICEACNA  61

>PYIR_20354
Length=516

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGA  251
            P   W+C QCTF+N  R+  C +C A
Sbjct  419  PKHEWACLQCTFVNQPRRMQCEICRA  444

>PYU1_G005635
Length=797

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRSMG  261
            W C  C F N E ++ CA+C    K++ R+ G
Sbjct  77   WICWYCNFANYEMKTQCALCSQPKKEKLRAAG  108

>PYIR_18820
Length=659

 Score = 32.7 bits (73),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 0/25 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMCGAGT  253
            GW C  C + N E++  C MCG   
Sbjct  69   GWQCVVCAYSNSEKRKTCIMCGTSV  93

>PITG_13168
Length=4284

 Score = 32.7 bits (73),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 21/45 (47%), Gaps = 3/45 (7%)

Query  208   TCGTHDEPS-RQIGEAAPEPYD--GWSCDQCTFLNDERQSVCAMC  249
              CG  +EP+ +   E A       GW C  CTF+N      CA+C
Sbjct  4190  VCGACNEPNPKHQDEDAQHQQQQQGWRCSNCTFINQPDDVCCAIC  4234

>PYIR_14221
Length=849

 Score = 32.7 bits (73),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            W C  C F N E ++ CA+CG   K++  S
Sbjct  155  WICWYCDFANYEMKTACALCGHDKKQKDFS  184

>SDRG_03621
Length=979

 Score = 32.7 bits (73),  Expect = 3.1, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (4%)

Query  229  GWSCDQCTFLNDERQSV-CAMCGAGTK  254
            GW+C+QCT++N+    + CA+C A  K
Sbjct  642  GWNCEQCTYVNENPNGLACAICAAPRK  668

 Score = 32.3 bits (72),  Expect = 3.8, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAG  252
            W C  CT LN  ++  CA CGA 
Sbjct  26   WECSMCTLLNGYQRKTCAACGAA  48

>PHYCA_543426
Length=743

 Score = 32.7 bits (73),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCG  250
            +  W+C +CT LN    S CA+CG
Sbjct  714  FQSWACPRCTLLNKGAASECAVCG  737

>PHYSO_361866
Length=5836

 Score = 32.7 bits (73),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  226   PYDGWSCDQCTFLNDERQSVCAMCGAGTK  254
             P + W C QC F+N     +C +C  G +
Sbjct  1634  PVEEWVCTQCAFVNKASAEMCTVCRIGAR  1662

>PYAP_24763
Length=667

 Score = 32.3 bits (72),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  210  GTHDEPSRQIGEAAPEPYDGWS-CDQCTFLNDERQSVCAMCGAGTKKRKR  258
            G  +   R++  A  E  +G+  C  C F N +  + C +CGAG +++ R
Sbjct  54   GARNAFDRRVALAVREAKEGFEECKGCGFTNAKGATSCVLCGAGIERKGR  103

>PYVX_19970
Length=619

 Score = 32.3 bits (72),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 22/47 (47%), Gaps = 3/47 (6%)

Query  217  RQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAV  263
            + + ++  E    W C+ C F N E    C +CG    +R  S+G V
Sbjct  4    QDVQDSNDEVSSQWKCEVCDFHNKESSKTCVLCGT---ERGFSLGLV  47

>SPRG_17182
Length=217

 Score = 32.0 bits (71),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 0/29 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGTKKR  256
            D W C  C FLN   + VC +C A    R
Sbjct  66   DRWECPVCAFLNVVDRPVCCLCAAKKDSR  94

>PYIW_17005
Length=785

 Score = 32.3 bits (72),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRK  257
            W C +CT+LN    +VC +C +    RK
Sbjct  120  WECVKCTYLNKTSSNVCEICTSPCPTRK  147

>SDRG_01442
Length=3660

 Score = 32.3 bits (72),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 0/22 (0%)

Query  228   DGWSCDQCTFLNDERQSVCAMC  249
             DGW+C  CTF N    + C +C
Sbjct  3035  DGWTCPACTFFNAWDNTQCCVC  3056

>PPTG_00735
Length=717

 Score = 32.3 bits (72),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (48%), Gaps = 7/86 (8%)

