Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G0019711617122222211848e-167
PYIW_177511617122422411398e-160
PYIR_170331617123222411224e-157
PHYKE_108181617123022811052e-154
PHYSO_5388861617122822611007e-154
PPTG_101841617122822610973e-153
PITG_206291617122822610963e-153
PHYCA_1228181617122922710931e-152
PYVX_146271617122922910912e-152
PHALS_051931617122822610712e-149
PYAR_171301617122722610573e-147
PYAP_16586161712532529942e-137
PHYRA_8473016170194321510391e-129
HYAP_07162161711942209276e-128
CCI46337161712292268994e-123
CCA17366161712282268838e-121
H310_01462161712252248724e-119
SDRG_06607161712202258431e-114
SPRG_05306161712202258421e-114
H257_00325161712402397991e-107
HYAP_07161161701881787903e-107
PYIW_2766816706413840730.86
CCI503071201644387731.9
CCA201261204117987712.2
PYIR_266328668121279702.6
CCA177741184121897684.8
PPTG_083456560251860705.5
PYIR_235481204116287666.7
PITG_078656560275068696.8
PYVX_214581204117887667.2
PHYCA_5609021204117791667.3
PYU1_G0142171204117887667.7
PYIW_145251204117887667.7
PHALS_102131204117787667.9
PHYRA_756391204117787667.9
PPTG_020591204117787667.9
PHYKE_99791204117787667.9
PITG_148851204117787667.9
PHYSO_3033951204116887668.1
HYAP_014656267749688.3
PYAP_212461204117887668.4
PPTG_000601781829847679.5
PPTG_224921117796158679.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001971

Length=222
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYU1_G001971                                                          460     8e-167
PYIW_17751                                                            443     8e-160
PYIR_17033                                                            436     4e-157
PHYKE_10818                                                           430     2e-154
PHYSO_538886                                                          428     7e-154
PPTG_10184                                                            427     3e-153
PITG_20629                                                            426     3e-153
PHYCA_122818                                                          425     1e-152
PYVX_14627                                                            424     2e-152
PHALS_05193                                                           417     2e-149
PYAR_17130                                                            411     3e-147
PYAP_16586                                                            387     2e-137
PHYRA_84730                                                           404     1e-129
HYAP_07162                                                            361     6e-128
CCI46337                                                              350     4e-123
CCA17366                                                              344     8e-121
H310_01462                                                            340     4e-119
SDRG_06607                                                            329     1e-114
SPRG_05306                                                            328     1e-114
H257_00325                                                            312     1e-107
HYAP_07161                                                            308     3e-107
PYIW_27668                                                            32.7    0.86  
CCI50307                                                              32.7    1.9   
CCA20126                                                              32.0    2.2   
PYIR_26632                                                            31.6    2.6   
CCA17774                                                              30.8    4.8   
PPTG_08345                                                            31.6    5.5   
PYIR_23548                                                            30.0    6.7   
PITG_07865                                                            31.2    6.8   
PYVX_21458                                                            30.0    7.2   
PHYCA_560902                                                          30.0    7.3   
PYU1_G014217                                                          30.0    7.7   
PYIW_14525                                                            30.0    7.7   
PHALS_10213                                                           30.0    7.9   
PHYRA_75639                                                           30.0    7.9   
PPTG_02059                                                            30.0    7.9   
PHYKE_9979                                                            30.0    7.9   
PITG_14885                                                            30.0    7.9   
PHYSO_303395                                                          30.0    8.1   
HYAP_01465                                                            30.8    8.3   
PYAP_21246                                                            30.0    8.4   
PPTG_00060                                                            30.4    9.5   
PPTG_22492                                                            30.4    9.8   

>PYU1_G001971
Length=222

 Score = 460 bits (1184),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 222/222 (100%), Positives = 222/222 (100%), Gaps = 0/222 (0%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180
            DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180

Query  181  QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN  222
            QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN
Sbjct  181  QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN  222

