Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G00596311147103834352e-56
PYIR_1518611147109833806e-48
PYIW_1474311147105833675e-46
PYAR_2320711147112802825e-33
PYAP_2284611147104832748e-32
PHYRA_8167511147106832694e-31
PHYKE_584111147121832696e-31
PYVX_2085411147104832679e-31
PHYCA_53538011147108832626e-30
PPTG_0925211147105832618e-30
PITG_1373911147105832582e-29
PHYSO_31501711147109832565e-29
PHALS_1156411147107832425e-27
HYAP_0849911147108832304e-25
HYAP_0850065260172832303e-24
CCI4423211147105802243e-24
CCA1752111147104802235e-24
H257_073581114798832156e-23
H310_075671114798832042e-21
SPRG_1288311147105802026e-21
SDRG_1491211147105802026e-21
SDRG_05420125012118781028e-06
SPRG_0586412501211878992e-05
SPRG_171331561311878966e-05
PYVX_181801475513577951e-04
PHYSO_3211551475513660942e-04
PPTG_171261475513675932e-04
PHYRA_959031475513457933e-04
PHYCA_118341475513457906e-04
PHALS_064791475513660860.002
PITG_184551475513258820.009
PHYKE_83921475513860790.026
PYIW_199701475513054780.027
CCA175421475512051770.036
PYIR_13291593710667760.048
HYAP_071031475516451770.058
CCI448201475512345740.12
PYU1_G0017361475512354720.19
PYIW_18388593711467710.23
PHYRA_825765279814455710.28
PPTG_09915527989655700.29
CCA224011561310944700.31
PHALS_05873527989659690.33
PHYSO_341187527989255690.36
H310_0091894928447680.43
PHYSO_424746198480749710.43
H257_11294783515873700.54
PITG_022641984137240700.65
PPTG_20656198481040700.70
PHYRA_75980198481440690.90
PPTG_02294911026664681.0
H310_0178114421545835681.1
H257_0403012501212175671.2
PYAP_2084717518649651.4
H310_05414783515873652.1
PHYKE_761317518742632.2
PYU1_G013186793911458642.3
PYAP_138941561312466642.7
H257_1621194928538623.9
PPTG_194622470938334634.7
PPTG_194692471338334634.7
PPTG_0773933351141636.3
PHYSO_3803525415012237616.4
SDRG_088921274488247607.2
PHYKE_8253108938834627.5
HYAP_04441911026036619.0
PYAR_141481561313963609.2
PITG_11064911026536619.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G005963

