Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_14752111501031103151560.0
PYIR_15175111501030103348910.0
PYU1_G005966111501030103348900.0
PHYSO_560347111501010103845440.0
PPTG_09255111501008103845360.0
PHYCA_570034111501011104045330.0
PYVX_13921111501041106045280.0
PHALS_11566111501009103845160.0
PITG_13745111501008103844900.0
HYAP_08497111501007104143720.0
PHYRA_8167811150975103543300.0
PYAP_2488311150980100941830.0
CCA1799111150965101438240.0
CCI40831111501163100336540.0
SDRG_14094111501003106532880.0
H310_11729111501002106632310.0
H257_1278711150968105632200.0
SPRG_03282111501004106632050.0
PYAR_247791115069970528430.0
PHYKE_64071115093465528380.0
PYAR_2437410571032532612042e-156
PYAP_197456156725108860.40
PYAP_13607481027038840.50
PYIR_167906156744122850.53
PYVX_132586156646171850.61
PYVX_16007966009043760.69
H310_1052314050926264820.71
H257_0504912647338138821.1
PYU1_G0112626156730135811.6
H257_0392513993329062801.7
CCA20583329736544782.7
PYAP_1333350334682782.8
PYIW_242651299428389773.1
PHALS_11598136771421104793.3
SPRG_1363913724917952753.8
PYAR_20912481026641764.0
PHYCA_123937654828734764.4
SPRG_1487013028824652764.7
PYIR_175257904102397775.8
CCI42121329758244766.5
PYAP_21787154352046766.6
H310_0707713993330162756.8
SDRG_1014613376122051747.0
H257_049161053666842757.8
PYU1_G00611011279983110758.1
PPTG_05364229668467759.5
PYVX_17912481013439709.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_14752

Length=1031
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYIW_14752                                                            1990    0.0   
PYIR_15175                                                            1888    0.0   
PYU1_G005966                                                          1888    0.0   
PHYSO_560347                                                          1754    0.0   
PPTG_09255                                                            1751    0.0   
PHYCA_570034                                                          1750    0.0   
PYVX_13921                                                            1748    0.0   
PHALS_11566                                                           1744    0.0   
PITG_13745                                                            1734    0.0   
HYAP_08497                                                            1688    0.0   
PHYRA_81678                                                           1672    0.0   
PYAP_24883                                                            1615    0.0   
CCA17991                                                              1477    0.0   
CCI40831                                                              1412    0.0   
SDRG_14094                                                            1271    0.0   
H310_11729                                                            1249    0.0   
H257_12787                                                            1244    0.0   
SPRG_03282                                                            1239    0.0   
PYAR_24779                                                            1099    0.0   
PHYKE_6407                                                            1097    0.0   
PYAR_24374                                                            468     2e-156
PYAP_19745                                                            37.7    0.40  
PYAP_13607                                                            37.0    0.50  
PYIR_16790                                                            37.4    0.53  
PYVX_13258                                                            37.4    0.61  
PYVX_16007                                                            33.9    0.69  
H310_10523                                                            36.2    0.71  
H257_05049                                                            36.2    1.1   
PYU1_G011262                                                          35.8    1.6   
H257_03925                                                            35.4    1.7   
CCA20583                                                              34.7    2.7   
PYAP_13333                                                            34.7    2.8   
PYIW_24265                                                            34.3    3.1   
PHALS_11598                                                           35.0    3.3   
SPRG_13639                                                            33.5    3.8   
PYAR_20912                                                            33.9    4.0   
PHYCA_123937                                                          33.9    4.4   
SPRG_14870                                                            33.9    4.7   
PYIR_17525                                                            34.3    5.8   
CCI42121                                                              33.9    6.5   
PYAP_21787                                                            33.9    6.6   
H310_07077                                                            33.5    6.8   
SDRG_10146                                                            33.1    7.0   
H257_04916                                                            33.5    7.8   
PYU1_G006110                                                          33.5    8.1   
PPTG_05364                                                            33.5    9.5   
PYVX_17912                                                            31.6    9.9   

>PYIW_14752
Length=1031

 Score = 1990 bits (5156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1031/1031 (100%), Positives = 1031/1031 (100%), Gaps = 0/1031 (0%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240

Query  241   PALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             PALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   PALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVAP  360
             GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGSTGGRKLSVAP
Sbjct  301   GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGSTGGRKLSVAP  360

Query  361   NNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA  420
             NNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA
Sbjct  361   NNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA  420

Query  421   ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI  480
             ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI
Sbjct  421   ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI  480

Query  481   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLLI  540
             HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLLI
Sbjct  481   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLLI  540

Query  541   ANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLAKK  600
             ANGSSSGDRKVSHSGQDGLSGGADGGKKRAGAAALNFDIETAISVLWENYPQHALTLAKK
Sbjct  541   ANGSSSGDRKVSHSGQDGLSGGADGGKKRAGAAALNFDIETAISVLWENYPQHALTLAKK  600

Query  601   HEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTL  660
             HEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTL
Sbjct  601   HEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTL  660

Query  661   VTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  720
             VTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN
Sbjct  661   VTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSN  720

Query  721   TSIGNTLLEMVLSGSADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRY  780
             TSIGNTLLEMVLSGSADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRY
Sbjct  721   TSIGNTLLEMVLSGSADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRY  780

Query  781   LYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATSGE  840
             LYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATSGE
Sbjct  781   LYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATSGE  840

Query  841   EWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekkieeddeki  900
             EWKELKQLLVLIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDDEKI
Sbjct  841   EWKELKQLLVLIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDDEKI  900

Query  901   kAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERE  960
             KAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERE
Sbjct  901   KAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERE  960

Query  961   CITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDD  1020
             CITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDD
Sbjct  961   CITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDD  1020

Query  1021  GSFDMRFSAEF  1031
             GSFDMRFSAEF
Sbjct  1021  GSFDMRFSAEF  1031

>PYIR_15175
Length=1030

 Score = 1888 bits (4891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 982/1033 (95%), Positives = 1001/1033 (97%), Gaps = 5/1033 (0%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKETLKDANGLWLKGVDIT+MSANRGMICVGDADGFIHLANRQLETRKFQ
Sbjct  1     MAQWRRFAFFDKETLKDANGLWLKGVDITTMSANRGMICVGDADGFIHLANRQLETRKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHEHFVSHVVMMKRSNILVSIGDG+D RS+ELRAQSKAVAEAGRSANS EEMYASKQTGK
Sbjct  61    AHEHFVSHVVMMKRSNILVSIGDGIDPRSDELRAQSKAVAEAGRSANSAEEMYASKQTGK  120

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNT SHV+LYASTRRGLT YHCTHDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVYLYASTRRGLTVYHCTHDD  240

Query  241   PALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             PALVKSAG +GLPPRTVVLDERGVDTNCSCVN+EGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   PALVKSAGAAGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVAP  360
             GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKG  GGRK  VAP
Sbjct  301   GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTTKGPVGGRKPPVAP  360

Query  361   NNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA  420
             N RAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNL+SIA
Sbjct  361   NTRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLFSIA  420

Query  421   ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI  480
             ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI
Sbjct  421   ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI  480

Query  481   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLLI  540
             HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEI+DGKK DL+GDLLI
Sbjct  481   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEILDGKKSDLNGDLLI  540

Query  541   ANGS-SSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLAK  599
             ANG+ ++GD+K      DG  GGADGGKK  G AALNFD+ETAISVLWENYPQHALTLAK
Sbjct  541   ANGNGTAGDKKAKQ---DGSVGGADGGKKGPGTAALNFDVETAISVLWENYPQHALTLAK  597

Query  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659
             KHEEHSWYLKIQLDRISYVESEDS ALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT
Sbjct  598   KHEEHSWYLKIQLDRISYVESEDSAALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  657

Query  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719
             LVTHLPGPTTELLKQLCTGKFVP N+ LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS
Sbjct  658   LVTHLPGPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  717

Query  720   NTSIGNTLLEMVLSGSAD-ETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  778
             NTSIGNTLLEMVLSGS D E RSEEE EDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK
Sbjct  718   NTSIGNTLLEMVLSGSGDEEKRSEEETEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  777

Query  779   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS  838
             RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS
Sbjct  778   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS  837

Query  839   GEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekkieedde  898
             GEEWKELKQLLVLID+NPVIPPLQVVQVLSQSRELPV+VLKQYIVNQLLNDEKKIEEDDE
Sbjct  838   GEEWKELKQLLVLIDNNPVIPPLQVVQVLSQSRELPVAVLKQYIVNQLLNDEKKIEEDDE  897