>PYIW_17751
Length=224

 Score = 443 bits (1139),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 214/224 (96%), Positives = 218/224 (97%), Gaps = 2/224 (1%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKV+ADVGLCITIYDFVHIGDAFVH
Sbjct  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVVADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180
            DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTA GIQATTTEASDKA +  
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKAEASD  180

Query  181  --QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN  222
              QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGL+SWW+N
Sbjct  181  LRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWWVN  224

>PYIR_17033
Length=232

 Score = 436 bits (1122),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 212/224 (95%), Positives = 216/224 (96%), Gaps = 5/224 (2%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV+PELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH
Sbjct  1    MFVLTRISDVIPVSPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180
            DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTA GIQATTTEASDKAA+  
Sbjct  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTATGIQATTTEASDKAATSA  180

Query  181  -----QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSW  219
                 QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGL+SW
Sbjct  181  AGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSW  224

>PHYKE_10818
Length=230

 Score = 430 bits (1105),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 216/228 (95%), Gaps = 8/228 (4%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VLVEEIDRKYANKVI+DVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVISDVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180
            D+AERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA +EG
Sbjct  121  DSAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAENEG  180

Query  181  --------QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                    QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW
Sbjct  181  VVTAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  228

>PHYSO_538886
Length=228

 Score = 428 bits (1100),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 207/226 (92%), Positives = 214/226 (95%), Gaps = 6/226 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASE-  179
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA  E 
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  180  -----GQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                  QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226

>PPTG_10184
Length=228

 Score = 427 bits (1097),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 206/226 (91%), Positives = 213/226 (94%), Gaps = 6/226 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MF LTR+SDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFALTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASE-  179
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA  E 
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  180  -----GQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                  QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226

>PITG_20629
Length=228

 Score = 426 bits (1096),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 206/226 (91%), Positives = 213/226 (94%), Gaps = 6/226 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASE-  179
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA  E 
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEI  180

Query  180  -----GQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                  QSLARRRSSSVDLSDNDPTPSAIHIL TIDEDGLGLSSWW
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILATIDEDGLGLSSWW  226

>PHYCA_122818
Length=229

 Score = 425 bits (1093),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 208/227 (92%), Positives = 214/227 (94%), Gaps = 7/227 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VLVEE+DRKYANKVIADVGLCIT+YDFV IGDAFVH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEVDRKYANKVIADVGLCITLYDFVSIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANG-IQATTTEASDKAASE  179
            DTAERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA G IQATTTEA+DKA  E
Sbjct  121  DTAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGSIQATTTEATDKAEKE  180

Query  180  G------QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                   QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW
Sbjct  181  TSAGDMRQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  227

>PYVX_14627
Length=229

 Score = 424 bits (1091),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 204/229 (89%), Positives = 215/229 (94%), Gaps = 7/229 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTRLSDVIPV PELFDADYT+VLVEEIDRKYANKVIADVGLCIT++DFVHIGDAF+H
Sbjct  1    MFVLTRLSDVIPVAPELFDADYTQVLVEEIDRKYANKVIADVGLCITLHDFVHIGDAFIH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180
            D+AERLWVWKYS+ QEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DK    G
Sbjct  121  DSAERLWVWKYSDSQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKEQDGG  180

Query  181  -------QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN  222
                   +SLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGL+SWW+N
Sbjct  181  AKNGDMRESLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLTSWWVN  229

>PHALS_05193
Length=228

 Score = 417 bits (1071),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 201/226 (89%), Positives = 213/226 (94%), Gaps = 6/226 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VL+EEIDRKYANKVIADVGLCIT+YDFV IGDA VH
Sbjct  1    MFVLTRISDVIPVEPELFDADYTQVLIEEIDRKYANKVIADVGLCITLYDFVSIGDAHVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFR+VVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRLVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASE-  179
            DTAERLWVWKYS+GQEKF+MD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DK+  E 
Sbjct  121  DTAERLWVWKYSDGQEKFFMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKSEKEI  180