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYU1_G005963                                                          172     2e-56
PYIR_15186                                                            150     6e-48
PYIW_14743                                                            145     5e-46
PYAR_23207                                                            113     5e-33
PYAP_22846                                                            110     8e-32
PHYRA_81675                                                           108     4e-31
PHYKE_5841                                                            108     6e-31
PYVX_20854                                                            107     9e-31
PHYCA_535380                                                          105     6e-30
PPTG_09252                                                            105     8e-30
PITG_13739                                                            103     2e-29
PHYSO_315017                                                          103     5e-29
PHALS_11564                                                           97.8    5e-27
HYAP_08499                                                            93.2    4e-25
HYAP_08500                                                            93.2    3e-24
CCI44232                                                              90.9    3e-24
CCA17521                                                              90.5    5e-24
H257_07358                                                            87.4    6e-23
H310_07567                                                            83.2    2e-21
SPRG_12883                                                            82.4    6e-21
SDRG_14912                                                            82.4    6e-21
SDRG_05420                                                            43.9    8e-06
SPRG_05864                                                            42.7    2e-05
SPRG_17133                                                            41.6    6e-05
PYVX_18180                                                            41.2    1e-04
PHYSO_321155                                                          40.8    2e-04
PPTG_17126                                                            40.4    2e-04
PHYRA_95903                                                           40.4    3e-04
PHYCA_11834                                                           39.3    6e-04
PHALS_06479                                                           37.7    0.002
PITG_18455                                                            36.2    0.009
PHYKE_8392                                                            35.0    0.026
PYIW_19970                                                            34.7    0.027
CCA17542                                                              34.3    0.036
PYIR_13291                                                            33.9    0.048
HYAP_07103                                                            34.3    0.058
CCI44820                                                              33.1    0.12 
PYU1_G001736                                                          32.3    0.19 
PYIW_18388                                                            32.0    0.23 
PHYRA_82576                                                           32.0    0.28 
PPTG_09915                                                            31.6    0.29 
CCA22401                                                              31.6    0.31 
PHALS_05873                                                           31.2    0.33 
PHYSO_341187                                                          31.2    0.36 
H310_00918                                                            30.8    0.43 
PHYSO_424746                                                          32.0    0.43 
H257_11294                                                            31.6    0.54 
PITG_02264                                                            31.6    0.65 
PPTG_20656                                                            31.6    0.70 
PHYRA_75980                                                           31.2    0.90 
PPTG_02294                                                            30.8    1.0  
H310_01781                                                            30.8    1.1  
H257_04030                                                            30.4    1.2  
PYAP_20847                                                            29.6    1.4  
H310_05414                                                            29.6    2.1  
PHYKE_7613                                                            28.9    2.2  
PYU1_G013186                                                          29.3    2.3  
PYAP_13894                                                            29.3    2.7  
H257_16211                                                            28.5    3.9  
PPTG_19462                                                            28.9    4.7  
PPTG_19469                                                            28.9    4.7  
PPTG_07739                                                            28.9    6.3  
PHYSO_380352                                                          28.1    6.4  
SDRG_08892                                                            27.7    7.2  
PHYKE_8253                                                            28.5    7.5  
HYAP_04441                                                            28.1    9.0  
PYAR_14148                                                            27.7    9.2  
PITG_11064                                                            28.1    9.8  

>PYU1_G005963
Length=103

 Score = 172 bits (435),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI
Sbjct  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
           VELSQYTNLNPSSMTWKVDVGRE
Sbjct  61  VELSQYTNLNPSSMTWKVDVGRE  83

>PYIR_15186
Length=109

 Score = 150 bits (380),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 76/83 (92%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M EAKEVVR+YRRILKLAAQYPSIKRNAIIR+IKLEF  NKHLTD + I  KVQSARQGI
Sbjct  1   MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
           VELSQYTNLNPSSMTWKVDVGRE
Sbjct  61  VELSQYTNLNPSSMTWKVDVGRE  83

>PYIW_14743
Length=105

 Score = 145 bits (367),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M EAKEVVR+YRRILKLAAQYPSIKR+AIIR+IK+EF +NK LTD++ I  KVQSARQGI
Sbjct  1   MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
           VELSQYTNLNPSSMTWKVDVGRE
Sbjct  61  VELSQYTNLNPSSMTWKVDVGRE  83

>PYAR_23207
Length=112

 Score = 113 bits (282),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           ++EVVR+YRR+L+LA QYPSIKR+A++ DIKLEF E KHLTDA+AI  K+ +A+ GI EL
Sbjct  7   SREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

Query  64  SQYTNLNPSSMTWKVDVGRE  83
           SQY +L   +M+W VDVGRE
Sbjct  67  SQYASLRSDAMSWTVDVGRE  86

>PYAP_22846
Length=104

 Score = 110 bits (274),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M + ++V+R+YR ILKLA QYPS+KR+AII+DIKLEF E KH TDA  I  K+ +A+ GI
Sbjct  1   MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y  LNPSS  W V VGRE
Sbjct  61  KELSMYATLNPSSTAWTVGVGRE  83

>PHYRA_81675
Length=106

 Score = 108 bits (269),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E KEVVR+YRRILKLA +YPSIKR +IIRDIK EF  NKHLTDA  I  ++ S R GI
Sbjct  1   MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y +L+PS   W V+VGR+
Sbjct  61  KELSMYASLHPSLPNWSVEVGRD  83