Query  176  GGDASATAASLTPAM----LRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWS  231
            G  A A A +L  AM    L +++ K  ER    +L     D   R++  A  +  +G++
Sbjct  5    GTIAVACALTLLLAMCFGWLARRSFKKFEREA--ELNAPLIDSDHRRLDAALRDAEEGFN  62

Query  232  -CDQCTFLNDERQSVCAMCGAGTKKR  256
             C  C F N +R   CA+CG   +KR
Sbjct  63   KCAVCEFENFKRCQFCAICGELMRKR  88

>H257_07428
Length=1069

 Score = 32.3 bits (72),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 17/28 (61%), Gaps = 3/28 (11%)

Query  229   GWSCDQCTFLNDE---RQSVCAMCGAGT  253
              W CD CTF+N+    R +VC +C +G 
Sbjct  1042  SWVCDACTFVNESPLHRLAVCEICHSGV  1069

>PYAP_16796
Length=4278

 Score = 32.3 bits (72),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  229   GWSCDQCTFLNDERQSVCAMCGAG  252
             GW C  CTF+N      CA+C  G
Sbjct  4208  GWQCANCTFINLPGDDACAICELG  4231

>PHALS_10255
Length=432

 Score = 32.0 bits (71),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCG  250
            + W+C  CTFLN      C MCG
Sbjct  57   NAWTCHVCTFLNHPELVECEMCG  79

>SDRG_11718
Length=4407

 Score = 32.3 bits (72),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (52%), Gaps = 0/27 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGTK  254
            D W C  C F N   Q  CA+C  GT+
Sbjct  831  DDWVCHHCEFNNKGGQGRCAICRVGTR  857

>H257_05035
Length=437

 Score = 32.0 bits (71),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 13/22 (59%), Gaps = 0/22 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMC  249
            D WSC  CT LND   S C +C
Sbjct  238  DPWSCAACTMLNDPNLSKCQIC  259

>PHALS_05049
Length=509

 Score = 32.0 bits (71),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query  209  CGTHDEPSRQIGEAAP----EPYDGWSCDQCTFLNDERQSVCAMC  249
            CG     +R+     P    +P D W+C+ C  +N ER+S C MC
Sbjct  289  CGDKSNATRENDSRGPPGLFQPGD-WTCNTCGNVNWERRSECNMC  332

>H257_12121
Length=2102

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGA  251
            W+C QCT+ N    S+C +CG+
Sbjct  61   WNCTQCTYENSSSSSICEICGS  82

>H310_04559
Length=4922

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)

Query  226   PYDGWSCDQCTFLNDERQSVCAMC  249
             P + WSC  CT LND   S C +C
Sbjct  4330  PSEPWSCVACTMLNDVNLSKCQIC  4353

>HYAP_04619
Length=2712

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 4/39 (10%)

Query  215   PSRQIGEAAP----EPYDGWSCDQCTFLNDERQSVCAMC  249
             P   +  +AP     P   WSC+ CT LN+   + C++C
Sbjct  1095  PKSILSASAPVEQSTPAVNWSCNACTMLNEANDTKCSVC  1133

 Score = 31.6 bits (70),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 18/42 (43%), Gaps = 0/42 (0%)

Query  213   DEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTK  254
             D+ ++Q    A +P   W C  CT  N    + C MC    K
Sbjct  1166  DDAAKQDHRMAMQPTSSWICSACTMKNKTLDATCHMCATARK  1207

>H257_12440
Length=425

 Score = 32.0 bits (71),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKR  258
            WSC +CT  N+     C  CGA T +  R
Sbjct  386  WSCARCTLENESHVDTCEACGAPTTRPAR  414

>PYU1_G003752
Length=520

 Score = 32.0 bits (71),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 1/24 (4%)

Query  229  GWSCDQCTFLND-ERQSVCAMCGA  251
             WSC  CTFLND E  + CA+C A
Sbjct  3    AWSCASCTFLNDNEALAQCAVCNA  26

>PYVX_23057
Length=94

 Score = 30.0 bits (66),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGA  251
            + WSC  CT  ND    VC  CGA
Sbjct  6    ESWSCAACTLQNDVTAEVCDACGA  29

>HYAP_10722
Length=1261

 Score = 32.0 bits (71),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230   WSCDQCTFLNDERQSVCAMC  249
             W C  CT++ND+   VC MC
Sbjct  1229  WVCPACTYVNDDTDIVCEMC  1248