Query  180  -----GQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                  +SLAR+RSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW
Sbjct  181  GAGDMRRSLARQRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  226

>PYAR_17130
Length=227

 Score = 411 bits (1057),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 210/226 (93%), Gaps = 6/226 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV P+LF+ DY KVLVEEIDRKYANKVIADVGLC++IYDFVHIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCVSIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            P+DGTSHSQVEFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PADGTSHSQVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDK-----  175
            DTAERLWVWKYSEG EKFYMD+HEEIRFRVTNINFTRVTKTA+GIQATTTEASDK     
Sbjct  121  DTAERLWVWKYSEGNEKFYMDLHEEIRFRVTNINFTRVTKTAHGIQATTTEASDKTEGAR  180

Query  176  -AASEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
             A    QSLAR RS+SVDLS++DPTPSAIHILGTIDEDGLGLSSWW
Sbjct  181  NAGDMRQSLARGRSASVDLSESDPTPSAIHILGTIDEDGLGLSSWW  226

>PYAP_16586
Length=253

 Score = 387 bits (994),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 209/252 (83%), Gaps = 32/252 (13%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV P+LF+ DY KVLVEEIDRKYANKVIADVGLC++IYDFVHIGDAFVH
Sbjct  1    MFVLTRISDVIPVAPDLFEEDYQKVLVEEIDRKYANKVIADVGLCLSIYDFVHIGDAFVH  60

Query  61   PSDGTSHSQV------------EFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDII  108
            P+DGTSHSQV            EFRMVVFRPFVGEVLKGRIVSC EEHIRVSMDFVQDII
Sbjct  61   PADGTSHSQVKRDGSTDARGVVEFRMVVFRPFVGEVLKGRIVSCNEEHIRVSMDFVQDII  120

Query  109  IPSYALQTPSYFDTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTAN-----  163
            IPSYA+QTPSYFDTAERLWVWKYSEG EKFYMD+HEEIRFRVT+INFTRVTKTA+     
Sbjct  121  IPSYAMQTPSYFDTAERLWVWKYSEGNEKFYMDLHEEIRFRVTSINFTRVTKTAHGGWYV  180

Query  164  ---------GIQATTTEASDK------AASEGQSLARRRSSSVDLSDNDPTPSAIHILGT  208
                     GIQATTTEAS+K      A    QSL R RS+SVDLSD+DPTPSAIHILGT
Sbjct  181  DADGVVGGVGIQATTTEASEKTEGTANAGDMRQSLTRGRSASVDLSDSDPTPSAIHILGT  240

Query  209  IDEDGLGLSSWW  220
            IDEDGLGLSSWW
Sbjct  241  IDEDGLGLSSWW  252

>PHYRA_84730
Length=1943

 Score = 404 bits (1039),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 6/215 (3%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVIPV PELFDADYT+VLVEEIDRKYANKV+ADVGLCIT+YDFV IGDA+VH
Sbjct  1    MFVLTRISDVIPVAPELFDADYTQVLVEEIDRKYANKVLADVGLCITLYDFVSIGDAYVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHSQVEFRMVVFRPFVGEVLKGR+VSCTEEHIRVSMDFVQDIIIPSYALQTPSYF
Sbjct  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRVVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASE-  179
            D AERLWVWKYSEGQEKFYMD+HEEIRFRVTNINFTRVTKTA GIQATTTEA+DKA  E 
Sbjct  121  DAAERLWVWKYSEGQEKFYMDLHEEIRFRVTNINFTRVTKTAKGIQATTTEATDKAEKEV  180

Query  180  -----GQSLARRRSSSVDLSDNDPTPSAIHILGTI  209
                  QSLARRRSSSVDLSDNDPTPSAIHIL  +
Sbjct  181  SAGDMRQSLARRRSSSVDLSDNDPTPSAIHILARL  215