Query  899   kikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  958
             KIKAFKSDTKQMKEEI+QL GKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE
Sbjct  898   KIKAFKSDTKQMKEEISQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  957

Query  959   RECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV  1018
             RECITCSMDHRHIMGLK+QLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV
Sbjct  958   RECITCSMDHRHIMGLKSQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV  1017

Query  1019  DDGSFDMRFSAEF  1031
             DDGSFDMRFS EF
Sbjct  1018  DDGSFDMRFSNEF  1030

>PYU1_G005966
Length=1030

 Score = 1888 bits (4890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 965/1033 (93%), Positives = 989/1033 (96%), Gaps = 5/1033 (0%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKETLKD NGLWLKGVDITSMSANRGMICVGD DGFIHLANRQLETRKFQ
Sbjct  1     MAQWRRFAFFDKETLKDGNGLWLKGVDITSMSANRGMICVGDGDGFIHLANRQLETRKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE+FVSHVVMMKRSNILVSIGDG+D RS ELRAQSKAVA+AGRSANS EEM+ASKQTGK
Sbjct  61    AHENFVSHVVMMKRSNILVSIGDGIDPRSAELRAQSKAVADAGRSANSAEEMFASKQTGK  120

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQ AVGLKNGAVIL
Sbjct  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQLAVGLKNGAVIL  180

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNT SHVFLYASTRRGLTCYHCTHDD
Sbjct  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTVSHVFLYASTRRGLTCYHCTHDD  240

Query  241   PALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFE  300
             PALVKSAG SGLPPRTVVLDERGVDTNCSCVN+EGEIAVGQTDAVYFYTTEDRSVCFGFE
Sbjct  241   PALVKSAGASGLPPRTVVLDERGVDTNCSCVNDEGEIAVGQTDAVYFYTTEDRSVCFGFE  300

Query  301   GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVAP  360
             GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTT+KG  GGRK  +AP
Sbjct  301   GEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTTSKGPAGGRKPPIAP  360

Query  361   NNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA  420
             N+RAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA
Sbjct  361   NSRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIA  420

Query  421   ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI  480
             ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI
Sbjct  421   ISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRI  480

Query  481   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLS-GDLL  539
             HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEI+DGKK DLS GD L
Sbjct  481   HNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIVDGKKNDLSGGDAL  540

Query  540   IA-NGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLA  598
              A NG+ +   K++   +   S GA+  +K  G AALNFD+ETAISVLWENYPQHALTLA
Sbjct  541   SAVNGTGAAGDKLA---KRDSSAGAETAQKGPGTAALNFDVETAISVLWENYPQHALTLA  597

Query  599   KKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGR  658
             KKHEEHSWYLKIQLDRISYVESEDSVALS HEKERVADALEYIKHLSFSEADSNLRKYGR
Sbjct  598   KKHEEHSWYLKIQLDRISYVESEDSVALSTHEKERVADALEYIKHLSFSEADSNLRKYGR  657

Query  659   TLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETV  718
             TLVTHLP PTTELLKQLCTGKFVP N+ LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETV
Sbjct  658   TLVTHLPEPTTELLKQLCTGKFVPDNSKLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETV  717

Query  719   SNTSIGNTLLEMVLSGSADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  778
             SNTSIGNTLLEMVLS +ADE R+EEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK
Sbjct  718   SNTSIGNTLLEMVLSETADEKRTEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGK  777

Query  779   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATS  838
             RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGAT+
Sbjct  778   RYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATT  837

Query  839   GEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekkieedde  898
             GEEW+ELKQLL LIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEED+E
Sbjct  838   GEEWRELKQLLALIDSNPVIPPLQVVQVLSQSRELPVSVLKQYIVNQLLNDEKKIEEDEE  897

Query  899   kikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  958
             KIKAFKSDTKQMKEEI QL GKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE
Sbjct  898   KIKAFKSDTKQMKEEITQLSGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETE  957

Query  959   RECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPV  1018
             RECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVP+
Sbjct  958   RECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPI  1017

Query  1019  DDGSFDMRFSAEF  1031
             DDGSFD RFS EF
Sbjct  1018  DDGSFDARFSNEF  1030

>PHYSO_560347
Length=1010

 Score = 1754 bits (4544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 892/1038 (86%), Positives = 942/1038 (91%), Gaps = 35/1038 (3%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMMKRSN+LV+IGDG+D R EELR QSKA+AEAGR  N+ EEMY SK TGK
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRDEELREQSKAIAEAGRGPNA-EEMYTSKPTGK  119

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             +TAVVR WRTDQQDR+GKPKLLQQIPVFAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  120   STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             F++DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT T +HVFLYASTRRGLTCYHC+HDD
Sbjct  180   FKSDLKRRADRPPQLLQPAGQYPVTGLAFTSKPVTATVAHVFLYASTRRGLTCYHCSHDD  239

Query  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
             PN R PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  358   PNARVPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKK---GDLSG  536
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK   G  SG
Sbjct  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKGGSDSG  537

Query  537   DLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALT  596
             DL   NG ++                          A LNFD+ETAISVLWENYPQHALT
Sbjct  538   DLTPRNGGAAA-------------------------ANLNFDVETAISVLWENYPQHALT  572

Query  597   LAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKY  656
             LAKKHEEHSWYLKIQLD ISYV+SEDSVALS  EKERVADALEYI+HLSFSEADSNLRKY
Sbjct  573   LAKKHEEHSWYLKIQLDHISYVDSEDSVALSDSEKERVADALEYIEHLSFSEADSNLRKY  632

Query  657   GRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  716
             GRTLVTH+PGPTTELLK+LCTGKFVPGN  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVE
Sbjct  633   GRTLVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  692

Query  717   TVSNTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRG  773
             TVSNTSIGNTLLEMVLS      +  RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G
Sbjct  693   TVSNTSIGNTLLEMVLSDDDEGENGARSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHG  752

Query  774   VKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLP  833
             +KKGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERGPLP
Sbjct  753   MKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERGPLP  812

Query  834   KGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekki  893
             KGATSGEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL NDEKKI
Sbjct  813   KGATSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLANDEKKI  872

Query  894   eeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  953
             EED+EKIKAFKSDTKQMKEEIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC
Sbjct  873   EEDEEKIKAFKSDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  932

Query  954   ISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKS  1013
             ISET+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKS
Sbjct  933   ISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKS  992

Query  1014  NEVPVDDGSFDMRFSAEF  1031
             NEV +D+GSF+ RFSAEF
Sbjct  993   NEVVLDEGSFETRFSAEF  1010

>PPTG_09255
Length=1008

 Score = 1751 bits (4536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 890/1038 (86%), Positives = 941/1038 (91%), Gaps = 37/1038 (4%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMMKRSN+LV+IGDG+D R +ELR QSKA+AEAGRS N+ EEMY SK +GK
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPDELREQSKAIAEAGRSPNA-EEMYTSKPSGK  119

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             +TAVVR WRTDQQDR+GKPKLLQQIPVFAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  120   STAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FR+DLKRR+DRPPHLLQPAGQYPVTGL FTSKPVT T SHVFLYASTRRGLTCYHC+HDD
Sbjct  180   FRSDLKRRADRPPHLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDD  239

Query  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
              N RAPGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  358   SNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDL---SG  536
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK      SG
Sbjct  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKSDSDSG  537

Query  537   DLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALT  596
             DL   NG+++                            LNFD+ETAISVLWENYPQHALT
Sbjct  538   DLTPRNGAAAN---------------------------LNFDVETAISVLWENYPQHALT  570

Query  597   LAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKY  656
             LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKY
Sbjct  571   LAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKY  630

Query  657   GRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  716
             GRTLVTH+P PTTELLK+LCTGKFVPGN  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVE
Sbjct  631   GRTLVTHMPAPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  690

Query  717   TVSNTSIGNTLLEMVLSGSADE---TRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRG  773
             TVSNTSIGNTLLEMVLS   +E   TRS EE E+AV+ ILDNPRVKYDEDHALIHLQM G
Sbjct  691   TVSNTSIGNTLLEMVLSDDDEEEGGTRSVEEKEEAVLRILDNPRVKYDEDHALIHLQMHG  750

Query  774   VKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLP  833
             +KKGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAERGPLP
Sbjct  751   MKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLP  810

Query  834   KGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekki  893
             KGAT GEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKI
Sbjct  811   KGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKI  870

