Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_20854111471041045402e-72
PHYKE_5841111471211023513e-43
PPTG_09252111471051073451e-42
PITG_1373911147105983451e-42
PHYSO_315017111471091023391e-41
PHYCA_535380111471081073391e-41
PHYRA_81675111471061023372e-41
PYAP_22846111471041043042e-36
HYAP_08499111471081023025e-36
PYIW_14743111471051042964e-35
HYAP_08500652601721023014e-35
PHALS_1156411147107992912e-34
PYIR_15186111471091022773e-32
PYAR_2320711147112812773e-32
PYU1_G005963111471031052747e-32
SPRG_1288311147105852495e-28
SDRG_1491211147105852495e-28
H257_073581114798852452e-27
H310_075671114798912372e-26
CCI4423211147105802295e-25
CCA1752111147104882271e-24
PYVX_181801475513584993e-05
PHALS_064791475513658932e-04
PYU1_G013186793911464880.001
PPTG_171261475513664870.002
PHYCA_118341475513460840.005
PHYRA_959031475513460810.014
PITG_1155594928870790.014
PYIW_199701475513054790.019
PYU1_G011200593711482790.020
PYU1_G00921817518656770.023
PHYKE_83921475513858790.027
PHYSO_3211551475513658780.037
CCA175421475512051770.037
PYU1_G0017361475512354770.040
PITG_184551475513258750.090
HYAP_071031475516454750.10
PYIR_1688079399648710.19
PYAP_2084717518664710.20
PYIW_18388593711482710.23
PYIR_13291593710682710.25
SDRG_0542012501211894700.38
CCA201021340311467700.41
PITG_0199217518855690.41
PYAP_177471475513455690.54
CCI487201340311475680.60
PHYSO_28898317518855670.60
PPTG_1958817518855670.69
H257_062931475512353671.0
PYU1_G0025078274343335681.2
PYVX_22540175110159651.5
H310_092241475512353651.9
PPTG_194622470938331662.1
PPTG_194692471338331662.1
PYVX_189211216136242644.2
PPTG_148282294911034615.7
CCI1036494929044615.8
H310_06072125012121104615.9
SPRG_1415312977741280636.4
CCI48351765280040627.3
SPRG_1301612904831636627.6
HYAP_08762175111249607.9
CCI448201475512355609.3
CCI405825408503044629.3
PHYKE_2868911022260619.8
PPTG_15919258310573609.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_20854

Length=104
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYVX_20854                                                            212     2e-72
PHYKE_5841                                                            139     3e-43
PPTG_09252                                                            137     1e-42
PITG_13739                                                            137     1e-42
PHYSO_315017                                                          135     1e-41
PHYCA_535380                                                          135     1e-41
PHYRA_81675                                                           134     2e-41
PYAP_22846                                                            121     2e-36
HYAP_08499                                                            120     5e-36
PYIW_14743                                                            118     4e-35
HYAP_08500                                                            120     4e-35
PHALS_11564                                                           116     2e-34
PYIR_15186                                                            111     3e-32
PYAR_23207                                                            111     3e-32
PYU1_G005963                                                          110     7e-32
SPRG_12883                                                            100     5e-28
SDRG_14912                                                            100     5e-28
H257_07358                                                            99.0    2e-27
H310_07567                                                            95.9    2e-26
CCI44232                                                              92.8    5e-25
CCA17521                                                              92.0    1e-24
PYVX_18180                                                            42.7    3e-05
PHALS_06479                                                           40.4    2e-04
PYU1_G013186                                                          38.5    0.001
PPTG_17126                                                            38.1    0.002
PHYCA_11834                                                           37.0    0.005
PHYRA_95903                                                           35.8    0.014
PITG_11555                                                            35.0    0.014
PYIW_19970                                                            35.0    0.019
PYU1_G011200                                                          35.0    0.020
PYU1_G009218                                                          34.3    0.023
PHYKE_8392                                                            35.0    0.027
PHYSO_321155                                                          34.7    0.037
CCA17542                                                              34.3    0.037
PYU1_G001736                                                          34.3    0.040
PITG_18455                                                            33.5    0.090
HYAP_07103                                                            33.5    0.10 
PYIR_16880                                                            32.0    0.19 
PYAP_20847                                                            32.0    0.20 
PYIW_18388                                                            32.0    0.23 
PYIR_13291                                                            32.0    0.25 
SDRG_05420                                                            31.6    0.38 
CCA20102                                                              31.6    0.41 
PITG_01992                                                            31.2    0.41 
PYAP_17747                                                            31.2    0.54 
CCI48720                                                              30.8    0.60 
PHYSO_288983                                                          30.4    0.60 
PPTG_19588                                                            30.4    0.69 
H257_06293                                                            30.4    1.0  
PYU1_G002507                                                          30.8    1.2  
PYVX_22540                                                            29.6    1.5  
H310_09224                                                            29.6    1.9  
PPTG_19462                                                            30.0    2.1  
PPTG_19469                                                            30.0    2.1  
PYVX_18921                                                            29.3    4.2  
PPTG_14828                                                            28.1    5.7  
CCI10364                                                              28.1    5.8  
H310_06072                                                            28.1    5.9  
SPRG_14153                                                            28.9    6.4  
CCI48351                                                              28.5    7.3  
SPRG_13016                                                            28.5    7.6  
HYAP_08762                                                            27.7    7.9  
CCI44820                                                              27.7    9.3  
CCI40582                                                              28.5    9.3  
PHYKE_2868                                                            28.1    9.8  
PPTG_15919                                                            27.7    9.8  