>HYAP_07162
Length=194

 Score = 361 bits (927),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 186/220 (85%), Gaps = 28/220 (13%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTRLSDVIPV P LFDADYT+VL+EEIDRKYANKVIADVGLC+T+YDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHS VEFRM+VFRPFVGEVLKGRIV CT+EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAASEG  180
            DTAE+LWVWKYS+GQEKFYMD+HEEIRFRVTNINFTRVTKTA                  
Sbjct  121  DTAEKLWVWKYSDGQEKFYMDLHEEIRFRVTNINFTRVTKTAK-----------------  163

Query  181  QSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWW  220
                       DLSDNDPTPSAIHILG+IDEDGLGLSSWW
Sbjct  164  -----------DLSDNDPTPSAIHILGSIDEDGLGLSSWW  192

>CCI46337
Length=229

 Score = 350 bits (899),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 197/226 (87%), Gaps = 5/226 (2%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTR+SDVI ++P LFD DYTKVL EEIDRKY NKVIADVGLCI++YDF+ IGDA +H
Sbjct  1    MFVLTRISDVIAIHPMLFDGDYTKVLKEEIDRKYCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PS+G SH+QVEFRM+VFRPF+GEVLKG+I+SC E HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMIVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATT---TEASDKAA  177
            DT ERLWVW +++  EKF+MD++EEIRFRVTN+NFT+V KTA G+QATT   TE  DKA+
Sbjct  121  DTYERLWVWTFTDSAEKFHMDLNEEIRFRVTNVNFTQVHKTAKGMQATTSESTEKKDKAS  180

Query  178  SEGQSL--ARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWI  221
             +  +L   RRR SSVDLSD+DPTPSA+ ILGTIDEDGLGL+SWWI
Sbjct  181  LKRGNLDDKRRRLSSVDLSDSDPTPSAMQILGTIDEDGLGLTSWWI  226

>CCA17366
Length=228

 Score = 344 bits (883),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 196/226 (87%), Gaps = 5/226 (2%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVL R+SDVI ++P LFD DYT+VL EEID+K+ NKVIADVGLCI++YDF+ IGDA +H
Sbjct  1    MFVLARISDVIAIHPMLFDGDYTRVLKEEIDKKFCNKVIADVGLCISVYDFIAIGDALIH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PS+G SH+QVEFRMVVFRPF+GEVLKG+I+SC E HIR++M+F+QDI+IPSYALQTPS+F
Sbjct  61   PSEGDSHTQVEFRMVVFRPFIGEVLKGKILSCNENHIRITMEFMQDILIPSYALQTPSHF  120

Query  121  DTAERLWVWKYSEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAAS--  178
            DT ERLWVW ++E  EKF+MD++EE+RFRVTN+NFT+V KTA G+QATT E++DK     
Sbjct  121  DTYERLWVWTFTESGEKFHMDLNEEVRFRVTNVNFTQVHKTAKGMQATTIESTDKDGKST  180

Query  179  -EGQSL--ARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWI  221
             +G ++   +RR SSVDLSDNDPTPSA+ ILGTIDEDGLGL+SWW+
Sbjct  181  LKGGNIDDRKRRLSSVDLSDNDPTPSAMQILGTIDEDGLGLTSWWV  226

>H310_01462
Length=225

 Score = 340 bits (872),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 191/224 (85%), Gaps = 4/224 (2%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVL R++DVI V PELF ADY+ VL+EEIDRKYANKVIADVGLCIT YDF+ IGDA+VH
Sbjct  1    MFVLCRVADVIQVAPELFSADYSSVLIEEIDRKYANKVIADVGLCITHYDFIEIGDAYVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I++CTEEHIRVSM+F+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIINCTEEHIRVSMEFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKY---SEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAA  177
            D  ERLW WK+    + Q+ +YM ++EE+RFRVTNINFTRV KTANG+QA  TEA+D   
Sbjct  121  DKTERLWEWKFPGREDDQDPYYMYLNEEVRFRVTNINFTRVLKTANGMQA-VTEAADTKP  179

