Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G005964111481761769405e-131
PYIW_14755111481691766974e-94
PYIR_15183111481871936855e-92
PYAP_22844111481781895952e-78
PHYCA_118037111481651755838e-77
PHYSO_300767111481661755785e-76
PHYSO_300766485331661755785e-76
PITG_13740111481661745681e-74
PPTG_09253111481661755654e-74
PHALS_11565111481621705047e-65
SDRG_04481111481861734452e-55
H310_10665111481651744205e-52
SPRG_13308111481871734218e-52
PYAR_26061111481141203904e-48
H257_07013111481661743805e-46
PHYRA_96081111481561173502e-41
SPRG_11879128323125993072e-35
PYVX_2085911148225932786e-30
H257_06740141032476777731.2
PYIW_1982811497120072712.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G005964

Length=176
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYU1_G005964                                                          366     5e-131
PYIW_14755                                                            273     4e-94 
PYIR_15183                                                            268     5e-92 
PYAP_22844                                                            233     2e-78 
PHYCA_118037                                                          229     8e-77 
PHYSO_300767                                                          227     5e-76 
PHYSO_300766                                                          227     5e-76 
PITG_13740                                                            223     1e-74 
PPTG_09253                                                            222     4e-74 
PHALS_11565                                                           198     7e-65 
SDRG_04481                                                            176     2e-55 
H310_10665                                                            166     5e-52 
SPRG_13308                                                            166     8e-52 
PYAR_26061                                                            154     4e-48 
H257_07013                                                            150     5e-46 
PHYRA_96081                                                           139     2e-41 
SPRG_11879                                                            122     2e-35 
PYVX_20859                                                            111     6e-30 
H257_06740                                                            32.7    1.2   
PYIW_19828                                                            32.0    2.2   

>PYU1_G005964
Length=176

 Score = 366 bits (940),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 176/176 (100%), Positives = 176/176 (100%), Gaps = 0/176 (0%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN
Sbjct  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP
Sbjct  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRKQ  176
            ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRKQ
Sbjct  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRKQ  176

>PYIW_14755
Length=169

 Score = 273 bits (697),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 152/176 (86%), Gaps = 15/176 (9%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MVHVK+RVFTFPS+PR+QNSYVVGT+EGGLLPTVGTLKL++ E  ++TFAQLRPRIELQN
Sbjct  1    MVHVKVRVFTFPSSPRKQNSYVVGTWEGGLLPTVGTLKLDDSE--SVTFAQLRPRIELQN  58

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            DNFMIR        R+LMFQEVL II+TSPNPH WPHSALQTYWFG+++D+EQ VPT+LP
Sbjct  59   DNFMIR--------RALMFQEVLAIIATSPNPHRWPHSALQTYWFGFYEDLEQRVPTVLP  110

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRKQ  176
                 VA ED+P+S FLNM TSKQTGDLILIPQTQVGP+CEKCC+GCA CPP+ KQ
Sbjct  111  -----VAVEDSPVSAFLNMMTSKQTGDLILIPQTQVGPVCEKCCEGCALCPPICKQ  161

>PYIR_15183
Length=187

 Score = 268 bits (685),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 152/193 (79%), Gaps = 26/193 (13%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            M ++K+RVFTFPS+PREQNSYVVGT+EGGLLPTVGTLKL+  E   +TFAQLRPRIELQN
Sbjct  4    MAYLKVRVFTFPSSPREQNSYVVGTWEGGLLPTVGTLKLDNSE--CVTFAQLRPRIELQN  61

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            DNFMIR V        LMFQEVL II+TSPNPH WPHSALQTYWFG+F+D+EQ VPTM+ 
Sbjct  62   DNFMIRQV-------PLMFQEVLAIIATSPNPHQWPHSALQTYWFGFFEDLEQSVPTMIS  114

Query  121  ARET-----------------PVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKC  163
             R +                  V+DED+P+S FLNMTTSKQTGDLILIPQTQVGP+CEKC
Sbjct  115  VRPSCGCDCTNPSTIDIAQWLQVSDEDSPVSTFLNMTTSKQTGDLILIPQTQVGPVCEKC  174

Query  164  CQGCARCPPVRKQ  176
            C+GCA CPP+RK+
Sbjct  175  CKGCALCPPIRKK  187

>PYAP_22844
Length=178

 Score = 233 bits (595),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 135/189 (71%), Gaps = 27/189 (14%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV VK+RVFTFPSNPREQNSY+     GGLLPTVG LKLE DE  +ITF+QLRPRIEL++
Sbjct  1    MVRVKVRVFTFPSNPREQNSYI-----GGLLPTVGALKLENDELTSITFSQLRPRIELRD  55