>PYVX_20854
Length=104

 Score = 212 bits (540),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI
Sbjct  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKTVGGKRE  104
            QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKTVGGKRE
Sbjct  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKTVGGKRE  104

>PHYKE_5841
Length=121

 Score = 139 bits (351),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 3/102 (3%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EV R+YRRILKLAQRYPSVKRDSI+RDIKTEFH +K L+DAQ++RE++ +ARAGI
Sbjct  1    MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVG  100
            +ELSQYA+LHPS+ +W++EVGRDA+  + PP   G+  K VG
Sbjct  61   KELSQYASLHPSSVNWSIEVGRDAI-QSPPPVHGGVNAKVVG  101

>PPTG_09252
Length=105

 Score = 137 bits (345),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 5/107 (5%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EV+RLYRRILKLAQRYPSVKR+SI+RDIKTEFH NK L+DAQ++RE++ + RAGI
Sbjct  1    MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKT---VGGKRE  104
             ELS YA+LHPS  +W+VEVGRDA+    PP   G+      GGK+E
Sbjct  61   TELSMYASLHPSLPNWSVEVGRDAI--QPPPVHGGVNAKIISGGKKE  105

>PITG_13739
Length=105

 Score = 137 bits (345),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 2/98 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA+  EV+R+YRRILKLAQRYPS+KR+SI+RDIKTEFH NK L+DAQ++RE++ + RAGI
Sbjct  1   MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKT  98
            ELS YA+LHPS  +W+VEVGRDA+    PP   G+KT
Sbjct  61  TELSMYASLHPSLPNWSVEVGRDAI--HPPPMHGGVKT  96

>PHYSO_315017
Length=109

 Score = 135 bits (339),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 3/102 (3%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EV+R+YRRILKLAQRYPSVKR+SI+RDIKTEFH NK L+DAQ++RE++ + RAGI
Sbjct  1    MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVG  100
            +ELS YA+LHPS  +W+VEVGRDA+    PP   G+  K VG
Sbjct  61   KELSMYASLHPSLPNWSVEVGRDAI-QPPPPVHGGVNAKVVG  101

>PHYCA_535380
Length=108

 Score = 135 bits (339),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 4/107 (4%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EV+R+YRRILKLA RYPS+KR+SI+RDIKTEFH NK+L+DAQ++RE++ + RAGI
Sbjct  1    MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVG-GKRE  104
            +ELS YA LHPS  +W+VEVGRDA+    PP   G+  K VG GK+E
Sbjct  61   KELSMYANLHPSLPNWSVEVGRDAI-QPPPPVHGGVSAKVVGDGKKE  106