Query  178  SEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWI  221
             + ++  RRRSSSVDLSD DP P+A+ I+GTIDEDGLGLSSWW+
Sbjct  180  DKSENPTRRRSSSVDLSDTDPKPAALQIIGTIDEDGLGLSSWWV  223

>SDRG_06607
Length=220

 Score = 329 bits (843),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 194/225 (86%), Gaps = 9/225 (4%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVL R++DVI + PELF  DY+ VL EEIDRKYANKVIADVGLCIT+YDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH++V FRMVVF+PF+GEVLKG+I+SCTEEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAA  177
            D  ERLW WK+    + Q+ +YM +HEEIRFRVTNINFTRVTKTA GIQAT TEA+D A+
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEIRFRVTNINFTRVTKTAKGIQATVTEAADSAS  180

Query  178  SEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN  222
                  +RRRSSSVDLS++DP PSA+ I+GTIDEDGLGLSSWWI 
Sbjct  181  ------SRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWWIE  219

>SPRG_05306
Length=220

 Score = 328 bits (842),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 194/225 (86%), Gaps = 9/225 (4%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVL R++DVI + PELF  DY+ VL EEIDRKYANKVIADVGLCIT+YDF+ IGDA++H
Sbjct  1    MFVLCRIADVIQIAPELFGTDYSSVLTEEIDRKYANKVIADVGLCITLYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH++V FRMVVF+PF+GEVLKG+I+SCTEEHIRVSMDFVQDIIIPSYA+QTPS+F
Sbjct  61   PSDGTSHTEVVFRMVVFQPFIGEVLKGKIISCTEEHIRVSMDFVQDIIIPSYAMQTPSFF  120

Query  121  DTAERLWVWKY---SEGQEKFYMDMHEEIRFRVTNINFTRVTKTANGIQATTTEASDKAA  177
            D  ERLW WK+    + Q+ +YM +HEE+RFRVTNINFTRVTKTA GIQAT TEA+D A+
Sbjct  121  DKNERLWEWKFPGKEDEQDPYYMYLHEEVRFRVTNINFTRVTKTAKGIQATVTEAADSAS  180

Query  178  SEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWIN  222
                  +RRRSSSVDLS++DP PSA+ I+GTIDEDGLGLSSWWI 
Sbjct  181  ------SRRRSSSVDLSEHDPKPSAMQIIGTIDEDGLGLSSWWIE  219

>H257_00325
Length=240

 Score = 312 bits (799),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 193/239 (81%), Gaps = 19/239 (8%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVL R++DVI V PELF +DY+ VL+EEIDRKYANKV+ADVGLCIT YDF+ IGDA++H
Sbjct  1    MFVLCRVADVIQVAPELFSSDYSSVLIEEIDRKYANKVVADVGLCITHYDFIEIGDAYIH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSH+ V FRMVVFRPF+GE+LKG+I+SCTEEHIRVSMDF+QDIIIPSYA+Q PS+F
Sbjct  61   PSDGTSHTDVIFRMVVFRPFIGEILKGKIISCTEEHIRVSMDFMQDIIIPSYAMQNPSFF  120

Query  121  DTAERLWVWKYS--EG----------------QEKFYMDMHEEIRFRVTNINFTRVTKTA  162
            D  ERLW WK+   EG                Q+ +YM ++EEIRFRVTNINFTRV KTA
Sbjct  121  DKTERLWEWKFPGREGIYCYAALPPIPTFVDDQDPYYMYLNEEIRFRVTNINFTRVLKTA  180

Query  163  NGIQATTTEASDKAASEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLGLSSWWI  221
             G+QA  T+A+D    + ++ +RRRSSSVDLSD+DP P+A+ I+GTIDEDGLGLSSWW+
Sbjct  181  KGMQA-VTDATDSKPDKHEAPSRRRSSSVDLSDSDPKPAALQIIGTIDEDGLGLSSWWV  238