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            D+ MIR        RS MFQEVL+IIS SPNPH WP SALQTYWFGYF D++Q VP  + 
Sbjct  56   DDGMIR--------RSPMFQEVLSIISASPNPHRWPASALQTYWFGYFTDMDQTVPHSIE  107

Query  121  ARETPV--------------ADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQG  166
               T +               +ED PIS +L+MTTSK TGDLILIPQTQ GP+CE CCQG
Sbjct  108  VCSTSIFAPLTKYLATDEYPNEEDAPISKYLDMTTSKLTGDLILIPQTQFGPVCEACCQG  167

Query  167  CARCPPVRK  175
            C RCPPV K
Sbjct  168  CERCPPVTK  176

>PHYCA_118037
Length=165

 Score = 229 bits (583),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 13/175 (7%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV VK+RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L+E E   +TFAQLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTVEGGLLPVVGTLNLDEKETDTVTFAQLRPRIELLQ  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
               +IR        RS+MFQEVL +I+ SPNPH WP +A+QTYWFG+F D  +  P ++ 
Sbjct  61   SKDVIR--------RSVMFQEVLALIAASPNPHGWPPNAMQTYWFGHFTDENESAPHVIT  112

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRK  175
            A     ADE+TPIS FLNMTTSKQTGDLIL+PQTQ+GP+CE+CC+GC+ CP +  
Sbjct  113  A-----ADENTPISQFLNMTTSKQTGDLILVPQTQLGPVCEQCCEGCSLCPSINS  162

>PHYSO_300767
Length=166

 Score = 227 bits (578),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 132/175 (75%), Gaps = 13/175 (7%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV VK+RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L++ E   +TFAQLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
               +IR        RS+MFQEVL +I+TS NPH WP +A+QTY FG+F D  + VP ++ 
Sbjct  61   TKDVIR--------RSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIA  112

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRK  175
            A     ADED PIS FLNMTTSKQTGDL+LIPQTQ+GP+CE+CC+GC  CPP+  
Sbjct  113  A-----ADEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIES  162

>PHYSO_300766
Length=166

 Score = 227 bits (578),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 132/175 (75%), Gaps = 13/175 (7%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV VK+RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L++ E   +TFAQLRPRIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVATVTFAQLRPRIELLQ  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
               +IR        RS+MFQEVL +I+TS NPH WP +A+QTY FG+F D  + VP ++ 
Sbjct  61   TKDVIR--------RSVMFQEVLALIATSANPHGWPPNAMQTYCFGHFADENEDVPHVIA  112

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRK  175
            A     ADED PIS FLNMTTSKQTGDL+LIPQTQ+GP+CE+CC+GC  CPP+  
Sbjct  113  A-----ADEDCPISQFLNMTTSKQTGDLVLIPQTQLGPVCERCCEGCELCPPIES  162

>PITG_13740
Length=166

 Score = 223 bits (568),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 13/174 (7%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV VK+RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L++ E   +TF QLR RIEL  
Sbjct  1    MVRVKVRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEAATVTFTQLRVRIELVQ  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
             N +IR        RS+MFQEVL +++TS NPH WP +A+QTYWFG+F D  + VP ++ 
Sbjct  61   INDVIR--------RSIMFQEVLALVATSSNPHKWPPNAMQTYWFGHFKDESESVPHVIA  112

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVR  174
            A     ADED PIS +LNMTTSK  GDLILIPQTQ+GP+CE+CC+GC  CPP++
Sbjct  113  A-----ADEDCPISQYLNMTTSKLMGDLILIPQTQLGPVCEQCCEGCTLCPPIQ  161

>PPTG_09253
Length=166

 Score = 222 bits (565),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 132/175 (75%), Gaps = 13/175 (7%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV VK+RVFTFP +PR+QNSYVVGT EGGLLP VGTL L++ E   +TF QLR RIEL  
Sbjct  1    MVRVKVRVFTFPPDPRKQNSYVVGTIEGGLLPVVGTLNLDDKEVSTVTFTQLRVRIELLQ  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
               +IR        RS+MFQEVL +I+TSPNPHNWP +A+QTYWFG+F D  + +P ++ 
Sbjct  61   VKDVIR--------RSVMFQEVLALIATSPNPHNWPPNAMQTYWFGHFIDESETIPHVIA  112

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVRK  175
            A     +DED PI+ FLNM TSKQTGDLIL+PQTQ+GP+CE+CC+GC  CPP++ 
Sbjct  113  A-----SDEDCPINQFLNMITSKQTGDLILVPQTQLGPVCEQCCEGCTLCPPIQS  162