>PHYKE_5841
Length=121

 Score = 108 bits (269),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E KEV R+YRRILKLA +YPS+KR++IIRDIK EF  +K LTDA  I  ++ SAR GI
Sbjct  1   MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELSQY +L+PSS+ W ++VGR+
Sbjct  61  KELSQYASLHPSSVNWSIEVGRD  83

>PYVX_20854
Length=104

 Score = 107 bits (267),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M +  EVVR+YRRILKLA +YPS+KR++I+RDIK EF ENK L+DA  +  K+ +AR GI
Sbjct  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELSQY  L+PS+ +W V+VGR+
Sbjct  61  QELSQYAALHPSAASWTVEVGRD  83

>PHYCA_535380
Length=108

 Score = 105 bits (262),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E KEV+R+YRRILKLA +YPSIKR +IIRDIK EF  NK LTDA  I  ++ S R GI
Sbjct  1   MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y NL+PS   W V+VGR+
Sbjct  61  KELSMYANLHPSLPNWSVEVGRD  83

>PPTG_09252
Length=105

 Score = 105 bits (261),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E KEV+R+YRRILKLA +YPS+KR +IIRDIK EF  NK+LTDA  I  ++ S R GI
Sbjct  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y +L+PS   W V+VGR+
Sbjct  61  TELSMYASLHPSLPNWSVEVGRD  83

>PITG_13739
Length=105

 Score = 103 bits (258),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E +EV+R+YRRILKLA +YPSIKR +IIRDIK EF  NK LTDA  I  ++ S R GI
Sbjct  1   MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y +L+PS   W V+VGR+
Sbjct  61  TELSMYASLHPSLPNWSVEVGRD  83

>PHYSO_315017
Length=109

 Score = 103 bits (256),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E KEV+R+YRRILKLA +YPS+KR +IIRDIK EF  NK LTDA  I  ++ S R GI
Sbjct  1   MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y +L+PS   W V+VGR+
Sbjct  61  KELSMYASLHPSLPNWSVEVGRD  83

>PHALS_11564
Length=107

 Score = 97.8 bits (242),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M E K+V+R+YRR+LKLA  YPSIKR AIIRDIK EF  N  +TDA  I   + SA  GI
Sbjct  1   MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y +L+PS   W V+VGR+
Sbjct  61  KELSMYASLHPSQPNWSVEVGRD  83

>HYAP_08499
Length=108

 Score = 93.2 bits (230),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M EA EV+R+YRRILKLA +YPSIKR +II DIK EFR N++L+DA  +  ++   + GI
Sbjct  1   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            ELS Y +L+PS   W ++VG +
Sbjct  61  KELSMYASLHPSLPNWNIEVGHD  83

>HYAP_08500
Length=172

 Score = 93.2 bits (230),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)

Query  1    MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
            M EA EV+R+YRRILKLA +YPSIKR +II DIK EFR N++L+DA  +  ++   + GI
Sbjct  65   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  124

Query  61   VELSQYTNLNPSSMTWKVDVGRE  83
             ELS Y +L+PS   W ++VG +
Sbjct  125  KELSMYASLHPSLPNWNIEVGHD  147

>CCI44232
Length=105

 Score = 90.9 bits (224),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 0/80 (0%)

Query  3   EAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVE  62
           E  ++  +YRRIL+LA +YPSIKR+AI+ DI+LEFRE++++   +AI  K+ SA  GI E
Sbjct  2   ERAQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKE  61

Query  63  LSQYTNLNPSSMTWKVDVGR  82
           L  Y NLNP    W V++GR
Sbjct  62  LMMYANLNPVEANWTVEIGR  81

>CCA17521
Length=104

 Score = 90.5 bits (223),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)

Query  3   EAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVE  62
           E  ++  +YRRIL+LA +YPSIKR+AII DI++EFRE++ +T A+ I  K+ SA  GI E
Sbjct  2   ERTQIFGLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKE  61