>PHYRA_81675
Length=106

 Score = 134 bits (337),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 3/102 (3%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EVVR+YRRILKLAQRYPS+KR SI+RDIKTEFH NK L+DAQ++RE++ + RAGI
Sbjct  1    MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVG  100
            +ELS YA+LHPS  +W+VEVGRDA+    PP   G+  K VG
Sbjct  61   KELSMYASLHPSLPNWSVEVGRDAI-QPPPPVHGGVSAKVVG  101

>PYAP_22846
Length=104

 Score = 121 bits (304),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 1/104 (1%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MAD+ +V+RLYR ILKLA++YPSVKRD+I++DIK EFHE K  +DA+ ++ KI AA+AGI
Sbjct  1    MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGN-GIKTVGGKR  103
            +ELS YA L+PS+ +WTV VGR+  P A    G+   K VG K+
Sbjct  61   KELSMYATLNPSSTAWTVGVGREVSPEATQAAGDTNTKVVGNKQ  104

>HYAP_08499
Length=108

 Score = 120 bits (302),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 1/102 (1%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EV+R+YRRILKLAQRYPS+KR SI+ DIK+EF  N+ LSDAQ+VR+++   +AGI
Sbjct  1    MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPK-GNGIKTVGG  101
            +ELS YA+LHPS  +W +EVG D  P     + G+ +K +GG
Sbjct  61   KELSMYASLHPSLPNWNIEVGHDVAPMPFDVQSGDDVKDIGG  102

>PYIW_14743
Length=105

 Score = 118 bits (296),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 3/104 (3%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EVVRLYRRILKLA +YPS+KR +I+R+IK EFH+NK L+D+ ++ +K+ +AR GI
Sbjct  1    MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKT--VGGK  102
             ELSQY  L+PS+ +W V+VGR+ +    P  G G+ T  VGGK
Sbjct  61   VELSQYTNLNPSSMTWKVDVGRE-VGVGGPAIGQGVSTKVVGGK  103

>HYAP_08500
Length=172

 Score = 120 bits (301),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 1/102 (1%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EV+R+YRRILKLAQRYPS+KR SI+ DIK+EF  N+ LSDAQ+VR+++   +AGI
Sbjct  65   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  124

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPK-GNGIKTVGG  101
            +ELS YA+LHPS  +W +EVG D  P     + G+ +K +GG
Sbjct  125  KELSMYASLHPSLPNWNIEVGHDVAPMPFDVQSGDDVKDIGG  166

>PHALS_11564
Length=107

 Score = 116 bits (291),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 78/99 (79%), Gaps = 1/99 (1%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA+  +V+R+YRR+LKLAQ YPS+KR++I+RDIK EFH N  ++DAQ++ E + +A AGI
Sbjct  1   MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  61  QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKTV  99
           +ELS YA+LHPS  +W+VEVGRDA+ +    +G+ +K V
Sbjct  61  KELSMYASLHPSQPNWSVEVGRDAIQSQL-REGSQVKVV  98

>PYIR_15186
Length=109

 Score = 111 bits (277),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 2/102 (2%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            MA+  EVVR+YRRILKLA +YPS+KR++I+R+IK EFH NK L+D  ++ +K+ +AR GI
Sbjct  1    MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI--KTVG  100
             ELSQY  L+PS+ +W V+VGR+    A P    G+  K VG
Sbjct  61   VELSQYTNLNPSSMTWKVDVGREVGLGAGPAVSQGVSAKVVG  102

>PYAR_23207
Length=112

 Score = 111 bits (277),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQ  65
           EVVRLYRR+L+LA++YPS+KRD++V DIK EFHE K L+DA  +  KI AA+AGI+ELSQ
Sbjct  9   EVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKELSQ  68

Query  66  YAALHPSAASWTVEVGRDALP  86
           YA+L   A SWTV+VGR+  P
Sbjct  69  YASLRSDAMSWTVDVGREVEP  89

>PYU1_G005963
Length=103

 Score = 110 bits (274),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 5/105 (5%)

Query  1    MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
            M +  EVVR+YRRILKLA +YPS+KR++I+RDIK EF ENK L+DA  +  K+ +AR GI
Sbjct  1    MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

Query  61   QELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGI---KTVGGK  102
             ELSQY  L+PS+ +W V+VGR+      PP G  +   K VG K
Sbjct  61   VELSQYTNLNPSSMTWKVDVGREV--GQGPPAGGPVVNAKVVGEK  103