>HYAP_07161
Length=188

 Score = 308 bits (790),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 158/178 (89%), Gaps = 14/178 (8%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
            MFVLTRLSDVIPV P LFDADYT+VL+EEIDRKYANKVIADVGLC+T+YDFV IGDAFVH
Sbjct  1    MFVLTRLSDVIPVAPSLFDADYTQVLIEEIDRKYANKVIADVGLCVTLYDFVRIGDAFVH  60

Query  61   PSDGTSHSQVEFRMVVFRPFVGEVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYF  120
            PSDGTSHS VEFRM+VFRPFVGEVLKGRIV CT+EHIRVSMDFVQDIIIPSYALQTPSY+
Sbjct  61   PSDGTSHSHVEFRMIVFRPFVGEVLKGRIVGCTDEHIRVSMDFVQDIIIPSYALQTPSYY  120

Query  121  DTAERLWVWKYSEGQ--------------EKFYMDMHEEIRFRVTNINFTRVTKTANG  164
            DTAE+LWVWKYS+GQ              EKFYMD+HEEIRFRVTNINFTRVTKTA G
Sbjct  121  DTAEKLWVWKYSDGQGEGVPQTWSRCLAVEKFYMDLHEEIRFRVTNINFTRVTKTAKG  178

>PYIW_27668
Length=138

 Score = 32.7 bits (73),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 26/40 (65%), Gaps = 3/40 (8%)

Query  83   EVLKGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPS--YF  120
            E+ K    + +++H+ ++MDF Q++  PS A +TPS  YF
Sbjct  26   ELYKNEFAAVSDDHVVLTMDFAQNLTTPS-AAETPSEWYF  64

>CCI50307
Length=443

 Score = 32.7 bits (73),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1    MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
            MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  265  MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  324

Query  59   VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
            +  S G     + +R ++FRPF  +VL
Sbjct  325  IQDSSGYVCFNIRYRAILFRPFKNQVL  351

>CCA20126
Length=179

 Score = 32.0 bits (71),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  EVL
Sbjct  61  IQDNSGYVCFNIRYRAILFRPFKNEVL  87

>PYIR_26632
Length=212

 Score = 31.6 bits (70),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 40/79 (51%), Gaps = 6/79 (8%)

Query  2   FVLTR-LSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVHIGDAFVH  60
           +VL R  S ++P    + D D+  +L+EE   + A KVI  V    T  DFV  G   V 
Sbjct  12  YVLLRSTSKIVPCESVVTDVDHPLLLLEEALSRVAMKVIEIV----TPNDFVCEGVCTVK  67

Query  61  PSDGTSHSQVEFRMV-VFR  78
            S G S S+  F ++ VFR
Sbjct  68  SSCGVSISEDGFALLQVFR  86

>CCA17774
Length=218

 Score = 30.8 bits (68),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 22/97 (23%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query  36   NKVIADVGLCITIYDFVHIGDAFVHPSDGTS--HSQVEFRMVVFRPFVGEVLKGRIVSCT  93
            N+ +  V LC   ++ +H+GD + H    +   H ++    +VF+P  G +LK +I    
Sbjct  43   NETLKGVILC---FNSIHLGDPYGHIISDSPYVHCKIIANALVFQPRQGMLLKAQINKIG  99

Query  94   EEHIRVSMDFVQDIIIPSYALQTPSYFDTAERLWVWK  130
              HI +    V +  + +  L     ++  +  W+ K
Sbjct  100  SNHIGMLFVGVFNGSVAASELPEGFVYNYHKEAWIGK  136

>PPTG_08345
Length=2518

 Score = 31.6 bits (70),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 1/60 (2%)