Query  63  LSQYTNLNPSSMTWKVDVGR  82
           L  Y NLNP    W V++GR
Sbjct  62  LLMYANLNPVDPNWTVEIGR  81

>H257_07358
Length=98

 Score = 87.4 bits (215),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M+ +  V +IYRR+L+LA ++PSIK+  +++DIKLEF ENK LTD + I  K+  A +GI
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            +L+QY  L+P++ +W VD+ ++
Sbjct  61  QQLNQYVALDPNAQSWSVDMDKD  83

>H310_07567
Length=98

 Score = 83.2 bits (204),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M+ +  V +IYRR+L+LA ++PSIKR+ ++ DIK EF +NK LTD   I  KV  A +GI
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGI  60

Query  61  VELSQYTNLNPSSMTWKVDVGRE  83
            +L+QY +L+P++  W VD+ ++
Sbjct  61  QQLNQYVSLDPNAQHWSVDMEKD  83

>SPRG_12883
Length=105

 Score = 82.4 bits (202),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (73%), Gaps = 0/80 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
            + V +IYRR+LKLA ++PSIK++ ++ DIK EF EN  LTDA+ I  K+  A +GI +L
Sbjct  3   GRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

Query  64  SQYTNLNPSSMTWKVDVGRE  83
            QY +L+P++ +W V++ ++
Sbjct  63  GQYVHLDPTAHSWTVEMEKD  82

>SDRG_14912
Length=105

 Score = 82.4 bits (202),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (73%), Gaps = 0/80 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
            + V +IYRR+LKLA ++PSIK++ ++ DIK EF EN  LTDA+ I  K+  A +GI +L
Sbjct  3   GRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

Query  64  SQYTNLNPSSMTWKVDVGRE  83
            QY +L+P++ +W V++ ++
Sbjct  63  GQYVHLDPTAHSWTVEMEKD  82

>SDRG_05420
Length=118

 Score = 43.9 bits (102),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query  5   KEVVRIYRRILKLAAQYPSIKRNAIIRD-IKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           +EVV++YR  L+ AA+ P     A +R  ++++FR+  H+ DA AI   +  A++ +  +
Sbjct  6   REVVQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLADAKEELERM  65

Query  64  SQYTNLNPSSMTWKVDVG  81
           + Y ++  S  T K   G
Sbjct  66  NYYHSMYQSGQTQKATHG  83

>SPRG_05864
Length=118

 Score = 42.7 bits (99),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query  5   KEVVRIYRRILKLAAQYPSIKRNAIIRD-IKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           +EV+++YR  L+ AA+ P     A +R  ++++FR+  H+ DA AI   +  A++ +  +
Sbjct  6   REVLQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLSDAKEELERM  65

Query  64  SQYTNLNPSSMTWKVDVG  81
           + Y ++  S  T K   G
Sbjct  66  NYYHSMYKSGQTQKATHG  83

>SPRG_17133
Length=118

 Score = 41.6 bits (96),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query  5   KEVVRIYRRILKLAAQYPSIKRNAIIRD-IKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           +EV+++YR  L+ AA+ P     A +R  ++++FR+  H+ DA AI   +  A++ +  +
Sbjct  6   REVLQVYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLSDAKEELERM  65

Query  64  SQYTNLNPSSMTWKVDVG  81
           + Y ++  +  T K   G
Sbjct  66  NYYHSMYKTGQTQKATHG  83

>PYVX_18180
Length=135

 Score = 41.2 bits (95),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 40/77 (52%), Gaps = 0/77 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           M    E+  +Y+++L+LA   P  KR + +  I+ EFR +  +TDA+ +   +Q A+  +
Sbjct  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60

Query  61  VELSQYTNLNPSSMTWK  77
             L   T   PS+   K
Sbjct  61  GYLKIVTPRGPSASGVK  77

>PHYSO_321155
Length=136

 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           A+E+  +Y+++L+LA   P  KR   +  I+ EFR +  LTD   + A +Q A+  +  L
Sbjct  5   ARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64

>PPTG_17126
Length=136

 Score = 40.4 bits (93),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 1/75 (1%)