>SPRG_12883
Length=105

 Score = 100 bits (249),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 1/85 (1%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA R  V ++YRR+LKLAQR+PS+K+D +V DIK EFHEN +L+DA +++EKI  A  GI
Sbjct  1   MAGR-SVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGI  59

Query  61  QELSQYAALHPSAASWTVEVGRDAL  85
           ++L QY  L P+A SWTVE+ +D  
Sbjct  60  EQLGQYVHLDPTAHSWTVEMEKDPF  84

>SDRG_14912
Length=105

 Score = 100 bits (249),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 1/85 (1%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA R  V ++YRR+LKLAQR+PS+K+D +V DIK EFHEN +L+DA +++EKI  A  GI
Sbjct  1   MAGR-SVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGI  59

Query  61  QELSQYAALHPSAASWTVEVGRDAL  85
           ++L QY  L P+A SWTVE+ +D  
Sbjct  60  EQLGQYVHLDPTAHSWTVEMEKDPF  84

>H257_07358
Length=98

 Score = 99.0 bits (245),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 64/85 (75%), Gaps = 0/85 (0%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           M+    V ++YRR+L+LA ++PS+K+  +V+DIK EFHENKAL+D  +++EKI  A  GI
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGI  60

Query  61  QELSQYAALHPSAASWTVEVGRDAL  85
           Q+L+QY AL P+A SW+V++ +D  
Sbjct  61  QQLNQYVALDPNAQSWSVDMDKDPF  85

>H310_07567
Length=98

 Score = 95.9 bits (237),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 65/91 (71%), Gaps = 0/91 (0%)

Query  7   VVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQY  66
           V ++YRR+L+LA+++PS+KRD +V DIK EFH+NK L+D  +++EK+  A  GIQ+L+QY
Sbjct  7   VPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQLNQY  66

Query  67  AALHPSAASWTVEVGRDALPTAAPPKGNGIK  97
            +L P+A  W+V++ +D      P +   +K
Sbjct  67  VSLDPNAQHWSVDMEKDPFGQNHPDRPQSLK  97

>CCI44232
Length=105

 Score = 92.8 bits (229),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 61/80 (76%), Gaps = 0/80 (0%)

Query  3   DRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQE  62
           +R ++  LYRRIL+LA+RYPS+KRD+IV DI+ EF E++ ++    + +KI +A AGI+E
Sbjct  2   ERAQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKE  61

Query  63  LSQYAALHPSAASWTVEVGR  82
           L  YA L+P  A+WTVE+GR
Sbjct  62  LMMYANLNPVEANWTVEIGR  81

>CCA17521
Length=104

 Score = 92.0 bits (227),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 63/88 (72%), Gaps = 3/88 (3%)

Query  3   DRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQE  62
           +R ++  LYRRIL+LA+RYPS+KRD+I+ DI+ EF E++ ++ A  +  KI +A AGI+E
Sbjct  2   ERTQIFGLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKE  61

Query  63  LSQYAALHPSAASWTVEVGRDALPTAAP  90
           L  YA L+P   +WTVE+GR   P+  P
Sbjct  62  LLMYANLNPVDPNWTVEIGR---PSEKP  86

>PYVX_18180
Length=135

 Score = 42.7 bits (99),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 0/84 (0%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA   E+  LY+++L+LAQ  P  KR S V  I+TEF  +  ++DA +V + +  A++ +
Sbjct  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60

Query  61  QELSQYAALHPSAASWTVEVGRDA  84
             L       PSA+     + R+ 
Sbjct  61  GYLKIVTPRGPSASGVKRYIYRNG  84

>PHALS_06479
Length=136

 Score = 40.4 bits (93),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           E+  LY+++L+LAQ  P  KR S +  I+ EF  ++ L+D ++V E I  A++ +  L
Sbjct  7   ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64

>PYU1_G013186
Length=114

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query  10  LYRRILKLAQRYPS--VKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQYA  67
           LYRR+L++A+ +    V++  I R+ +T F E +A++DA+++RE + A    +     Y 
Sbjct  7   LYRRVLRVARTWEGGYVEQQWIRREARTRFEEQRAITDARRIRELVQAGHDQVDVALHYQ  66