Query  894   eeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  953
             EED+EKIKAFK DTKQMKEEIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC
Sbjct  871   EEDEEKIKAFKGDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  930

Query  954   ISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKS  1013
             ISET+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKS
Sbjct  931   ISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKS  990

Query  1014  NEVPVDDGSFDMRFSAEF  1031
             NEV +D+GSF+ RFSAEF
Sbjct  991   NEVVLDEGSFETRFSAEF  1008

>PHYCA_570034
Length=1011

 Score = 1750 bits (4533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 888/1040 (85%), Positives = 940/1040 (90%), Gaps = 38/1040 (4%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMMKRSN+LV+IGDG+D R EELR QSKA+AEAGR+ N+ EEMY SK TGK
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRPEELREQSKAIAEAGRTPNA-EEMYTSKPTGK  119

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             +TAVVR WRTDQQDR+GKPKLLQQIP+FAKKYPEEAVTAFAVNDD++QFAVGLKNGAVIL
Sbjct  120   STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLTQFAVGLKNGAVIL  179

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FR+DLKRR+DRPPHLLQPAGQYPVTGL F SKPVT T SHVFLYASTRRGLTCYHC+HDD
Sbjct  180   FRSDLKRRTDRPPHLLQPAGQYPVTGLSFASKPVTATVSHVFLYASTRRGLTCYHCSHDD  239

Query  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  240   PALVKSAGGAAALPPRTTVLDERGVDVNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEK+YL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKRYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
              N RAPGARFGLDEMEE+RHVVCEFGAIFVVSS+GH+YRL+EKDTTSKLEILFRKNLYSI
Sbjct  358   SNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHIYRLSEKDTTSKLEILFRKNLYSI  417

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKK-----GDL  534
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK     G  
Sbjct  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKNGTKSGSD  537

Query  535   SGDLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHA  594
             SGDL   NG ++ +                          LNFD+ETAISVLWENYPQHA
Sbjct  538   SGDLTPRNGGAAAN--------------------------LNFDVETAISVLWENYPQHA  571

Query  595   LTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLR  654
             LTLAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLR
Sbjct  572   LTLAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLR  631

Query  655   KYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVE  714
             KYGRTLVTHLPGPTTELLK+LCTGKFVPGN  LKSDPGDFLHLFVSHRAQLKEFLQYIVE
Sbjct  632   KYGRTLVTHLPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVE  691

Query  715   VETVSNTSIGNTLLEMVLSGSADE---TRSEEEVEDAVMAILDNPRVKYDEDHALIHLQM  771
             VETVSNTSIGNTLLEMVLS   D    TRS EE E+AV+ ILDNPRVKYDEDHALIHLQM
Sbjct  692   VETVSNTSIGNTLLEMVLSDDDDGENGTRSVEEKEEAVLRILDNPRVKYDEDHALIHLQM  751

Query  772   RGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGP  831
              G+KKGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAERGP
Sbjct  752   HGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGP  811

Query  832   LPKGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdek  891
             LPKGAT GEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEK
Sbjct  812   LPKGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEK  871

Query  892   kieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHL  951
             KIEED+EKIKAFK DTKQMKEEI QL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHL
Sbjct  872   KIEEDEEKIKAFKGDTKQMKEEITQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHL  931

Query  952   NCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIF  1011
             NCISET+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIF
Sbjct  932   NCISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIF  991

Query  1012  KSNEVPVDDGSFDMRFSAEF  1031
             KSNEV +D+GSF+ RFSAEF
Sbjct  992   KSNEVVLDEGSFETRFSAEF  1011

>PYVX_13921
Length=1041

 Score = 1748 bits (4528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 886/1060 (84%), Positives = 945/1060 (89%), Gaps = 48/1060 (5%)

Query  1     MAQWRRFAFFDKETLKDANGLWLK-----------------GVDITSMSANRGMICVGDA  43
             MAQWRRFAFFDKE LKDANG W+K                 GVDITSMSANRGMICVGDA
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKSLDANFFRRLVVPDAIQGVDITSMSANRGMICVGDA  60

Query  44    DGFIHLANRQLETRKFQAHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAG  103
             DGF+HLANRQLE RKFQAHE+FVSHVVMMKRSN+LV++GDG+D RSEEL+AQSKA+AEAG
Sbjct  61    DGFVHLANRQLEARKFQAHENFVSHVVMMKRSNVLVTVGDGIDPRSEELKAQSKAIAEAG  120

Query  104   RSANSVEEMYASKQTGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVN  163
             RS N+ EEM+  KQ+GK+TAVVR WRTDQQDRDGKPKLLQQ+P+FAKKYPEEAVTAFAV+
Sbjct  121   RSGNA-EEMFTPKQSGKSTAVVRFWRTDQQDRDGKPKLLQQVPIFAKKYPEEAVTAFAVH  179

Query  164   DDISQFAVGLKNGAVILFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFL  223
             DD+SQFAVGLKNGAVILFR+DLKRRSDRPPHLLQPAGQYPVTGL FTSKP+T T SHVFL
Sbjct  180   DDVSQFAVGLKNGAVILFRSDLKRRSDRPPHLLQPAGQYPVTGLAFTSKPITATVSHVFL  239

Query  224   YASTRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTD  283
             YASTRRGLTCYHCTHDDPA+ K+AG +G+PPRTVVLDERGVD +CSCVN+EGE+AVGQTD
Sbjct  240   YASTRRGLTCYHCTHDDPAVTKAAGAAGMPPRTVVLDERGVDMSCSCVNDEGELAVGQTD  299

Query  284   AVYFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtlt  343
             AVYFYTTEDRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT
Sbjct  300   AVYFYTTEDRSVCFGFEGEKKYLSFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT  359

Query  344   ntttkgstggRKLSVAPNNR-------APGARFGLDEMEEIRHVVCEFGAIFVVSSVGHV  396
             +T +    G R+  +APN R         GARFGLDEMEEIRHVVCEFGAIFVVSSVGHV
Sbjct  360   STNSNAKGGARRPPLAPNARXXXXXXXXXGARFGLDEMEEIRHVVCEFGAIFVVSSVGHV  419

Query  397   YRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLR  456
             YRL+EKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGD+DGSLR
Sbjct  420   YRLSEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDFDGSLR  479

Query  457   QYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  516
             QY RTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK
Sbjct  480   QYVRTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKK  539

Query  517   LDKFIQLDEIIDGKKGDLSGDLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLN  576
             LDKFIQLDE+ID  K     + +     SS +  +     +                  N
Sbjct  540   LDKFIQLDEVIDSSKKAADRNSIAKLPRSSDETGLDGKRDNP-----------------N  582

Query  577   FDIETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVAD  636
             FD+ETAISVLWENYP+HALTLAKK+EEHSWYLKIQLDRISYVESEDSVALS HEKERV D
Sbjct  583   FDVETAISVLWENYPKHALTLAKKYEEHSWYLKIQLDRISYVESEDSVALSDHEKERVTD  642

Query  637   ALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLH  696
             ALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGN+ LKSDPGDFLH
Sbjct  643   ALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNSSLKSDPGDFLH  702

Query  697   LFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSGSADET-----RSEEEVEDAVMA  751
             LFVSHRAQLKEFLQYIVEVETV+NTSIGNTLLEMVLS  +++      R++ E EDAVM 
Sbjct  703   LFVSHRAQLKEFLQYIVEVETVTNTSIGNTLLEMVLSDDSEDAEGSAPRTDAEKEDAVML  762

Query  752   ILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKH  811
             ILDNPRVKYDEDHALIHLQM G+KKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKH
Sbjct  763   ILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKH  822

Query  812   GEKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsR  871
             GEKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLL LID+NPVIPPLQVVQVLSQSR
Sbjct  823   GEKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPVIPPLQVVQVLSQSR  882

Query  872   ELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDL  931
             ELPVSV+KQYIVNQL NDE+KI ED+EKIKAFK DTKQMKEEI+QL  KAVVFQATKCDL
Sbjct  883   ELPVSVVKQYIVNQLANDERKIAEDEEKIKAFKGDTKQMKEEISQLSSKAVVFQATKCDL  942

Query  932   CNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQ  991
             CNHDLDLPAVHFMCQHSFHLNCISETEREC+TCS+DHRHIMGLKTQLEQKAGNHEQF+NQ
Sbjct  943   CNHDLDLPAVHFMCQHSFHLNCISETERECMTCSLDHRHIMGLKTQLEQKAGNHEQFYNQ  1002