Query  1   MTEA-KEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQG  59
           M EA +E+  +Y+++L+LA   P  KR + I  I+ +FR +  LTD   + A +Q A+  
Sbjct  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  60  IVELSQYTNLNPSSM  74
           +  L   T    S+M
Sbjct  61  LSYLKIVTPRAESNM  75

>PHYRA_95903
Length=134

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (60%), Gaps = 0/57 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           A+E+  +Y+++L+LA   P  KR   +  I+ EFR ++ LTD   + A +Q A+  +
Sbjct  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59

>PHYCA_11834
Length=134

 Score = 39.3 bits (90),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           A+E+  +Y+++L+LA   P  KR   I  I+ EFR ++ LTD   +   +Q A+  +
Sbjct  3   ARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59

>PHALS_06479
Length=136

 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
            +E+  +Y+++L+LA   P  KR + I  I+ EFR ++ LTD   +   +Q A+  +  L
Sbjct  5   TRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYL  64

>PITG_18455
Length=132

 Score = 36.2 bits (82),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 0/58 (0%)

Query  6   EVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           E+  +Y+++L+LA   P  KR + I  I+ +FR +   TD   + A +Q A+  +  L
Sbjct  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

>PHYKE_8392
Length=138

 Score = 35.0 bits (79),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           A+E+  +Y+++L++A   P  KR+  +  I+ EFR +  L+D   +   +Q A+  +  L
Sbjct  5   ARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYL  64

>PYIW_19970
Length=130

 Score = 34.7 bits (78),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           +Y+++L+LA   P  KR    + I+ EFR  K L+D   ++A +  A+  I  L
Sbjct  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69

>CCA17542
Length=120

 Score = 34.3 bits (77),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           IY+R+++LA   P+ K+ A + +I+ EFR+++ ++D + +   ++ A+  I
Sbjct  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57

>PYIR_13291
Length=106

 Score = 33.9 bits (76),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (51%), Gaps = 7/67 (10%)

Query  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQ------GIVEL  63
           +Y+R L +   YP +    +   +K+ F +NK LTD + I   ++  R       G+++L
Sbjct  4   LYKRFLYVGRDYP-LGLAYVREKVKIAFFKNKDLTDQTEIKRAIKKGRWMVQEMIGVIQL  62

Query  64  SQYTNLN  70
            +Y  LN
Sbjct  63  KKYRTLN  69

>HYAP_07103
Length=164

 Score = 34.3 bits (77),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 0/51 (0%)

Query  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
           +Y+++L+LA   P  KR   +  I+ EFR +  LTD   + + +Q A+  I
Sbjct  4   LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54

>CCI44820
Length=123

 Score = 33.1 bits (74),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 0/45 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTD  45
           MT   E  RI+++++KLA   P  K+   + +I+ EFR+++ + D
Sbjct  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRD  45

>PYU1_G001736
Length=123

 Score = 32.3 bits (72),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 0/54 (0%)

Query  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           +Y+++LKLA   P+ KR   +  I+ EFR +    D   I A +  A+  I  L
Sbjct  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYL  62

>PYIW_18388
Length=114

 Score = 32.0 bits (71),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 32/67 (48%), Gaps = 7/67 (10%)

Query  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQ------GIVEL  63
           +YRR L +   YP +    +    K  F +NK+LTD   I   V+  R       G+++L
Sbjct  8   LYRRFLHVGKDYP-LGLAYVREKAKTAFFKNKNLTDPVEIKRAVKKGRWMVQEMIGVIQL  66

Query  64  SQYTNLN  70
            +Y  +N
Sbjct  67  KKYRTIN  73

>PHYRA_82576
Length=144

 Score = 32.0 bits (71),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 29/55 (53%), Gaps = 6/55 (11%)

Query  5    KEVVRIYRRILKLAAQYPSIKRNA------IIRDIKLEFRENKHLTDASAIHAKV  53
            KEV+R+YR IL+    +P +          + ++ ++E  +N++ TD   I  ++
Sbjct  60   KEVLRLYREILRTTRMFPHLNEQGQPWSTVLHKNARMEIEQNRYETDGETISKRI  114