Query  68  ALHP  71
             +P
Sbjct  67  IPYP  70

>PPTG_17126
Length=136

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (2%)

Query  1   MADRLEVVR-LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAG  59
           MA+ +  +R LY+++L+LAQ  P  KR S +  I+ +F  +  L+D Q+V   I  A++ 
Sbjct  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  60  IQEL  63
           +  L
Sbjct  61  LSYL  64

>PHYCA_11834
Length=134

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 1/60 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA R E+  LY+++L+LAQ  P  KR + +  I+ EF  ++ L+D ++V + +  A++ +
Sbjct  1   MAAR-ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59

>PHYRA_95903
Length=134

 Score = 35.8 bits (81),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           MA R E+  LY+++L+LAQ  P  KR   +  I+ EF  ++ L+D ++V   I  A++ +
Sbjct  1   MAAR-ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59

>PITG_11555
Length=88

 Score = 35.0 bits (79),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 36/70 (51%), Gaps = 10/70 (14%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKALSDA--------QQVRE  51
           MA    V+RLYR +L+ A ++ +   R    R IK +FH+NK L           Q VRE
Sbjct  1   MASSSSVLRLYREMLRNAAKFETYNFRAYATRRIKEDFHKNKTLKSGSPELEKTLQLVRE  60

Query  52  KI-MAARAGI  60
           ++ +  R GI
Sbjct  61  QVDVLGRQGI  70

>PYIW_19970
Length=130

 Score = 35.0 bits (79),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           +Y+++L+LA+  P  KR++  + I++EF   K LSD +++   +  A++ I  L
Sbjct  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69

>PYU1_G011200
Length=114

 Score = 35.0 bits (79),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 10/82 (12%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQE------L  63
           LYRR L + + YP +    +   +KT F +N+ L+D  ++++ I   R  +QE      L
Sbjct  8   LYRRFLHVGKDYP-LGLPYVREKVKTAFLKNRDLTDPLEIKKAIHKGRWMVQEMIGVIQL  66

Query  64  SQYAALHPSAASWTVEVGRDAL  85
            +Y  L+   A +T E  RD L
Sbjct  67  KKYRTLN---ARYTSEDLRDIL  85

>PYU1_G009218
Length=86

 Score = 34.3 bits (77),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 1/56 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKALSDAQQVREKIMA  55
           MA + +V+RLY+ +L+ A ++ S   R    R +K +FH+NK L+     +E  +A
Sbjct  1   MASKQQVLRLYKEMLRNASKFESYNYRKYAERRVKEDFHKNKQLAAGSAEQESALA  56

>PHYKE_8392
Length=138

 Score = 35.0 bits (79),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (59%), Gaps = 0/58 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           E+  LY+++L++AQ  P  KR   +  I+ EF  +  LSD ++V + +  A++ +  L
Sbjct  7   ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYL  64

>PHYSO_321155
Length=136

 Score = 34.7 bits (78),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 33/58 (57%), Gaps = 0/58 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           E+  LY+++L+LAQ  P  KR+  +  I+ EF  +  L+D + V   I  A++ +  L
Sbjct  7   ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64

>CCA17542
Length=120

 Score = 34.3 bits (77),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 36/51 (71%), Gaps = 0/51 (0%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           +Y+R+++LA+  P+ K+ + + +I+TEF +++ +SD  Q+ + +  A++ I
Sbjct  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57

>PYU1_G001736
Length=123

 Score = 34.3 bits (77),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           +Y+++LKLAQ  P+ KR + V  I+ EF  +    D +++   +  A++ I  L
Sbjct  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYL  62

>PITG_18455
Length=132

 Score = 33.5 bits (75),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (57%), Gaps = 0/58 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           E+  LY+++L+LAQ  P  KR S +  I+ +F  +   +D ++V   I  A++ +  L
Sbjct  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

>HYAP_07103
Length=164

 Score = 33.5 bits (75),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           LY+++L+LAQ  P  KR   +  I+ EF  +  L+D ++V   +  A++ I  L
Sbjct  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57

>PYIR_16880
Length=96

 Score = 32.0 bits (71),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 0/48 (0%)