Query  992   LETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             LETAADGF+TIAEYFGKGIFKSNEV  DDGSF+ RFSAEF
Sbjct  1003  LETAADGFNTIAEYFGKGIFKSNEV-ADDGSFETRFSAEF  1041

>PHALS_11566
Length=1009

 Score = 1744 bits (4516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 868/1038 (84%), Positives = 939/1038 (90%), Gaps = 36/1038 (3%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADG ++LANR +E RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGSVYLANRSMEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMMKRSN+LV+IGDG+D RSEELR QSK +AEAGR+ N+ E+MY +K TGK
Sbjct  61    AHEMFVSHVVMMKRSNVLVTIGDGIDPRSEELREQSKVIAEAGRAPNA-EDMYTAKPTGK  119

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             +TA+VR WRTDQQDR+GKPKL+QQIP+FAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  120   STAIVRFWRTDQQDREGKPKLMQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FR+DLKRR+DRPPHLLQPAGQYPVTGL FTSKPVT T SHVFLYAST RGLTCYHC+HDD
Sbjct  180   FRSDLKRRADRPPHLLQPAGQYPVTGLAFTSKPVTVTLSHVFLYASTGRGLTCYHCSHDD  239

Query  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGV+ NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  240   PALVKSAGGAAALPPRTTVLDERGVEMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEKK++ FFKHYL+VAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T++KG    RK  ++
Sbjct  300   EGEKKFVCFFKHYLIVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTSSKGPI--RKAPLS  357

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
              N RAPGARFG+DEMEEIRHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  358   LNARAPGARFGIDEMEEIRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDL---SG  536
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDV+KLDKFIQLDE+ID KK      SG
Sbjct  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVQKLDKFIQLDEVIDAKKTKTDRNSG  537

Query  537   DLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALT  596
             DL++ NG ++ +                          LNFD+ETAISVLWENYPQHALT
Sbjct  538   DLMLRNGGATAN--------------------------LNFDVETAISVLWENYPQHALT  571

Query  597   LAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKY  656
             LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKY
Sbjct  572   LAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKY  631

Query  657   GRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  716
             GRTLVTH+P PTTELLK+LCTGKFVP N  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVE
Sbjct  632   GRTLVTHMPAPTTELLKRLCTGKFVPSNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  691

Query  717   TVSNTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRG  773
             T+SNTSIGNTLLEMVLS      +  RS EE EDAV+ ILDNPRVKYDEDHALIHLQM  
Sbjct  692   TISNTSIGNTLLEMVLSDDDEGENGLRSVEEKEDAVLRILDNPRVKYDEDHALIHLQMHS  751

Query  774   VKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLP  833
             +KKGKRYLYNKLHMYHMLVQFHIEE+DDQSI++EVRKHGEKDPNLWSLALKYFAERGPLP
Sbjct  752   MKKGKRYLYNKLHMYHMLVQFHIEESDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLP  811

Query  834   KGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekki  893
             KGA  GEEWKELKQLLVLID+NP IPPLQVVQVLSQSRELPVSV+KQY+V+QL NDEKKI
Sbjct  812   KGAIDGEEWKELKQLLVLIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVSQLANDEKKI  871

Query  894   eeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  953
             EED+EKIKAFKSDTKQMK+EIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC
Sbjct  872   EEDEEKIKAFKSDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  931

Query  954   ISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKS  1013
             ISET+REC+TCSMDHRHI+GLK+QLEQKAGNHEQF+NQLETA DGFHTIAEYFGKGIFKS
Sbjct  932   ISETDRECLTCSMDHRHILGLKSQLEQKAGNHEQFYNQLETAVDGFHTIAEYFGKGIFKS  991

Query  1014  NEVPVDDGSFDMRFSAEF  1031
             NEV +D+GSF+ RFSAEF
Sbjct  992   NEVVLDEGSFETRFSAEF  1009

>PITG_13745
Length=1008

 Score = 1734 bits (4490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 878/1038 (85%), Positives = 936/1038 (90%), Gaps = 37/1038 (4%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVD+TSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDVTSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMMKRSN+LV+IGDG+D R EELR QSKA+AEAGR+ N+ EEMY SK  GK
Sbjct  61    AHELFVSHVVMMKRSNVLVTIGDGIDPRLEELREQSKAIAEAGRAPNA-EEMYTSKPAGK  119

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             +TAVVR WRTDQQDR+GKPKLLQQIP+FAKKYPEEAVTAFA NDD+SQFAVGLKNGAVIL
Sbjct  120   STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAANDDLSQFAVGLKNGAVIL  179

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FR+DLKRR+DRPP LLQPAGQYPVTGL FTSKPVT T SHVFLYASTRRGLTCYHC+HDD
Sbjct  180   FRSDLKRRTDRPPQLLQPAGQYPVTGLSFTSKPVTATVSHVFLYASTRRGLTCYHCSHDD  239

Query  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  240   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEKK+L FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  300   EGEKKFLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  357

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
              N R+PGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  358   SNARSPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  418   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDL---SG  536
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK      SG
Sbjct  478   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTKTDSDSG  537

Query  537   DLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALT  596
             +L   NG+ +                            LNFD+ETAISVLWENYPQHALT
Sbjct  538   ELTPRNGAVAN---------------------------LNFDVETAISVLWENYPQHALT  570

Query  597   LAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKY  656
             LAKKHEEHSWYLKIQLD ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNLRKY
Sbjct  571   LAKKHEEHSWYLKIQLDHISYVDSEDSAALSESEKERVADALEYIEHLSFSEADSNLRKY  630

Query  657   GRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  716
             GRTLVTH+P PTTELLK+LCTGKFVPGN  +KSDPGDFLHLFVSHRAQLKEFLQYIVEVE
Sbjct  631   GRTLVTHMPAPTTELLKRLCTGKFVPGNPSMKSDPGDFLHLFVSHRAQLKEFLQYIVEVE  690

Query  717   TVSNTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRG  773
             TVSNTSIGNTLLEMVLS      +  RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G
Sbjct  691   TVSNTSIGNTLLEMVLSDDDEGENGKRSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHG  750

Query  774   VKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLP  833
             +K+GKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKDPNLWSLALKYFAERGPLP
Sbjct  751   MKRGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDPNLWSLALKYFAERGPLP  810

Query  834   KGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekki  893
             KGAT GEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKI
Sbjct  811   KGATGGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKI  870

Query  894   eeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  953
             EED+EKIKAFK+DTKQMK+EIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC
Sbjct  871   EEDEEKIKAFKNDTKQMKDEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNC  930

Query  954   ISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKS  1013
             ISET+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKS
Sbjct  931   ISETDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKS  990

Query  1014  NEVPVDDGSFDMRFSAEF  1031
             NEV +D+GSF+ RFSAEF
Sbjct  991   NEVVLDEGSFETRFSAEF  1008

>HYAP_08497
Length=1007

 Score = 1688 bits (4372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 856/1041 (82%), Positives = 928/1041 (89%), Gaps = 44/1041 (4%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADG++HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGYVHLANRSLEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMMKRSN+L +IGDG+D R +ELR QSKA+AEAGR+ N      A + TGK
Sbjct  61    AHELFVSHVVMMKRSNVLATIGDGIDPRPDELREQSKAIAEAGRAPN------AEEPTGK  114

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             +TAVVR WRTD QDR+GKPKLLQQIP+FAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  115   STAVVRFWRTDLQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  174

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FR+DLKRR+DRP HLLQPAGQYPVTGL F SKPVT T+ HVFLYASTRRGLTCYHC+HDD
Sbjct  175   FRSDLKRRTDRPSHLLQPAGQYPVTGLSFISKPVTATSVHVFLYASTRRGLTCYHCSHDD  234

Query  241   PALVKS-AGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKS  G + LPPRT VLDERGVD NCSCVNEE EIAVGQTDAVYFYTTEDRSVCF F
Sbjct  235   PALVKSVGGAAALPPRTTVLDERGVDVNCSCVNEEDEIAVGQTDAVYFYTTEDRSVCFAF  294

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEKKYLHFFKHYLLVAH+DPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  295   EGEKKYLHFFKHYLLVAHIDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  352

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
              N+R   ARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  353   SNSRTADARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  412

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  413   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  472

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLS----  535
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK + +    
Sbjct  473   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKKTNGTKIDN  532

Query  536   --GDLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQH  593
                DL + +G  + +                          LNFD+ETAISVLWENYPQH
Sbjct  533   DASDLALKDGGGAAN--------------------------LNFDVETAISVLWENYPQH  566