>PPTG_09915
Length=96

 Score = 31.6 bits (70),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 30/55 (55%), Gaps = 6/55 (11%)

Query  5   KEVVRIYRRILKLAAQYP------SIKRNAIIRDIKLEFRENKHLTDASAIHAKV  53
           KEV+R+YR IL+    +P       +  + + ++ ++E  +N++ TD   I  ++
Sbjct  8   KEVLRLYREILRTTRMFPHRNEQGQLWSDVLHKNARMEIEQNRYETDGETISKRI  62

>CCA22401
Length=109

 Score = 31.6 bits (70),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query  7   VVRIYRRILKLAAQYPSIKRNAIIRD-IKLEFRENKHLTDASAI  49
           V+R+YR  L+ A + P  +   +++  IKL+FRE + L D  AI
Sbjct  5   VLRLYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDPRAI  48

>PHALS_05873
Length=96

 Score = 31.2 bits (69),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 14/59 (24%), Positives = 31/59 (53%), Gaps = 6/59 (10%)

Query  1   MTEAKEVVRIYRRILKLAAQYP------SIKRNAIIRDIKLEFRENKHLTDASAIHAKV  53
           + + KEV+R+YR I++    +P       I  + + ++ ++E  +N+H  D   I  ++
Sbjct  4   LNKRKEVLRLYRNIIRTTRMFPHRNEQGQIWSDVLQKNARMEIEQNRHEKDGETISKRI  62

>PHYSO_341187
Length=92

 Score = 31.2 bits (69),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 30/55 (55%), Gaps = 6/55 (11%)

Query  5   KEVVRIYRRILKLAAQYP------SIKRNAIIRDIKLEFRENKHLTDASAIHAKV  53
           KEV+R+YR IL+    +P       +  + + ++ ++E  +N++ TD   I  ++
Sbjct  7   KEVLRLYREILRTTRMFPHRNEQGQLWSDVLQKNARMEIEQNRYETDGETISKRI  61

>H310_00918
Length=84

 Score = 30.8 bits (68),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIK-RNAIIRDIKLEFRENKHLTDA  46
           M    EV+R+Y+ +L  AAQ+ +   R   +R IK +FR N  L D+
Sbjct  1   MARRSEVLRLYKDLLLEAAQFQNYTFRTYSLRRIKADFRANASLRDS  47

>PHYSO_424746
Length=807

 Score = 32.0 bits (71),  Expect = 0.43, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 26/49 (53%), Gaps = 0/49 (0%)

Query  20   QYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVELSQYTN  68
            +Y S  R+   R+I L  REN+HL D  A+ A +   R+G    S  T+
Sbjct  285  RYKSALRDEARREIDLFMRENRHLFDNGAVEAFLVPKRKGKCARSTRTS  333

>H257_11294
Length=158

 Score = 31.6 bits (70),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 6/73 (8%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKR--NAIIRDIKLEFRENKHLTDASAIHAKVQSARQ  58
           ++  ++V R+Y+R LKL   +   +R  N     I+ +F E+KH TD   I A  +  R+
Sbjct  23  LSHKQQVTRLYKRSLKLLDSWIIDRRLWNEEATKIRGQFNEHKH-TD---IGAAQRLLRE  78

Query  59  GIVELSQYTNLNP  71
              EL +YT+ +P
Sbjct  79  ATAELEKYTHPDP  91

>PITG_02264
Length=1372

 Score = 31.6 bits (70),  Expect = 0.65, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  20   QYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQG  59
            +Y S  R+   R++ L  REN+HL D  A+ A +   R+G
Sbjct  860  RYKSALRDEARREVDLFMRENRHLFDNGAVEAFLVPKRKG  899

>PPTG_20656
Length=810

 Score = 31.6 bits (70),  Expect = 0.70, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  20   QYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQG  59
            +Y S  R+   R++ L  REN+HL D  A+ A +   R+G
Sbjct  286  RYKSALRDEARREVDLFMRENRHLFDNGAVEAFLVPKRKG  325