Query  24  VKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQYAALHP  71
           V++  I R+ +T F EN+ L DA+++RE + AA   +     Y   +P
Sbjct  5   VEQQWIKREARTRFEENRKLRDARKIRELVQAAHDQVDVALHYQIPYP  52

>PYAP_20847
Length=86

 Score = 32.0 bits (71),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 37/64 (58%), Gaps = 4/64 (6%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKAL---SDAQQVREKIMAA  56
           MA +  V+RLY+ +L+ A  + S   R   VR ++T+F +NKAL   S  QQ   ++   
Sbjct  1   MATKQAVLRLYKDMLRDAVTFESYNYRSYAVRRVRTDFRKNKALVVGSAEQQKALEVAME  60

Query  57  RAGI  60
           +AG+
Sbjct  61  QAGV  64

>PYIW_18388
Length=114

 Score = 32.0 bits (71),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 10/82 (12%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQE------L  63
           LYRR L + + YP +    +    KT F +NK L+D  +++  +   R  +QE      L
Sbjct  8   LYRRFLHVGKDYP-LGLAYVREKAKTAFFKNKNLTDPVEIKRAVKKGRWMVQEMIGVIQL  66

Query  64  SQYAALHPSAASWTVEVGRDAL  85
            +Y  ++   + +T E  RD L
Sbjct  67  KKYRTIN---SRYTSEELRDIL  85

>PYIR_13291
Length=106

 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 10/82 (12%)

Query  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQE------L  63
           LY+R L + + YP +    +   +K  F +NK L+D  +++  I   R  +QE      L
Sbjct  4   LYKRFLYVGRDYP-LGLAYVREKVKIAFFKNKDLTDQTEIKRAIKKGRWMVQEMIGVIQL  62

Query  64  SQYAALHPSAASWTVEVGRDAL  85
            +Y  L+   + +T E  RD L
Sbjct  63  KKYRTLN---SRYTSEELRDIL  81

>SDRG_05420
Length=118

 Score = 31.6 bits (70),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (48%), Gaps = 1/94 (1%)

Query  2   ADRLEVVRLYRRILKLAQRYPSVKRDSIVRD-IKTEFHENKALSDAQQVREKIMAARAGI  60
           A R EVV++YR  L+ A R P     + +R  ++ +F +   + DA+ +   +  A+  +
Sbjct  3   ALRREVVQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLADAKEEL  62

Query  61  QELSQYAALHPSAASWTVEVGRDALPTAAPPKGN  94
           + ++ Y +++ S  +     G  A   +  P  N
Sbjct  63  ERMNYYHSMYQSGQTQKATHGETAQLASHCPNCN  96

>CCA20102
Length=114

 Score = 31.6 bits (70),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (54%), Gaps = 3/67 (4%)

Query  3   DRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQE  62
           +R   ++ +R   ++    P+  R  I R I+TEF + + + D +QV+  +   R G+++
Sbjct  13  NRAAALKQFRDFQRVTAALPTSTRSDIRRQIRTEFEKCRFVEDDEQVQSLL---RYGMEQ  69

Query  63  LSQYAAL  69
           L   ++L
Sbjct  70  LKHVSSL  76

>PITG_01992
Length=88

 Score = 31.2 bits (69),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 28/55 (51%), Gaps = 1/55 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKALSDAQQVREKIM  54
           M     V+RLYR +L+ A  + +   R    R +K EFH+NK L      +EK +
Sbjct  1   MVSSSSVLRLYREMLRNAANFENYNFRAYATRRVKEEFHKNKVLKVGSPEQEKAL  55

>PYAP_17747
Length=134

 Score = 31.2 bits (69),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 33/55 (60%), Gaps = 1/55 (2%)

Query  10  LYRRILKLAQRYPSV-KRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           LY+R+L+LA+  P   KR++ ++ I++EF   K   D ++V   +  A+A I  L
Sbjct  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63

>CCI48720
Length=114

 Score = 30.8 bits (68),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
             +R   +R YR   ++  + P+  R  I R I+ EF   + + + +Q++   +  R G 
Sbjct  11  FINRAAALRQYREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQ---LLLRYGK  67