Query  594   ALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNL  653
             ALTLA+KHEEHSWYLKIQL +ISYV+SEDS ALS  EKERVADALEYI+HLSFSEADSNL
Sbjct  567   ALTLARKHEEHSWYLKIQLGQISYVDSEDSAALSESEKERVADALEYIQHLSFSEADSNL  626

Query  654   RKYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIV  713
             RKYGRTLVTH+PGP TELLK+LCTGK+VP +  LKSDPGDFLHLFVSHRAQLKEFLQYIV
Sbjct  627   RKYGRTLVTHMPGPATELLKRLCTGKYVPEDPSLKSDPGDFLHLFVSHRAQLKEFLQYIV  686

Query  714   EVETVSNTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQ  770
             EVETVSNTSIGNTLLEMVLS      +  RS EE E++V+ ILDNPRVKYDEDHALIHLQ
Sbjct  687   EVETVSNTSIGNTLLEMVLSDDDEGENGGRSVEEKEESVLRILDNPRVKYDEDHALIHLQ  746

Query  771   MRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERG  830
             MRG+KKGKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHG+KDPNLWSLALKYFAERG
Sbjct  747   MRGMKKGKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGDKDPNLWSLALKYFAERG  806

Query  831   PLPKGATSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNde  890
             PLPKGATSG+EW+EL+QLLVLID+N  IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DE
Sbjct  807   PLPKGATSGKEWEELQQLLVLIDTNSAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDE  866

Query  891   kkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFH  950
             KKIEED+EKIKAF+SDTKQMKEEIAQL  +AVVFQATKCDLC+HDLDLPAVHFMCQHSFH
Sbjct  867   KKIEEDEEKIKAFRSDTKQMKEEIAQLSSRAVVFQATKCDLCSHDLDLPAVHFMCQHSFH  926

Query  951   LNCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGI  1010
             LNCISET+RECI+CSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGF+TIAEYFGKGI
Sbjct  927   LNCISETDRECISCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFNTIAEYFGKGI  986

Query  1011  FKSNEVPVDDGSFDMRFSAEF  1031
             FKSNEV +D+GSF+ RFSAEF
Sbjct  987   FKSNEVVLDEGSFETRFSAEF  1007

>PHYRA_81678
Length=975

 Score = 1672 bits (4330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 861/1035 (83%), Positives = 909/1035 (88%), Gaps = 64/1035 (6%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFFDKE LKDA+G W+KGVDITSMSANRG+ICVGDADGF+HLANR LE RKFQ
Sbjct  1     MAQWRRFAFFDKEVLKDASGPWMKGVDITSMSANRGLICVGDADGFVHLANRSLEARKFQ  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
             AHE FVSHVVMM                                        Y SK TGK
Sbjct  61    AHELFVSHVVMM----------------------------------------YTSKPTGK  80

Query  121   TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
             TTAVVR WRTDQQDR+GKPKLLQQIPVFAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  81    TTAVVRFWRTDQQDREGKPKLLQQIPVFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  140

Query  181   FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
             FR+DLKRR+DRPPHLLQPAGQYPVTGLEFTSKPVT T +HVFLYASTRRGLTCYHC+HDD
Sbjct  141   FRSDLKRRTDRPPHLLQPAGQYPVTGLEFTSKPVTATVAHVFLYASTRRGLTCYHCSHDD  200

Query  241   PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  201   PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  260

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT+T  KG    RK  +A
Sbjct  261   EGEKKYLRFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTSTNPKGPM--RKPPLA  318

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
              N RAPGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  319   SNARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  378

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+NSI+DIFRMYGDHLYQKGD+DGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  379   AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDFDGSLRQYVRTIGHVEPSYVIRRFLDAQR  438

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539
             IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID +K + +    
Sbjct  439   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDARKANGT----  494

Query  540   IANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLAK  599
               +GS SGD                       AA LNFD+ETAISVLWENYPQHALTLAK
Sbjct  495   -KSGSDSGD-------------TTPRNGGGGAAANLNFDVETAISVLWENYPQHALTLAK  540

Query  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659
             KHEEHSWYLKIQLD ISYV+SEDSVALS +EKERVADALEYI+HLSFSEADSNLRKYGRT
Sbjct  541   KHEEHSWYLKIQLDHISYVDSEDSVALSENEKERVADALEYIEHLSFSEADSNLRKYGRT  600

Query  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719
             LVTH+PGPTTELLK+LCTGKFVPGN  LKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS
Sbjct  601   LVTHMPGPTTELLKRLCTGKFVPGNPSLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  660

Query  720   NTSIGNTLLEMVLSG---SADETRSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKK  776
             NTSIGNTLLEMVLS      +  RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G+KK
Sbjct  661   NTSIGNTLLEMVLSDDDEGENGARSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKK  720

Query  777   GKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGA  836
             GKRYLYNKLHMYHMLVQFHIEENDDQSI++EVRKHGEKD NLWSLALKYFAERGPLPKGA
Sbjct  721   GKRYLYNKLHMYHMLVQFHIEENDDQSILEEVRKHGEKDLNLWSLALKYFAERGPLPKGA  780

Query  837   TSGEEWKELKQLLVLIDSNPVIpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekkieed  896
             TSGEEWKELKQLL LID+NP IPPLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKIEED
Sbjct  781   TSGEEWKELKQLLALIDTNPAIPPLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEED  840

Query  897   dekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  956
             +EKIKAFK DTKQMKEEIAQL  +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE
Sbjct  841   EEKIKAFKGDTKQMKEEIAQLSSRAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISE  900

Query  957   TERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEV  1016
             T+RECITCSMDHRHI+GLKTQLEQKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV
Sbjct  901   TDRECITCSMDHRHILGLKTQLEQKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEV  960

Query  1017  PVDDGSFDMRFSAEF  1031
              +D+GSF+ RFSAEF
Sbjct  961   VLDEGSFETRFSAEF  975

>PYAP_24883
Length=980

 Score = 1615 bits (4183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1009 (81%), Positives = 889/1009 (88%), Gaps = 37/1009 (4%)

Query  31    MSANRGMICVGDADGFIHLANRQLETRKFQAHEHFVSHVVMMKRSNILVSIGDGMDHRSE  90
             MSANRGM+CVGDADGF+HLANRQLE RKF+AHEHFVSH+VMMKRSN+LV+IGDG+D RS+
Sbjct  1     MSANRGMLCVGDADGFVHLANRQLEARKFRAHEHFVSHIVMMKRSNVLVTIGDGIDPRSD  60

Query  91    ELRAQSKAVAEAGRSANSV-------EEMYA-SKQTGKTTAVVRLWRTDQQDRDGKPKLL  142
             ELR QS+A+AEAGR+A +        ++M+  S  +GK+TAVVR+WRTDQQDRDG+PKLL
Sbjct  61    ELREQSRAIAEAGRAAGAAGAGAATADDMFTRSADSGKSTAVVRIWRTDQQDRDGRPKLL  120

Query  143   QQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVILFRTDLKRRSDRPPHLLQPAGQY  202
             QQ+PVFAKKYPEEAVTAFAV+DDI QFAVGL+NGAVILFR DLKRR++RPP LLQPAGQ+
Sbjct  121   QQVPVFAKKYPEEAVTAFAVSDDIGQFAVGLRNGAVILFRIDLKRRAERPPQLLQPAGQF  180

Query  203   PVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDER  262
             PVTGL FTSKP++NT +HVFLYASTRRGLTCYHC HDDPALVK+AG +GLP RTVVLDER
Sbjct  181   PVTGLSFTSKPISNTVAHVFLYASTRRGLTCYHCNHDDPALVKAAGAAGLPSRTVVLDER  240

Query  263   GVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRG  322
             GVD +CSCVN+EGEIAVGQ DAVYFY  EDRSVCFGFEGEKKYL FFKHYLLVAHVDPRG
Sbjct  241   GVDHHCSCVNDEGEIAVGQVDAVYFYNNEDRSVCFGFEGEKKYLQFFKHYLLVAHVDPRG  300

Query  323   RHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVAPNNRAPGARFGLDEMEEIRHVVC  382
             RHQVNVYDLQNKFIAFNW+LT T ++     R+  +  NNRAPGARFGLD+MEEIRHVVC
Sbjct  301   RHQVNVYDLQNKFIAFNWSLTQTASRNGGM-RRPPLPTNNRAPGARFGLDDMEEIRHVVC  359

Query  383   EFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  442
                          VYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG
Sbjct  360   ------------CVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYG  407