>PHYRA_75980
Length=814

 Score = 31.2 bits (69),  Expect = 0.90, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  20   QYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQG  59
            +Y S  R+   R++ L  REN+HL D  A+ A +   R+G
Sbjct  285  RYKSALRDEARREVDLFMRENRHLFDNGAVEAFLVPKRRG  324

>PPTG_02294
Length=266

 Score = 30.8 bits (68),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (8%)

Query  1    MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
            +T   E  R+     ++ +  PS+    I++ I++ FR+N  ++D  A  AK+  A + +
Sbjct  63   LTSLDEFRRLRDNAFRMGS--PSVD---IVQSIRVAFRQNMQISDQKAASAKLDEAIEAL  117

Query  61   VELS  64
             ELS
Sbjct  118  SELS  121

>H310_01781
Length=458

 Score = 30.8 bits (68),  Expect = 1.1, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  45  DASAIHAKVQSARQGIVELSQYTNLNPSSMTWKVD  79
           DA+  HA VQ A+ G  +L     L+ +++ W++D
Sbjct  21  DATEAHALVQRAQSGFADLVDVCQLDTAAVRWRLD  55

>H257_04030
Length=121

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (51%), Gaps = 1/75 (1%)

Query  5   KEVVRIYRRILKLAAQYPS-IKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           +EV+ +Y+  L  A++ P  + R  +    +L+FR+  HL D  A+   +  A++ +  +
Sbjct  6   REVLHVYKACLVSASKCPQHVHRETMRAYARLKFRDKMHLRDVQAVKLCLADAKEELERM  65

Query  64  SQYTNLNPSSMTWKV  78
             Y ++  +    KV
Sbjct  66  DYYHSMYRAGQADKV  80

>PYAP_20847
Length=86

 Score = 29.6 bits (65),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIK-RNAIIRDIKLEFRENKHLTDASA  48
           M   + V+R+Y+ +L+ A  + S   R+  +R ++ +FR+NK L   SA
Sbjct  1   MATKQAVLRLYKDMLRDAVTFESYNYRSYAVRRVRTDFRKNKALVVGSA  49

>H310_05414
Length=158

 Score = 29.6 bits (65),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKR--NAIIRDIKLEFRENKHLTDASAIHAKVQSARQ  58
           +T  ++V R+Y+R LKL   +   +R  N     I+ +F +NKH TD +     +   R+
Sbjct  23  LTHKQQVTRLYKRSLKLLDSWVIDRRLWNEEATKIRGQFDDNKH-TDLAVAQRLI---RE  78

Query  59  GIVELSQYTNLNP  71
              +L +YT+ +P
Sbjct  79  ANAQLEKYTHPDP  91

>PHYKE_7613
Length=87

 Score = 28.9 bits (63),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  7   VVRIYRRILKLAAQYPSIK-RNAIIRDIKLEFRENKHLTDAS  47
           V+R+YR +L+ A++  +   R+   R +K +FR+NK L + S
Sbjct  6   VLRLYREMLRSASKLETYNFRSYFTRRVKEDFRKNKTLAEGS  47

>PYU1_G013186
Length=114

 Score = 29.3 bits (64),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 5/58 (9%)

Query  1   MTEAKEVVRIYRRILKLAAQYPS--IKRNAIIRDIKLEFRENKHLTDASAIHAKVQSA  56
           M EA+    +YRR+L++A  +    +++  I R+ +  F E + +TDA  I   VQ+ 
Sbjct  1   MAEARA---LYRRVLRVARTWEGGYVEQQWIRREARTRFEEQRAITDARRIRELVQAG  55

>PYAP_13894
Length=124

 Score = 29.3 bits (64),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/66 (23%), Positives = 37/66 (56%), Gaps = 1/66 (2%)

Query  5   KEVVRIYRRILKLAAQYPSIKRNAIIRD-IKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           KEV+ +YR  L+ A + P  ++  +++  ++++FR   +  D + I   +  AR+ + ++
Sbjct  7   KEVLGLYRACLRSARKCPEWEQREMMKTYVRMKFRHEMYTKDTTRIKRMLADAREELEQM  66