Query  61  QELSQYAALHPSAAS  75
           ++L   ++L  +A S
Sbjct  68  EQLKYVSSLVDTAVS  82

>PHYSO_288983
Length=88

 Score = 30.4 bits (67),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 29/55 (53%), Gaps = 1/55 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKALSDAQQVREKIM  54
           MA    V+RLYR +L+ A ++ +   R    R +K +F +NK L      +EK +
Sbjct  1   MASSSSVLRLYREMLRNAAKFETYNFRSYATRRVKEDFRKNKTLQAGSPEQEKAL  55

>PPTG_19588
Length=88

 Score = 30.4 bits (67),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 1/55 (2%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKALSDAQQVREKIM  54
           MA    V+RLYR +L+ A ++ +   R    R ++ +F +NKAL      +EK +
Sbjct  1   MASSSSVLRLYREMLRNAAKFETYNFRAYATRRVREDFRKNKALKTGSSEQEKAL  55

>H257_06293
Length=123

 Score = 30.4 bits (67),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%), Gaps = 0/53 (0%)

Query  11  YRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           Y++++KLAQ  P+ ++ + +  I+ +F     +S A+++ + +M A++ I  L
Sbjct  9   YKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYL  61

>PYU1_G002507
Length=433

 Score = 30.8 bits (68),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  44   SDAQQVREKIMAARAGIQELSQYAALHPSAASWTV  78
            S A+ VRE     R G Q L +Y  LH +++SWT 
Sbjct  159  SAAKLVREYFAIFRNGFQVLPRYRDLHGNSSSWTT  193

>PYVX_22540
Length=101

 Score = 29.6 bits (65),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 29/59 (49%), Gaps = 15/59 (25%)

Query  1   MADRLEVVRLYRRILKLAQRYPSVK---------------RDSIVRDIKTEFHENKALS  44
           M+    V+RLYR +L+ A ++   +               R   VR +K +FH+NKAL+
Sbjct  1   MSSSQNVLRLYREMLRNASKFEPYRELTTCFTRCKQSYNFRSYAVRRVKEDFHKNKALA  59

>H310_09224
Length=123

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 13/53 (25%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  11  YRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63
           Y++++KLAQ  P+ ++   +  ++ EF  +  ++ + Q+ + +M A++ I  L
Sbjct  9   YKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYL  61

>PPTG_19462
Length=383

 Score = 30.0 bits (66),  Expect = 2.1, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  7    VVRLYRRILKLAQRYPSVKRDSIVRDIKTEF  37
            V R+ RRI +LA+R+P++K   +  D+KT F
Sbjct  246  VRRIARRIEELAERHPTLKIKLLKGDVKTAF  276

>PPTG_19469
Length=383

 Score = 30.0 bits (66),  Expect = 2.1, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  7    VVRLYRRILKLAQRYPSVKRDSIVRDIKTEF  37
            V R+ RRI +LA+R+P++K   +  D+KT F
Sbjct  246  VRRIARRIEELAERHPTLKIKLLKGDVKTAF  276

>PYVX_18921
Length=362

 Score = 29.3 bits (64),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 0/42 (0%)

Query  24  VKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQ  65
           +K DS++ D +TE  +  A   A QV  K +AA   + +LSQ
Sbjct  37  LKSDSLLNDARTEADDKDAPLGAGQVALKFLAAPINVADLSQ  78

>PPTG_14828
Length=110

 Score = 28.1 bits (61),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHE  39
           + V + RR+L+  +RYP     +++ DI   FH 
Sbjct  59  QFVSIARRVLEFRRRYPGYTIYAMIADIADAFHH  92

>CCI10364
Length=90

 Score = 28.1 bits (61),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 1/44 (2%)

Query  6   EVVRLYRRILKLAQRYPSVK-RDSIVRDIKTEFHENKALSDAQQ  48
           +V+RLYR +L+ A  +     R    R +K EF +NK LS  +Q
Sbjct  6   QVLRLYRAMLRDAASFQEYNFRAYAKRRVKEEFRKNKTLSAEEQ  49

>H310_06072
Length=121

 Score = 28.1 bits (61),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 49/104 (47%), Gaps = 2/104 (2%)