>SDRG_12787
Length=4071

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 25/56 (45%), Gaps = 2/56 (4%)

Query  206   QLTCGTHDEPSRQIGEAAPEPYDG--WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
             +L    H +P+++   A     D   W C  CT+ N+   + CAMC     K  ++
Sbjct  3941  KLCAAFHVDPTKEHHAAKSTADDDALWMCSVCTYTNEALLTACAMCSEPRDKLAKT  3996

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 13/49 (27%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query  209   CGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
             C    EP  ++ +  P+    W+C+ CT +N   ++ C++C  G   R+
Sbjct  3983  CAMCSEPRDKLAKT-PQA-TTWTCENCTCVNPIVETTCSVCEMGMSGRR  4029

>PHYCA_568946
Length=876

 Score = 32.0 bits (71),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  225  EPYDGWSCDQCTFLNDERQSVCAMCG  250
            EP   WSC +CT +N    + C+ CG
Sbjct  830  EPAGVWSCSRCTLINPTSSASCSSCG  855

>PYIW_18680
Length=755

 Score = 32.0 bits (71),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            W C  C F N E ++ CA+CG   K++  S
Sbjct  65   WICWYCDFANYEMKTQCALCGNDKKQKDFS  94

>SPRG_12059
Length=1015

 Score = 32.0 bits (71),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 0/22 (0%)

Query  230   WSCDQCTFLNDERQSVCAMCGA  251
             W C QCTF+ND     C +C A
Sbjct  991   WVCAQCTFVNDADLVACEVCDA  1012

>H310_07947
Length=634

 Score = 32.0 bits (71),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGA  251
            D W CD C F N+  +  C +CG 
Sbjct  70   DQWKCDICDFCNNVSKPECVLCGT  93

>HYAP_01775
Length=765

 Score = 32.0 bits (71),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCG  250
            +  W+C +CT LN++  + CA CG
Sbjct  737  FQPWACPRCTLLNEKMVATCAACG  760

>PYIR_24101
Length=414

 Score = 32.0 bits (71),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 25/93 (27%), Positives = 38/93 (41%), Gaps = 17/93 (18%)

Query  159  QRMRHQALVGANGSCR--LGGDASATAASLTPAMLRQKALKAAERRRHDQLTCGTHDEPS  216
            +R  +  L G+N + R  LGG+         P  L +   KA +R        G H E +
Sbjct  307  RRSLNAKLYGSNVTARQILGGE--------VPCTLAEPLWKALDR------ALGVHREYA  352

Query  217  RQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
              +    P  + G SCD C ++N     +C  C
Sbjct  353  NGLPVLVPS-FVGVSCDACGYMNTSENHMCMRC  384

>PYIR_22040
Length=457

 Score = 32.0 bits (71),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (63%), Gaps = 0/27 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKR  256
            W C +CT +N+   S+C  CG  +K++
Sbjct  411  WDCPRCTLVNETSSSLCEACGYESKQQ  437

>SDRG_05055
Length=1015

 Score = 32.0 bits (71),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 0/22 (0%)

Query  230   WSCDQCTFLNDERQSVCAMCGA  251
             W C QCTF+ND     C +C A
Sbjct  992   WVCAQCTFVNDADLIACEVCDA  1013

>H310_05680
Length=104

 Score = 30.0 bits (66),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (54%), Gaps = 0/26 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGT  253
            D W+C +CT LN      C  CGA +
Sbjct  7    DNWACPECTLLNKLLAEACEACGATS  32

>SDRG_07504
Length=1097

 Score = 32.0 bits (71),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (4%)

Query  226  PYDG-WSCDQCTFLNDERQSVCAMCGA  251
            PY+  WSC +CT L     + C +CGA
Sbjct  326  PYEPEWSCSECTMLQPMAYTFCGVCGA  352

>PHYCA_557065
Length=242

 Score = 31.2 bits (69),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 33/65 (51%), Gaps = 3/65 (5%)