>PHALS_11565
Length=162

 Score = 198 bits (504),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 117/170 (69%), Gaps = 13/170 (8%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            M+HVK+RVFTFPS+P++QNSYVVG+ EGG LP VGT+ +++ E   ITF QLR RIEL  
Sbjct  1    MIHVKVRVFTFPSDPQKQNSYVVGSIEGGHLPVVGTILIDDKEATTITFTQLRQRIELLQ  60

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
                    V  E+ RS MFQEVL  I+TSPN H+WP   +QTYWFGYF D    VP ++ 
Sbjct  61   --------VKDEIRRSAMFQEVLAFIATSPNSHSWPQKFMQTYWFGYFADEGACVPHIIT  112

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARC  170
            A     ADE  P+S F NM TSKQ  DLIL+PQTQ+GP+C +CCQ C  C
Sbjct  113  A-----ADEIRPVSQFTNMATSKQICDLILVPQTQIGPVCHQCCQSCKVC  157

>SDRG_04481
Length=186

 Score = 176 bits (445),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 114/173 (66%), Gaps = 15/173 (9%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            +V +K+RVF FP +P  ++SYVVG+  GGL   +G + +E+DE   +TF  +RPRIELQ 
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVVEDDE--DLTFQSVRPRIELQQ  59

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            D  ++R        R +M+QE L ++++  NPH WP  ALQTYW GY+   + LVPT++P
Sbjct  60   DGSVLR--------RHIMYQEALFLMTSGANPHQWPVKALQTYWLGYYAHEDDLVPTIIP  111

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPV  173
                  ADE      FL+M T+K T DLILIPQ+Q+GP+C  CCQGCA CPP+
Sbjct  112  T-----ADEHQSFREFLDMKTTKLTADLILIPQSQIGPVCNACCQGCAACPPI  159

>H310_10665
Length=165

 Score = 166 bits (420),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 115/174 (66%), Gaps = 15/174 (9%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            MV +K+RVFTF  +P  ++SY+VG+  GGL   +G + L++D+   +TFA +RPRIEL+ 
Sbjct  1    MVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLDDDD--DLTFASVRPRIELKE  58

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            +N +IR        R+LMFQE L  ++ + NPH WP   LQTYW GY+ + + + PT++P
Sbjct  59   ENGLIR--------RNLMFQEALFQMTEARNPHQWPTHTLQTYWLGYYKNEDDMTPTIIP  110

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVR  174
                   DE   + + L+M ++K T DLI++PQ+Q+GP+C  CCQGCA CP ++
Sbjct  111  TE-----DEARSLRDVLDMKSTKVTADLIIVPQSQIGPVCAMCCQGCALCPAIQ  159

>SPRG_13308
Length=187

 Score = 166 bits (421),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 113/173 (65%), Gaps = 15/173 (9%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            +V +K+RVF FP +P  ++SYVVG+  GGL   +G + +++     +TF  +RPRIELQ 
Sbjct  2    VVRIKVRVFLFPVDPLVEHSYVVGSRPGGLSSVIGMVVMDD--DDDLTFESVRPRIELQQ  59

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            D  + R        R +M+QE L ++++S NPH WP  ALQTYW GY+   + LVPT++P
Sbjct  60   DGSVQR--------RHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIP  111

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPV  173
                  ADE  P+   L+M T+K T DLILIPQ+Q+GP+C  CCQGCA CPP+
Sbjct  112  -----TADEQKPLRAVLDMKTTKLTADLILIPQSQIGPVCTACCQGCAVCPPI  159

>PYAR_26061
Length=114

 Score = 154 bits (390),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 8/120 (7%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            ++ VK+RVFTFPS+PR QNSYVVGT EGGLLPTVGTL L++ E   +TFAQLRPR+EL++
Sbjct  2    VLRVKVRVFTFPSDPRLQNSYVVGTMEGGLLPTVGTLSLDDSEKDTVTFAQLRPRLELRD  61

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            D+ MIR        RS +FQEVL I S S NPH WP SALQTYWFG+F D  + VP  +P
Sbjct  62   DDGMIR--------RSALFQEVLAIASASRNPHGWPVSALQTYWFGFFQDPSETVPHAIP  113

>H257_07013
Length=166

 Score = 150 bits (380),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 14/174 (8%)