Query  156   TRVTKTANGIQATTTEASDKAASEGQSLARRRSSSVDLSDNDPTPSAIHILGTIDEDGLG  215
             T ++    G++   T AS+ +A E  S +  RS    L DN  +   I+IL  IDED  G
Sbjct  1414  TNLSPAPAGMRTIGT-ASEASAQEFSSTSSVRSERFSLDDNGSSRGMINILEQIDEDAFG  1472

>PYIR_23548
Length=162

 Score = 30.0 bits (66),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PITG_07865
Length=2750

 Score = 31.2 bits (69),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 6/68 (9%)

Query  150   VTNINFTRVTKTANGIQATTTEASDKAASEGQSLARRRSSSVDLSDNDPTPS--AIHILG  207
             VTN++       A G++A  T AS+ +A +  S +  RS    + DN+   S   I+IL 
Sbjct  1644  VTNLS----PAPAGGMRAIGTGASEPSAQDFSSTSSVRSERFSVDDNNGGSSRGLINILE  1699

Query  208   TIDEDGLG  215
              IDED  G
Sbjct  1700  QIDEDAFG  1707

>PYVX_21458
Length=178

 Score = 30.0 bits (66),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKFGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PHYCA_560902
Length=177

 Score = 30.0 bits (66),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 39/91 (43%), Gaps = 2/91 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVLKGRI  89
           +  + G     + +R ++FRPF  +VL   I
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVLDAVI  91

>PYU1_G014217
Length=178

 Score = 30.0 bits (66),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PYIW_14525
Length=178

 Score = 30.0 bits (66),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PHALS_10213
Length=177

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PHYRA_75639
Length=177

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PPTG_02059
Length=177

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PHYKE_9979
Length=177

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PITG_14885
Length=177

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>PHYSO_303395
Length=168

 Score = 30.0 bits (66),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGFVCFNIRYRAILFRPFKNQVL  87

>HYAP_01465
Length=677

 Score = 30.8 bits (68),  Expect = 8.3, Method: Composition-based stats.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query  156  TRVTKTANG--IQATTTEASDKAASEGQSLARRRSSSVDLSDNDPTPSA  202
            T  T ++N   + A T     +A S    L RR+SSS   S++ P P+A
Sbjct  212  TTTTNSSNAQLVDAQTLVDKQRATSSSNLLVRRKSSSTRGSNHAPAPTA  260

>PYAP_21246
Length=178

 Score = 30.0 bits (66),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 38/87 (44%), Gaps = 2/87 (2%)

Query  1   MFVLTRLSDVIPVNPELFDADYTKVLVEEIDRKYANKVIADVGLCITIYDFVH--IGDAF  58
           MF L +LS  + ++P  F      ++   +  +     +   G  IT+ +     IG   
Sbjct  1   MFFLKQLSRDLLLHPMHFGPRLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV  60

Query  59  VHPSDGTSHSQVEFRMVVFRPFVGEVL  85
           +  + G     + +R ++FRPF  +VL
Sbjct  61  IQDNSGYVCFNIRYRAILFRPFKNQVL  87

>PPTG_00060
Length=298

 Score = 30.4 bits (67),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 10/47 (21%)

Query  86   KGRIVSCTEEHIRVSMDFVQDIIIPSYALQTPSYFDTAERLWVWKYS  132
            K  + S +E+H  + MDF Q++ +PS A  TPS          W+YS
Sbjct  161  KKDLASVSEDHAVIVMDFSQNLTLPSVA-STPSQ---------WEYS  197

>PPTG_22492
Length=961

 Score = 30.4 bits (67),  Expect = 9.8, Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (45%), Gaps = 0/58 (0%)

Query  151  TNINFTRVTKTANGIQATTTEASDKAASEGQSLARRRSSSVDLSDNDPTPSAIHILGT  208
            T  +F  +  TAN + A T EAS +       L         +S++DP  SA+ +  T
Sbjct  536  TATDFVLIEATANSVPAFTVEASGRTTIANGGLIVNGLGGAQISNSDPAASALVVSAT  593

Lambda      K        H        a         alpha
   0.320    0.135    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11111420790

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40