Query  69   RLRPAERPTSFLPFEHLLGTMLHELVHMKIGPHNAAFYKLLDELTSEMESLMAQGLIGIT  128
            R  P+  P+ +L  + +L  ML+E V      HN  + +L D+L S+   L   G++ + 
Sbjct  150  RATPSVLPSVYLKVDTMLANMLNEAVRSSQLEHNQQWQQLKDDLVSQ---LAQTGMMKVF  206

Query  129  GAQFQ  133
              +F+
Sbjct  207  ENKFK  211

>PPTG_17523
Length=739

 Score = 32.0 bits (71),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query  187  TPAMLRQKALKAAERRRHDQLTCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVC  246
            TP +L  +A+  +      + +    + P+ Q     P P   W CD C   N  R+++C
Sbjct  95   TPLVLEHRAVNVSYTDGFRRRSADDSNRPNDQRQGWQPRP--DWICDGCNVTNFARRTIC  152

Query  247  AMCGA  251
              C A
Sbjct  153  FQCNA  157

>PPTG_18193
Length=146

 Score = 30.8 bits (68),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMC  249
            P + WSC  CTF+N      C MC
Sbjct  28   PMEPWSCPSCTFVNRPLSMQCEMC  51

>H257_12425
Length=706

 Score = 32.0 bits (71),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (64%), Gaps = 0/22 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGA  251
            W C  C  +N   +S+CA+CGA
Sbjct  86   WQCVVCAHMNHPDKSICALCGA  107

>PHYCA_541576
Length=583

 Score = 31.6 bits (70),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMC  249
            P + WSC  CTF+N      C MC
Sbjct  462  PMEPWSCPSCTFVNRPLSMQCEMC  485

>PYIW_20686
Length=526

 Score = 31.6 bits (70),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCG  250
            W C +CT +N+   SVC  CG
Sbjct  481  WDCPRCTLMNEMSSSVCEACG  501

>H257_01530
Length=666

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 17/39 (44%), Gaps = 7/39 (18%)

Query  230  WSCDQCTFLNDERQSVCAMCGA-------GTKKRKRSMG  261
            W+CD C F N +    C +CG        G    KRS G
Sbjct  76   WACDVCDFKNYDGHKTCILCGTERDFTLYGKASSKRSSG  114

>PPTG_12239
Length=4322

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 12/21 (57%), Gaps = 0/21 (0%)

Query  229   GWSCDQCTFLNDERQSVCAMC  249
             GW C  CTF+N      CA+C
Sbjct  4252  GWRCGNCTFINQPDDVSCAIC  4272

>PHALS_11109
Length=1073

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (57%), Gaps = 3/37 (8%)

Query  230   WSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVNL  266
             WSC +CT +N E    C+ CG    + +RS   +++L
Sbjct  1032  WSCLRCTLINSETNGSCSSCGY---RYQRSRPKIIDL  1065

>PYAP_16329
Length=1201

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 11/23 (48%), Gaps = 0/23 (0%)

Query  230   WSCDQCTFLNDERQSVCAMCGAG  252
             W C  CTF+ND     C MC   
Sbjct  1173  WVCSACTFVNDAGDEACEMCSTA  1195

>H310_11898
Length=2428

 Score = 32.0 bits (71),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 0/26 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGA  251
            P   WSC  CT  N     VC  CGA
Sbjct  334  PLQEWSCPVCTVTNSSSAHVCTTCGA  359

 Score = 31.6 bits (70),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  208   TCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
             TC  +  P+   G  +P+ ++ W C QCT +N    S+C++C
Sbjct  967   TCQCYAVPASARG--SPD-FNLWRCPQCTVVNATSVSICSVC  1005

>SPRG_12726
Length=1089

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (4%)

Query  226  PYDG-WSCDQCTFLNDERQSVCAMCGA  251
            PY+  WSC +CT L     + C +CGA
Sbjct  316  PYEPEWSCSECTMLQPMAYTFCGVCGA  342

>PYIR_22962
Length=1366

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 9/39 (23%)

Query  232  CDQCTFLNDERQSVCAMCGA---------GTKKRKRSMG  261
            C  C F N +  SVC++CG          G KK+K+++G
Sbjct  757  CKLCGFTNFQTSSVCSVCGEPIPAASASNGDKKKKKTVG  795

>H310_05197
Length=410

 Score = 31.6 bits (70),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 0/34 (0%)