Query  1    MAD-RLEVVRLYRRILKLAQRYPS-VKRDSIVRDIKTEFHENKALSDAQQVREKIMAARA  58
            M+D R +V+++Y+  L  A + P  + R+++   ++ +F E   + D Q +   +  A+ 
Sbjct  1    MSDLRRQVLQVYKACLVSAAKCPQHIHRETMRAYVRLKFREKMHVRDTQALNILLQDAKE  60

Query  59   GIQELSQYAALHPSAASWTVEVGRDALPTAAPPKGNGIKTVGGK  102
             ++ +  Y +++ +  +    V   + P  AP   N   T   +
Sbjct  61   ELERMDYYHSMYRAGQANKATVFNRSAPVLAPTCPNCNHTFESQ  104

>SPRG_14153
Length=412

 Score = 28.9 bits (63),  Expect = 6.4, Method: Composition-based stats.
 Identities = 22/80 (28%), Positives = 30/80 (38%), Gaps = 17/80 (21%)

Query  14   ILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQYAALHPSA  73
            +L++  + P V  D+   D KT   E  A  D + VR                 ALH + 
Sbjct  121  VLEVLLKAPGVDLDATSSDGKTALAEAIACGDMRAVR-----------------ALHSAL  163

Query  74   ASWTVEVGRDALPTAAPPKG  93
                  V RD +PT   P G
Sbjct  164  TVSVGTVARDEMPTPGEPIG  183

>CCI48351
Length=800

 Score = 28.5 bits (62),  Expect = 7.3, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 22/40 (55%), Gaps = 5/40 (13%)

Query  56   ARAGIQELSQYAALHPSAAS-----WTVEVGRDALPTAAP  90
            ARAGIQ L  Y ++ PS +      W +E  +++  T AP
Sbjct  674  ARAGIQHLITYMSILPSNSPKAHILWPLEKQQESFDTLAP  713

>SPRG_13016
Length=316

 Score = 28.5 bits (62),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query  12   RRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQ  47
            RRIL      P+    S+V+D+K++  EN AL  AQ
Sbjct  270  RRILS---TLPNSAESSLVKDLKSKLEENAALLQAQ  302

>HYAP_08762
Length=112

 Score = 27.7 bits (60),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query  11  YRRILKLAQRYPSVKRDSI-VRDIKTEFHENKAL-SDAQQVREKIMAAR  57
           YR +L+ A ++ +    +  +R IK EFH NK + +D+ + ++ + AAR
Sbjct  36  YREMLRSAAKFENYNFSNYALRRIKEEFHTNKTMKADSTEQKQALEAAR  84

>CCI44820
Length=123

 Score = 27.7 bits (60),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 34/55 (62%), Gaps = 0/55 (0%)

Query  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60
           E  R++++++KLA+  P  K+   + +I+ EF +++ + D  Q+ + +  A++ I
Sbjct  6   ETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60

>CCI40582
Length=5030

 Score = 28.5 bits (62),  Expect = 9.3, Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 0/44 (0%)

Query  39    ENKALSDAQQVREKIMAARAGIQELSQYAALHPSAASWTVEVGR  82
             EN A + A ++RE    AR        ++ +HPS AS + +V R
Sbjct  1454  ENYARARAIELRESEKIARPATTPGGSHSIVHPSTASSSTDVSR  1497

>PHYKE_2868
Length=222

 Score = 28.1 bits (61),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  22   PSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQELSQYAALHPSAASWTVEVG  81
            PSV    IV+ I+T F EN  LSD +    K+  A   + ELS+   L    +S TV  G
Sbjct  78   PSV---DIVQSIRTAFRENVNLSDPKIANLKLDDAIVVLNELSEQLLLA-KCSSVTVTDG  133

>PPTG_15919
Length=105

 Score = 27.7 bits (60),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 37/73 (51%), Gaps = 15/73 (21%)

Query  1   MADRLEVVRLYRRILKLAQR----YPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAA  56
           MADR +V+ LY+RIL L ++    +  V  D  VRD   EF  +K  S A +     M  
Sbjct  1   MADRAKVLALYKRILTLHRQKLEPHMRVLGDQYVRD---EFKRHK--SAASKFVPPFM--  53

Query  57  RAGIQELSQYAAL  69
               QE  QYAA+
Sbjct  54  ----QEWEQYAAV  62

Lambda      K        H        a         alpha
   0.316    0.130    0.363    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3358154610

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40