Query  443   DHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  502
             DHLY+KGD+DGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT
Sbjct  408   DHLYEKGDFDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTT  467

Query  503   LLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLLIANGSSSGDRKVSHsgqdglsgg  562
             LLLNCYTKLKDVKKLD FIQLDE  D   G+  G   +ANG +S D+             
Sbjct  468   LLLNCYTKLKDVKKLDNFIQLDENTDKLNGETKGIAAVANGGTSNDK-------------  514

Query  563   adggkkragaaaLNFDIETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESED  622
                  +  G   +NFDIETAISVLWENYPQHAL LAKKHEEHSWYLKIQLDRISYVESED
Sbjct  515   ---AHENGGKTGMNFDIETAISVLWENYPQHALILAKKHEEHSWYLKIQLDRISYVESED  571

Query  623   SVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVP  682
             SV LSA E+ERVADALEYI+HLSFSEAD+NLRKYGRTLVTHLPGPTT+LLK+LCTGKFVP
Sbjct  572   SVGLSASEQERVADALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGKFVP  631

Query  683   GNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSGSADETRSE  742
             GN  LKSDP DFLHLFVSHR QLKEFLQYIVEVETV+N  IGNTLLEMVLS   D   S+
Sbjct  632   GNPSLKSDPADFLHLFVSHREQLKEFLQYIVEVETVTNPLIGNTLLEMVLSDDGDTKLSD  691

Query  743   EEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQ  802
              E EDAVMAILDNPRV+YDEDHALIHLQMRG+KKGKRYLYNKLH+YHMLVQFHIEENDDQ
Sbjct  692   AEREDAVMAILDNPRVRYDEDHALIHLQMRGMKKGKRYLYNKLHLYHMLVQFHIEENDDQ  751

Query  803   SIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLVLIDSNPVIpplq  862
             +IIDEVRKHGEKDPNLWSLALKYFAERGPLPKG  +GEEWK+LKQLL LID+NPVIPPLQ
Sbjct  752   AIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGVKAGEEWKDLKQLLALIDTNPVIPPLQ  811

Query  863   vvqvlsqsRELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAV  922
             VV VLSQSRELPVSV+KQYIVNQL++DEKKIEED+EKIK +K+DTKQMKEEIAQL  +AV
Sbjct  812   VVHVLSQSRELPVSVVKQYIVNQLVSDEKKIEEDEEKIKTYKADTKQMKEEIAQLNSRAV  871

Query  923   VFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKA  982
             VFQATKC+LCNHDLDLPAVHFMC+HSFHLNCISETERECITCS+DHRHIMGLKTQLEQKA
Sbjct  872   VFQATKCELCNHDLDLPAVHFMCKHSFHLNCISETERECITCSLDHRHIMGLKTQLEQKA  931

Query  983   GNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             GNHEQF+NQLETAADGF TIAEYFGKGIFK++    DD +FD RFSAEF
Sbjct  932   GNHEQFYNQLETAADGFQTIAEYFGKGIFKTDIAAEDDSAFDARFSAEF  980

>CCA17991
Length=965

 Score = 1477 bits (3824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 734/1014 (72%), Positives = 851/1014 (84%), Gaps = 62/1014 (6%)

Query  31    MSANRGMICVGDADGFIHLANRQLETRKFQAHEHFVSHVVMMKRSNILVSIGDGMDHRSE  90
             MSANRG+IC GDA+G+IHL+N QLE RKFQAH HFVS +VMMKRSNILVS+GDG+D R  
Sbjct  1     MSANRGLICAGDAEGYIHLSNSQLEVRKFQAHNHFVSQIVMMKRSNILVSVGDGIDPRPS  60

Query  91    ELRAQSKAVAEAGRSANSVEEMYASKQTG--KTTAVVRLWRTDQQDRDGKPKLLQQIPVF  148
              + A+   V           ++ +SK  G  ++TA++R+WRTDQQDR+GKPK+LQQI VF
Sbjct  61    MIHAEKADV-----------DINSSKAAGDSESTAMIRIWRTDQQDREGKPKMLQQIQVF  109

Query  149   AKKYPEEAVTAFAVNDDISQFAVGLKNGAVILFRTDLKRRSDR-PPHLLQPAGQYPVTGL  207
             AK++PEEAVTAFAV+DD+SQ++VGLKNGAVIL+R+D + R +R  P LLQPAGQ+PVTGL
Sbjct  110   AKRFPEEAVTAFAVSDDVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGL  169

Query  208   EFTSKPVTNTASHVFLYASTRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDERGVDTN  267
              FT+KP+TN+ +HVFLYASTRRGLTCYHC  DD  +VK+ G S +PPR V LDERGVD +
Sbjct  170   AFTTKPITNSLNHVFLYASTRRGLTCYHCNQDDQYIVKAVGASRMPPRCVTLDERGVDFH  229

Query  268   CSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVN  327
             CSCVN++GEIAVGQ DAVYFYTT+D+SVCF F+GEKKYLHFFK YL+VAHVD RGRHQVN
Sbjct  230   CSCVNDDGEIAVGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVN  289

Query  328   VYDLQNKFIAFNWtltntttkgstggRKLSVAPNNRA----PGARFGLDEMEEIRHVVCE  383
             VYDLQNKFIAFNWTLT++    S+     + A   +     P +RFGLD ME+I+H+V E
Sbjct  290   VYDLQNKFIAFNWTLTHSVPSESSPNVSKATAARGKQSQPNPSSRFGLDRMEQIQHIVSE  349

Query  384   FGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGD  443
             FG+IFVVSS GHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSI+DIFRMYGD
Sbjct  350   FGSIFVVSSAGHVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGD  409

Query  444   HLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTL  503
             HLYQKGDYDGSLRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTL
Sbjct  410   HLYQKGDYDGSLRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTL  469

Query  504   LLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLLIANGSSSGDRKVSHsgqdglsgga  563
             LLNC+TKLKDVKKLD FIQL++          G+   A G +S                 
Sbjct  470   LLNCFTKLKDVKKLDAFIQLED----------GNAAKAGGQTS-----------------  502

Query  564   dggkkragaaaLNFDIETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDS  623
                        LNFD+ETAISVLWE YPQHALTLA+KHEEHSWYLKIQLD+ISYV+S+ S
Sbjct  503   -----------LNFDVETAISVLWEMYPQHALTLARKHEEHSWYLKIQLDQISYVDSDGS  551

Query  624   VALSAHEKERVADALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPG  683
               LS+ EKERV DALEYIKHLSF+EAD+NLRKYGRTLVTHLPGPTTELLK+LCTGKFVP 
Sbjct  552   TTLSSAEKERVIDALEYIKHLSFAEADANLRKYGRTLVTHLPGPTTELLKRLCTGKFVPE  611

Query  684   NAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSG-SADETRSE  742
                LKSDP DFLHLFVSHRAQL+EFLQYIVEVET+++ SIGNTLLEMVL+   ++E+ S 
Sbjct  612   KPELKSDPADFLHLFVSHRAQLREFLQYIVEVETITDPSIGNTLLEMVLTDEGSEESPSA  671

Query  743   EEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQ  802
             +  EDAVMAILDNPRV+YDEDHALIHLQM G++KGKRYL+NKLHMYHMLVQ HIEE+DDQ
Sbjct  672   DMKEDAVMAILDNPRVRYDEDHALIHLQMHGMRKGKRYLFNKLHMYHMLVQHHIEEHDDQ  731

Query  803   SIIDEVRKHGEKDPNLWSLALKYFAERGPLPK-----GATSGEEWKELKQLLVLIDSNPV  857
             SII+EVRKHG+KDPNLWSLALKYFAERGPLPK     G  S EEWKEL+QLL++ID+NPV
Sbjct  732   SIIEEVRKHGDKDPNLWSLALKYFAERGPLPKYVSKSGNASNEEWKELRQLLIMIDTNPV  791

Query  858   IpplqvvqvlsqsRELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQL  917
             IPPLQVVQVLSQ+R+LP+SV+K YI+NQL ++++ ++ D+EKI+AFK+DT+QMKEEIAQL
Sbjct  792   IPPLQVVQVLSQARDLPLSVIKPYILNQLSHNQELVDNDEEKIRAFKADTRQMKEEIAQL  851

Query  918   GGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQ  977
               KA+VFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET+REC+TCS++HRHI+GLKTQ
Sbjct  852   NSKAIVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECMTCSVEHRHILGLKTQ  911

Query  978   LEQKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             LEQKAGNHEQF+NQLET+ DGF TIAEYFGKGIFK NE+PVDD +FD +   +F
Sbjct  912   LEQKAGNHEQFYNQLETSMDGFETIAEYFGKGIFKKNEIPVDDPTFDFQSGVDF  965

>CCI40831
Length=1163

 Score = 1412 bits (3654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/1003 (71%), Positives = 832/1003 (83%), Gaps = 69/1003 (7%)

Query  40    VGDADGFIHLANRQLETRKFQAHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAV  99
             +GDAD  +H+ +      +F+AH H V     MKRSNILVS+GDG+D R+  + A+   V
Sbjct  219   MGDADD-LHIQS----DLQFRAHGHRV-----MKRSNILVSVGDGIDPRTSMIHAEKSDV  268

Query  100   AEAGRSANSVEEMYASKQTGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTA  159
                 R  ++ +         ++TA++R+WRTDQQDR+GKPK+LQQI VFAK++PEEAVTA
Sbjct  269   DTTSRKGDTGD--------SESTAMIRIWRTDQQDREGKPKMLQQIQVFAKRFPEEAVTA  320

Query  160   FAVNDDISQFAVGLKNGAVILFRTDLKRRSDR-PPHLLQPAGQYPVTGLEFTSKPVTNTA  218
             FAV+D++SQ++VGLKNGAVIL+R+D + R +R  P LLQPAGQ+PVTGL FT+KP+ N+ 
Sbjct  321   FAVSDEVSQWSVGLKNGAVILYRSDSRFRVERIDPILLQPAGQHPVTGLAFTTKPINNSL  380

Query  219   SHVFLYASTRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIA  278
             +HVFLYASTRRGLTCYHC  DD  +VK+ GT+G+PPR V LDERGVD  CSCVN+EGEIA
Sbjct  381   NHVFLYASTRRGLTCYHCNQDDQYIVKAVGTTGMPPRCVTLDERGVDFCCSCVNDEGEIA  440

Query  279   VGQTDAVYFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAF  338
             VGQ DAVYFYTT+D+SVCF F+GEKKYLHFFK YL+VAHVD RGRHQVNVYDLQNKFIAF
Sbjct  441   VGQPDAVYFYTTDDKSVCFAFDGEKKYLHFFKQYLIVAHVDSRGRHQVNVYDLQNKFIAF  500

Query  339   NWtlt-ntttkgstggRKLSVAPNNRA---PGARFGLDEMEEIRHVVCEFGAIFVVSSVG  394
             NWTLT +  ++ S    K  VA   ++   PGARFGLD+ME+I+H+V EFG+IFVVSS G
Sbjct  501   NWTLTHSVPSESSANVSKTMVARGKQSQPNPGARFGLDKMEQIQHIVSEFGSIFVVSSAG  560

Query  395   HVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGS  454
             HVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSI+DIFRMYGDHLYQKGDYDGS
Sbjct  561   HVYRLTEKDTTSKLEILFRKNLYSIAISLAFSSNYDINSIVDIFRMYGDHLYQKGDYDGS  620

Query  455   LRQYARTIGHVEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDV  514
             LRQY RTIGH+EPSYVIRRFLDAQRIHNLT YLEALHEKAFANAEHTTLLLNC+TKLKDV
Sbjct  621   LRQYTRTIGHLEPSYVIRRFLDAQRIHNLTNYLEALHEKAFANAEHTTLLLNCFTKLKDV  680

Query  515   KKLDKFIQLDEIIDGKKGDLSGDLLIANGSSSGDRKVSHsgqdglsggadggkkragaaa  574
             KKLD FIQL+   DG          +A G +S                            
Sbjct  681   KKLDAFIQLE---DGN---------VAGGHTS----------------------------  700

Query  575   LNFDIETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERV  634
             LNFD+ETAISVLWE YPQHALTLA+KHEEHSWYLKIQLD+ISYVES+ S  LS  EKERV
Sbjct  701   LNFDVETAISVLWEMYPQHALTLARKHEEHSWYLKIQLDQISYVESDGSTTLSGAEKERV  760

Query  635   ADALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDF  694
              DAL+YI+HLSF+EAD+NLRKYGRTLVTHLPGPTTELLK+LCTGKFVP    LKS+P DF
Sbjct  761   IDALKYIEHLSFAEADANLRKYGRTLVTHLPGPTTELLKRLCTGKFVPEKPELKSNPADF  820

Query  695   LHLFVSHRAQLKEFLQYIVEVETVSNTSIGNTLLEMVLSG-SADETRSEEEVEDAVMAIL  753
             LHLFVSHRAQL+EFLQYIVEVET+++ SIGNTLLEMVL+   ++E+ + +  EDAVMAIL
Sbjct  821   LHLFVSHRAQLREFLQYIVEVETITDPSIGNTLLEMVLTDEGSEESPNTDRKEDAVMAIL  880

Query  754   DNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGE  813
             DNPRV+YDEDHALIHLQM G++KGKRYL+NKLHMYHMLVQ HIEENDDQSII+EVRKHG+
Sbjct  881   DNPRVRYDEDHALIHLQMHGMRKGKRYLFNKLHMYHMLVQHHIEENDDQSIIEEVRKHGD  940

Query  814   KDPNLWSLALKYFAERGPLPKGATS-----GEEWKELKQLLVLIDSNPVIpplqvvqvls  868
             KDPNLWSLALKYFAERGPLPK A+       EEWKEL+QLL +ID+NPVIPPLQVVQVLS
Sbjct  941   KDPNLWSLALKYFAERGPLPKNASKSSKSSTEEWKELRQLLSMIDTNPVIPPLQVVQVLS  1000

Query  869   qsRELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATK  928
             Q+R+LP+SV+K YI+NQL ++++ IE D+EKI+AFK+DT+QMKEEI+QL  KA+VFQATK
Sbjct  1001  QARDLPLSVIKPYILNQLSHNQELIESDEEKIRAFKADTRQMKEEISQLNSKAIVFQATK  1060

Query  929   CDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQF  988
             CDLCNHDLDLPAVHFMCQHSFHLNCISET+REC+TCS++HRHI+GLKTQL+QKAGNHEQF
Sbjct  1061  CDLCNHDLDLPAVHFMCQHSFHLNCISETDRECMTCSVEHRHILGLKTQLDQKAGNHEQF  1120

Query  989   FNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             +NQLET+ DGF TIAEYFGKGIFK NE+PVDD +FD +   +F
Sbjct  1121  YNQLETSMDGFETIAEYFGKGIFKRNEIPVDDPAFDFQSGVDF  1163

>SDRG_14094
Length=1003

 Score = 1271 bits (3288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/1065 (63%), Positives = 796/1065 (75%), Gaps = 96/1065 (9%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRF FFD++ LKD NG WL+GVD+T MS NRG++ VGDA G IH+ANRQLETR F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTG-  119
             AH+HFVSHVVMMK++N+LVSIGDG D R  +L   SKAVAEA R+    +E      TG 
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYTSTGS  120

Query  120   --KTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177
                +TA+V++WRTDQQDR+GKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  178   VILFRTDLKRRSDR-----PPHLLQPAGQYPVTGLEFTSKPV-------TNTASHVFLYA  225
             +ILFR+++KRR+       PP LLQ A   PVT L F  KP        T+T + ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  226   STRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAV  285
             +T+RGLTCYHC  DD   VKS  +  L PR+VVLDERGV  +C CVN++G++ +GQTDAV
Sbjct  240   ATKRGLTCYHC--DD---VKSKNS--LMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAV  292

Query  286   YFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltnt  345
             YFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LTNT
Sbjct  293   YFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNT  352

Query  346   ttkgstggRKLSVAPNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTT  405
                     + L  A +      RFG +E+EEIRHVV EFGA+FVV+S G VYRL+EKDT 
Sbjct  353   A-------KALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVYRLSEKDTA  405

Query  406   SKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHV  465
             SKL ILF KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGDYDGSLRQYARTIGHV
Sbjct  406   SKLSILFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGHV  465

Query  466   EPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE  525
             EPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D+
Sbjct  466   EPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLIDD  525

Query  526   IIDGKKGDLSGDLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISV  585
                             +GS++ +                         AL FD+ETA++V
Sbjct  526   ----------------DGSNAKE---------------------GTPQALTFDVETALTV  548

Query  586   LWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLS  645
             L ENYPQHAL LA+KH EHSWYLKIQLDRIS         LS  E  RVADAL+YI+ LS
Sbjct  549   LRENYPQHALALARKHAEHSWYLKIQLDRISDT-------LSDAEHARVADALDYIRGLS  601