Query  225  EPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKR  258
            E    W+C +CT  N+     C +CGA T K  R
Sbjct  366  ETSTTWTCARCTLENEPHVEKCEVCGAPTTKPTR  399

>PYAP_14575
Length=624

 Score = 31.6 bits (70),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (5%)

Query  222  AAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVV  264
            A+ E  + W C  C F N   +S C +C  GTK+     G+VV
Sbjct  40   ASGEGDERWKCLVCEFTNAMEKSSCILC--GTKRNATRRGSVV  80

>PITG_00223
Length=1076

 Score = 32.0 bits (71),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 12/42 (29%), Positives = 23/42 (55%), Gaps = 3/42 (7%)

Query  225   EPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVVNL  266
             +P   WSC +CT +N    + C+ CG    + +R+   +++L
Sbjct  1030  KPAAAWSCSRCTLINPPTNASCSSCG---HRYRRARPQIIDL  1068

>PYAP_13401
Length=2054

 Score = 32.0 bits (71),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (52%), Gaps = 0/27 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAG  252
            P   WSC  CT+LN    S C MC + 
Sbjct  605  PQTEWSCAACTYLNGGTASKCVMCDSA  631

>PHALS_06460
Length=728

 Score = 31.6 bits (70),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 18/39 (46%), Gaps = 0/39 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTKKRKRSMGAVV  264
            P  GW C+ C   N+   S C +CG   + +  +   VV
Sbjct  151  PNCGWKCEVCRHTNEISSSECVLCGTSPEAQSNNASVVV  189

>HYAP_09598
Length=840

 Score = 31.6 bits (70),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 18/42 (43%), Gaps = 0/42 (0%)

Query  208  TCGTHDEPSRQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMC  249
            TC    E + Q  E        W C  CTF+N    + CA+C
Sbjct  749  TCEACSEANPQHHEVQQPQRQEWRCGNCTFINRSDDATCAIC  790

>PPTG_18194
Length=534

 Score = 31.6 bits (70),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMC  249
            P + WSC  CTF+N      C MC
Sbjct  416  PMEPWSCPSCTFVNRPLSMQCEMC  439

>PHYRA_94679
Length=431

 Score = 31.6 bits (70),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMC  249
             W+C  CTFLN+  +  C MC
Sbjct  58   NWNCPACTFLNEAPRCFCEMC  78

>PYAP_19127
Length=649

 Score = 31.6 bits (70),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 23/47 (49%), Gaps = 1/47 (2%)

Query  210  GTHDEPSRQIGEAAPEPYDGWS-CDQCTFLNDERQSVCAMCGAGTKK  255
             + D   R++  A  E   G+  C QC F N  R + C +CGA  ++
Sbjct  52   SSEDAIERRVQVAVREARLGFRVCAQCDFTNPRRNASCVICGAKVRE  98

>H257_01539
Length=661

 Score = 31.6 bits (70),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 17/39 (44%), Gaps = 7/39 (18%)

Query  230  WSCDQCTFLNDERQSVCAMCGA-------GTKKRKRSMG  261
            W+CD C F N +    C +CG        G    KRS G
Sbjct  71   WACDVCDFKNYDGHKTCILCGTERDFTLYGKASSKRSSG  109

>PPTG_14855
Length=760

 Score = 31.6 bits (70),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  226  PYDGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
            P  GW C+ C   N+  Q+ C +CG   ++ K
Sbjct  168  PNAGWKCEVCLHTNEFSQTGCVLCGTTAEELK  199

>PPTG_05700
Length=744

 Score = 31.6 bits (70),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 14/24 (58%), Gaps = 0/24 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCG  250
            +  W+C +CT LN+     CA CG
Sbjct  705  FQPWACPRCTLLNNTIDPTCAACG  728

>H310_11750
Length=910

 Score = 31.6 bits (70),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (56%), Gaps = 1/27 (4%)

Query  229  GWSCDQCTFLNDERQSVCA-MCGAGTK  254
            GW C +CTFLN  + S C    G G K
Sbjct  417  GWMCPKCTFLNRHQDSTCQNAVGIGVK  443

>PPTG_10950
Length=1079

 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  225   EPYDGWSCDQCTFLNDERQSVCAMCG  250
             +P   WSC +CT +N +  + C+ CG
Sbjct  1033  KPAAAWSCSRCTLINLQTNASCSSCG  1058