Query  1    MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
            +V +K+RVFTF  +P  ++SY+VG+  GGL   +G + LE+DE   +TF  +RPRIEL+ 
Sbjct  2    VVRIKVRVFTFSIDPTVEHSYLVGSAAGGLSSAIGMIVLEDDE--DLTFESVRPRIELKE  59

Query  61   DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLP  120
            +N +IR        R+ MFQE L  ++ + NPH WP   LQTYW GY+   +   PT++ 
Sbjct  60   ENGLIR--------RNPMFQEALFQMTEARNPHQWPMHTLQTYWLGYYQHEDDPTPTIIR  111

Query  121  ARETPVADEDTPISNFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPVR  174
              +T        + + L+M ++K T DLI+IPQ+Q+GP+C +CCQ CA CP ++
Sbjct  112  TEDT----SSKCLRDVLDMKSTKVTADLIVIPQSQIGPVCSQCCQRCALCPSIQ  161

>PHYRA_96081
Length=156

 Score = 139 bits (350),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 8/117 (7%)

Query  6    IRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQNDNFMI  65
            +RVFTFPS+PR+QNSYVVGT EGGLLP VGTL L + E   +TF QLR RIEL  D  +I
Sbjct  47   VRVFTFPSDPRKQNSYVVGTIEGGLLPVVGTLNLHDKEVATVTFEQLRLRIELLQDKDVI  106

Query  66   RSVVALEVLRSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLPAR  122
            R        RS+MFQEVL +I+ S NPH WP +A+QTYWFG++ D    +P ++  R
Sbjct  107  R--------RSVMFQEVLALIAASSNPHGWPPNAMQTYWFGHYTDENDSIPRVIAVR  155

>SPRG_11879
Length=125

 Score = 122 bits (307),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 5/99 (5%)

Query  75   RSLMFQEVLTIISTSPNPHNWPHSALQTYWFGYFDDVEQLVPTMLPARETPVADEDTPIS  134
            R +M+QE L ++++S NPH WP  ALQTYW GY+   + LVPT++P      ADE  P+ 
Sbjct  4    RHIMYQEALFLMTSSANPHQWPVKALQTYWLGYYAHEDDLVPTVIP-----TADEQKPLR  58

Query  135  NFLNMTTSKQTGDLILIPQTQVGPMCEKCCQGCARCPPV  173
              L+M ++K T DLILIPQ+Q+GP+C  CCQGCA CPP+
Sbjct  59   AVLDMKSTKLTADLILIPQSQIGPVCNACCQGCAECPPI  97

>PYVX_20859
Length=225

 Score = 111 bits (278),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 4/93 (4%)

Query  1   MVHVKIRVFTFPSNPREQNSYVVGTFEGGLLPTVGTLKLEEDEFVAITFAQLRPRIELQN  60
           MV VK+RVFTFPS+PREQNSY+VGT EGGLLP VGTL +E+ E   I+F+QLRPRIEL+N
Sbjct  1   MVRVKVRVFTFPSDPREQNSYLVGTSEGGLLPVVGTLNVEDAEQDTISFSQLRPRIELKN  60

Query  61  DNFMIRSVVALEVLRSLMFQEVLTIISTSPNPH  93
           DN M+R V +  +  SL+   +L    T+P PH
Sbjct  61  DNNMVRCVRSAALPVSLIMMAIL----TAPQPH  89

>H257_06740
Length=4767

 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 32/77 (42%), Gaps = 11/77 (14%)

Query  56   IELQNDNFMIRSVVAL-----------EVLRSLMFQEVLTIISTSPNPHNWPHSALQTYW  104
            +EL  D+     VVA            ++LR  M + V    +TSP P  WPH  + T  
Sbjct  421  LELGGDSMSAVQVVAACKVLGLNLTVAQLLRDPMLRNVARKANTSPEPVAWPHVTVSTEV  480

Query  105  FGYFDDVEQLVPTMLPA  121
             G  D       T+LPA
Sbjct  481  LGSIDVNRTQHATVLPA  497

>PYIW_19828
Length=1200

 Score = 32.0 bits (71),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query  36   TLKLEEDEFVAITFAQLRPRIELQNDNFMIRSVVALE---VLRSLMFQEVLTIISTSPNP  92
            T +L  +E+VA  FA LR   +    N + RSVV L+   V  +  + E++T IS     
Sbjct  722  TTQLLNEEYVAYEFALLRQDYQDLEPNDIWRSVVVLDHAIVDAATAWDELVTSISAY---  778

Query  93   HNWPHSALQTYW  104
             +W  ++   YW
Sbjct  779  DSWNSASNSMYW  790

Lambda      K        H        a         alpha
   0.322    0.137    0.421    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6872252244

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40