Query  64  SQYTNL  69
             Y ++
Sbjct  67  EYYHSV  72

>H257_16211
Length=85

 Score = 28.5 bits (62),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (3%)

Query  4   AKEVVRIYRRILKLAAQYPSIK-RNAIIRDIKLEFREN  40
           + EV+R+YR +L+ AAQ+ +   R    R IK +FR N
Sbjct  5   STEVLRLYRDLLREAAQFQNYTFRTYSQRRIKADFRAN  42

>PPTG_19462
Length=383

 Score = 28.9 bits (63),  Expect = 4.7, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  5    KEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFR  38
            + V RI RRI +LA ++P++K   +  D+K  FR
Sbjct  244  ESVRRIARRIEELAERHPTLKIKLLKGDVKTAFR  277

>PPTG_19469
Length=383

 Score = 28.9 bits (63),  Expect = 4.7, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  5    KEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFR  38
            + V RI RRI +LA ++P++K   +  D+K  FR
Sbjct  244  ESVRRIARRIEELAERHPTLKIKLLKGDVKTAFR  277

>PPTG_07739
Length=511

 Score = 28.9 bits (63),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (59%), Gaps = 0/41 (0%)

Query  20   QYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60
            ++PS++  A+  +  +EF E   +TD S +  K++S +  I
Sbjct  469  EFPSLQPQAVFSEDLMEFTEEAAVTDVSEMCTKLESKKNLI  509

>PHYSO_380352
Length=122

 Score = 28.1 bits (61),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  2   TEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFR  38
           TE + V RI R IL  A ++PS     ++ D+   FR
Sbjct  43  TEYEPVERIAREILHQAEKFPSADIKLLLGDVASAFR  79

>SDRG_08892
Length=82

 Score = 27.7 bits (60),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 13/47 (28%), Positives = 25/47 (53%), Gaps = 0/47 (0%)

Query  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDAS  47
           M      +R+YR I + +A++P +    I  + +  FR  +H T+A+
Sbjct  1   MMAGSHALRLYRAIFETSARFPPLMAKKIRFNARELFRLRRHETNAA  47

>PHYKE_8253
Length=388

 Score = 28.5 bits (62),  Expect = 7.5, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 18/34 (53%), Gaps = 0/34 (0%)

Query  48  AIHAKVQSARQGIVELSQYTNLNPSSMTWKVDVG  81
           A H K+QS     V+   Y   NP+  T++VDV 
Sbjct  13  AAHDKLQSPTTANVDYDHYQYQNPADSTFRVDVA  46

>HYAP_04441
Length=260

 Score = 28.1 bits (61),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 19/36 (53%), Gaps = 0/36 (0%)

Query  29   IIRDIKLEFRENKHLTDASAIHAKVQSARQGIVELS  64
            + + I+L FREN  L D     AKV  A + + EL 
Sbjct  85   LTKSIQLAFRENLRLDDVKTASAKVDDAIKALSELG  120

>PYAR_14148
Length=139

 Score = 27.7 bits (60),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 34/63 (54%), Gaps = 1/63 (2%)

Query  5   KEVVRIYRRILKLAAQYPSIKRNAIIRD-IKLEFRENKHLTDASAIHAKVQSARQGIVEL  63
           K+ + +YR  ++ A + P  ++  +++  ++++FR+  H  D S I   +  AR+ +  +
Sbjct  9   KDALALYRACMRSARKCPEWEQREMMKTYVRMKFRDEVHTQDTSRIKRLLADAREELERM  68

Query  64  SQY  66
             Y
Sbjct  69  DYY  71

>PITG_11064
Length=265

 Score = 28.1 bits (61),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  29   IIRDIKLEFRENKHLTDASAIHAKVQSARQGIVELS  64
            +++ I+  FR+N H+ D     AK+  A + + ELS
Sbjct  85   VVKSIQTAFRQNMHINDQKDASAKLDEAIETLSELS  120

Lambda      K        H        a         alpha
   0.317    0.129    0.350    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3367751040

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40