>PHALS_12522
Length=75

 Score = 29.3 bits (64),  Expect = 7.3, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 18/31 (58%), Gaps = 0/31 (0%)

Query  210  GTHDEPSRQIGEAAPEPYDGWSCDQCTFLND  240
            G  DE S +  E+A +PY  W+C +   L+D
Sbjct  13   GGVDEASSRSDESASDPYYRWNCKRSDMLSD  43

>H310_13382
Length=241

 Score = 30.8 bits (68),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 3/38 (8%)

Query  215  PSRQIGEAAPEPYDG---WSCDQCTFLNDERQSVCAMC  249
            PS++   A P+       W+C  CT+LN     VCAMC
Sbjct  198  PSQKRSNAPPQVPPSKKRWTCAACTYLNVSLSHVCAMC  235

>PYAR_13176
Length=621

 Score = 31.6 bits (70),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 42/103 (41%), Gaps = 21/103 (20%)

Query  163  HQALVGANGSCRLGGDASATAASLTPAMLRQKALKAAERRRHD-------QLTCGTHDEP  215
            H A VGA  +  +G  +SA     TPA  R      A RR H+       QL C     P
Sbjct  8    HDANVGAEPTANVGA-SSALPTDPTPAQRR------AVRRLHEAMEAFEAQLQC-----P  55

Query  216  SRQIGEAAPE--PYDGWSCDQCTFLNDERQSVCAMCGAGTKKR  256
                   AP   P +   C++C     E + VC +C A  KKR
Sbjct  56   ICLCAYTAPASLPCNHCFCEECIHRALELKQVCPICKAPAKKR  98

>PYAR_15385
Length=497

 Score = 31.2 bits (69),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 22/54 (41%), Gaps = 4/54 (7%)

Query  208  TCGTHDEPSRQI----GEAAPEPYDGWSCDQCTFLNDERQSVCAMCGAGTKKRK  257
             CG   EP+  +     +       GW C  CTF+N      CA+C  G   ++
Sbjct  402  VCGACSEPNPLLLSDETKTTSSSQQGWQCANCTFINLPGDVACAICELGVDGQR  455

>PYVX_21625
Length=785

 Score = 31.6 bits (70),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            W C  C F N E ++ CA+CG   K ++ S
Sbjct  122  WICWYCDFANYELKTNCALCGHEKKDKQSS  151

>SPRG_16444
Length=629

 Score = 31.2 bits (69),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 14/27 (52%), Gaps = 0/27 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKR  256
            W C  C F+N E + +C++C      R
Sbjct  68   WECSVCAFMNLETKPICSLCSTHRDYR  94

>H310_01265
Length=430

 Score = 31.2 bits (69),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRKRS  259
            W+C +CT +ND   + C  CG   +   ++
Sbjct  3    WTCPRCTLINDSSSTTCDACGHSARPPDKA  32

>PPTG_06518
Length=687

 Score = 31.2 bits (69),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 1/23 (4%)

Query  228  DGWSCDQCTFLN-DERQSVCAMC  249
            + W C  CTFLN D R S C +C
Sbjct  50   NAWECRMCTFLNEDTRASRCELC  72

>CCA23237
Length=2179

 Score = 31.6 bits (70),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 12/24 (50%), Gaps = 0/24 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGA  251
            D WSC  CTF N+     C MC  
Sbjct  25   DFWSCGTCTFQNESYLQYCEMCST  48

>PPTG_19285
Length=1115

 Score = 31.6 bits (70),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC +CTF N+     CAMC
Sbjct  50   WSCSRCTFENEAPVGQCAMC  69

>SDRG_01371
Length=443

 Score = 31.2 bits (69),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 15/28 (54%), Gaps = 0/28 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGAGTKKRK  257
            W+C +CT +ND     C  CG    K++
Sbjct  406  WACPRCTLVNDMHIDECLACGGPNSKKR  433

>PYAP_15290
Length=701

 Score = 31.2 bits (69),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 0/34 (0%)

Query  217  RQIGEAAPEPYDGWSCDQCTFLNDERQSVCAMCG  250
            + + E++ E  + W C+ C F N      C +CG
Sbjct  82   QDVQESSDELQNQWKCEVCDFYNKPSSKSCVLCG  115

>PYU1_G004545
Length=665

 Score = 31.2 bits (69),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 0/25 (0%)

Query  229  GWSCDQCTFLNDERQSVCAMCGAGT  253
            GW C  C + N+++   C MCG  +
Sbjct  67   GWQCIVCAYSNNDKHKNCLMCGTSS  91

>PYAR_18001
Length=668

 Score = 31.2 bits (69),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 12/26 (46%), Gaps = 0/26 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMCGAGT  253
            D W C  C + N   +S C MCG   
Sbjct  69   DAWQCVVCAYTNSASRSACLMCGTSV  94

>SDRG_11726
Length=669

 Score = 31.2 bits (69),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (64%), Gaps = 0/22 (0%)

Query  230  WSCDQCTFLNDERQSVCAMCGA  251
            W+C  CT +N  R   C++CGA
Sbjct  125  WTCSMCTLINTARLLKCSVCGA  146

>H310_12417
Length=268

 Score = 30.8 bits (68),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query  220  GEAAPEPYDG-WSCDQCTFLNDERQSVCAMC  249
            G+A+ E  DG W C +CT+ N  + S C +C
Sbjct  123  GDASVESTDGSWRCLRCTYQNQYQDSFCVVC  153

>PHYSO_492770
Length=184

 Score = 30.4 bits (67),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 12/22 (55%), Gaps = 0/22 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMC  249
              W C QCT+ N    S C+MC
Sbjct  148  SSWRCTQCTYTNTCFDSRCSMC  169

>PITG_16494
Length=102

 Score = 29.3 bits (64),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (52%), Gaps = 0/27 (0%)

Query  225  EPYDGWSCDQCTFLNDERQSVCAMCGA  251
            E  D W+C  CT  N+     CA CGA
Sbjct  4    EEIDSWTCPGCTLKNELTVEACAACGA  30

>PYU1_G004101
Length=162

 Score = 30.4 bits (67),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (52%), Gaps = 10/89 (11%)

Query  49   FPKNANLLGMNV-NHGWKIYVRLRPAE---RPTSFLPFEHLLGTMLHELVHMKIGPHNAA  104
            FP     LG+   +HG  I +R+  A    R  +FL   H L T+++ L+ +K+GP +A+
Sbjct  64   FPTITVFLGLTAPSHGLAI-LRMLAASLFYRSFAFLIEPHDLKTVIYRLLGLKLGPDSAS  122

Query  105  FYKLLDELTSEMESLMAQGLIGITGAQFQ  133
                +  L ++  SL+ + L G+ G  F 
Sbjct  123  ----VITLPTQARSLLDR-LFGVDGKYFY  146

>H257_01643
Length=696

 Score = 31.2 bits (69),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%)

Query  230  WSCDQCTFLNDERQSVCAMC  249
            WSC  CT +ND   + CA C
Sbjct  638  WSCSHCTLINDVGATTCAAC  657

>H310_11857
Length=452

 Score = 30.8 bits (68),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 12/22 (55%), Gaps = 0/22 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMC  249
            D W C  CTFLN    + C +C
Sbjct  82   DSWECPMCTFLNHAALATCEIC  103

>SPRG_21525
Length=1119

 Score = 31.2 bits (69),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 19/44 (43%), Gaps = 7/44 (16%)

Query  209  CGTHDEPSRQIGEAAP--EPYDGWSCDQCTFLNDERQSVCAMCG  250
            CGT      ++  A P       W+C  CT LN     VC++C 
Sbjct  88   CGT-----AKVASAGPPASTSSSWACSACTLLNPRDAQVCSVCS  126

>PYAR_13796
Length=727

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 0/22 (0%)

Query  228  DGWSCDQCTFLNDERQSVCAMC  249
            D W C +CT+LN     VC +C
Sbjct  51   DEWECTRCTYLNASEILVCEIC  72

>PYVX_21156
Length=774

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  227  YDGWSCDQCTFLNDERQSVCAMCG  250
            Y  W C +CT LND +   C  CG
Sbjct  748  YLPWQCPRCTLLNDTKAVECLACG  771

Lambda      K        H        a         alpha
   0.321    0.134    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 17151781731

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40