Query  646   FSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQL  705
             F+EAD NLRKYGRTLVTHLPGPTTELL+QLCTG+F       KSDPGDFLHLFVSHR QL
Sbjct  602   FAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQL  660

Query  706   KEFLQYIVEVETVSNTSIGNTLLEMVLSGS------ADETRSEEEV---------EDAVM  750
             +EFL+YIV+VE+VSNTSIGNTLLEMVL+ +       D+   E EV         E AV+
Sbjct  661   REFLEYIVQVESVSNTSIGNTLLEMVLNDTHKRDVPKDDDSEEPEVHEAPSPVTTEAAVL  720

Query  751   AILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRK  810
             ++LDNPRVKYDEDHALI +QM G+K+GKRYLY KLHMYHML+Q H+EE +D ++++ V++
Sbjct  721   SLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVKQ  780

Query  811   HGEKDPNLWSLALKYFAERGPLPKGAT--SGEEWKELKQLLVLIDSNPV--Ipplqvvqv  866
               + D NLW LAL+YFAERGP PKG++  S +EW ELKQLL L+D  P   IPPLQVV +
Sbjct  781   --QTDSNLWLLALRYFAERGPYPKGSSVRSTDEWSELKQLLALVDVTPTLQIPPLQVVSI  838

Query  867   lsqsRELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQA  926
             LSQSRE+P+SV++ Y+V+QL  D+  I+ D ++IK +K DT +M+ ++A L  KA+VFQA
Sbjct  839   LSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMAGLSSKAMVFQA  898

Query  927   TKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHE  986
             TKCDLC+HDLDLP VHFMC HSFH NCISETERECITC+ +HRH++ LK  LE KAGNHE
Sbjct  899   TKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNHE  958

Query  987   QFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             QFFNQLETAADGF+TIAEYFGKGIFKS        S   RFS E 
Sbjct  959   QFFNQLETAADGFNTIAEYFGKGIFKSEAAVDRRPSGVPRFSNEL  1003

>H310_11729
Length=1002

 Score = 1249 bits (3231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/1066 (62%), Positives = 799/1066 (75%), Gaps = 99/1066 (9%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFF+KE LKD NGLWL+G+D+TSMS NRG++ +GDA G IHLANRQLETR F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHLANRQLETRAFR  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRS-ANSVEEMYASKQTG  119
             AHEHFVSHV+MMK++N+LVSIGDG D R  +L   SKAVAEA R+ A   E+++ S  + 
Sbjct  61    AHEHFVSHVIMMKKANLLVSIGDGKDPRDPDLIKASKAVAEASRTQAQQDEQLFTSSDSR  120

Query  120   KTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVI  179
              +TA+V++WRTDQQDRDGKPKLLQQI +F+K + EEAVTAFAV+DD+SQ A+GL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFSK-FAEEAVTAFAVSDDLSQIAIGLLNGAII  179

Query  180   LFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHD  239
             LFR+D KRRSD+PP LLQPA QYPVT L F +K      + + LYA+T+RGLTCYHC  D
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATK-----VNILTLYAATKRGLTCYHC--D  232

Query  240   DPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             D +   +A  +G+P R+VVLDERGV  +C  V+E+G++AVGQ+DAVYFYT E+RSVCFGF
Sbjct  233   DASSKSNASNNGMP-RSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEERSVCFGF  291

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             EG+KKYL FFK YLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT             + A
Sbjct  292   EGDKKYLGFFKQYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLT-------------NTA  338

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
                   G RFG D  EEIRHVV EFGA+FV+SS+G+VYRL E DTTSKL+ILFRK+LYSI
Sbjct  339   KIGAGGGGRFGDDAAEEIRHVVSEFGAVFVLSSLGYVYRLMEIDTTSKLDILFRKHLYSI  398

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+ SIMDIFR YGDHLYQKGD+DGSLRQYARTIG+VEPSYVIR+FLDAQR
Sbjct  399   AISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQR  458

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539
             IHNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D   D +  D      
Sbjct  459   IHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLID---DEQTTD------  509

Query  540   IANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLAK  599
               +  ++ D +                  +     L FD+ETA++VL + YP HAL LAK
Sbjct  510   --DAPTTADTR------------------KQPKQQLTFDVETALTVLRDYYPTHALALAK  549

Query  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659
             KH EHSWYLKIQLDRI       S  LS  +  RV DAL YI+ LSF+EA+ NLRKYGRT
Sbjct  550   KHHEHSWYLKIQLDRIH------SETLSDADHARVQDALTYIEGLSFTEANLNLRKYGRT  603

Query  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719
             LVTH+PGPTTELLK LCTG+F   N G K+DP +FLHLFVSHRAQL+EFL+YIV VETV+
Sbjct  604   LVTHVPGPTTELLKALCTGRFHDSN-GEKADPANFLHLFVSHRAQLREFLEYIVHVETVA  662

Query  720   NTSIGNTLLEMVLS-------------------------GSADETRSEEEVEDAVMAILD  754
             N  IGNTLLEMVLS                         G    + S  + E AV+A+LD
Sbjct  663   NPQIGNTLLEMVLSDVGRGGPNAAVDELDEEHDEGGRAPGGGTASTSAAKNESAVLALLD  722

Query  755   NPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEK  814
             NPRVKYDEDHALI +QM G+K+GKRYLY KLHMYHMLVQ H+EE D+ +++++V++HGE 
Sbjct  723   NPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLVQHHMEEGDNVAVLEQVKQHGES  782

Query  815   DPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLVLIDSNP---VIpplqvvqvlsqsR  871
             +PNLW LALKYF+E+        +   +  L+ LL  +DS+     IPPLQVV +LSQ+R
Sbjct  783   NPNLWLLALKYFSEK------KDNDPTYTHLQTLLSWMDSSSKSLQIPPLQVVAILSQAR  836

Query  872   ELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDL  931
             +LP+SV++QY+VNQL  D+  I++++++IK FK DT +M+ ++  L  KA+VFQATKCDL
Sbjct  837   DLPLSVVRQYVVNQLKQDQIHIDKENDEIKKFKQDTAKMRAQLTTLSSKAMVFQATKCDL  896

Query  932   CNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQ  991
             C+HDLDLP VHFMC HSFH NCISET+REC+TC  +HRH + LKT LE KA NHE FFNQ
Sbjct  897   CSHDLDLPVVHFMCGHSFHQNCISETDRECMTCGPEHRHFVALKTSLETKASNHELFFNQ  956

Query  992   LETAADGFHTIAEYFGKGIFKSNEVPV------DDGSFDMRFSAEF  1031
             LE+A DGF+TIAEYFGKGIFK+++  +      D+ + + RFS E+
Sbjct  957   LESATDGFNTIAEYFGKGIFKADDPMMAQLGLGDEHASEARFSNEY  1002

>H257_12787
Length=968

 Score = 1244 bits (3220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/1056 (62%), Positives = 792/1056 (75%), Gaps = 113/1056 (11%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRFAFF+KE LKD NGLWL+G+D+TSMS NRG++ +GDA G IH+ANRQLETR F+
Sbjct  1     MAQWRRFAFFEKELLKDQNGLWLRGIDVTSMSGNRGLLVIGDASGLIHMANRQLETRAFR  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRS-ANSVEEMYASKQTG  119
             AH+HFVSHV+MMK++N+LVSIGDG D R  EL   SKA+A+A R+ A   E+++ +  + 
Sbjct  61    AHDHFVSHVIMMKKANLLVSIGDGKDPRDPELIKASKAIADASRTQAQQDEQLFTASDSQ  120

Query  120   KTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVI  179
              +TA+V++WRTDQQDRDGKPKLLQQI +FAK +PEEAVTAF+V+DD++Q AVGL NGA+I
Sbjct  121   GSTALVKIWRTDQQDRDGKPKLLQQIKIFAK-FPEEAVTAFSVSDDLAQIAVGLLNGAII  179

Query  180   LFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHD  239
             LFR+D KRRSD+PP LLQPA QYPVT L F +K    T     LYA+T+RGLTCYHC  D
Sbjct  180   LFRSDAKRRSDKPPLLLQPATQYPVTSLHFATKLNVPT-----LYAATKRGLTCYHC--D  232

Query  240   DPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
             D      +  SG  PR+VVLDERGV  +C  V+E+G++AVGQ+DAVYFYT EDRSVCFGF
Sbjct  233   D------SSRSGGMPRSVVLDERGVALHCGAVSEDGDMAVGQSDAVYFYTPEDRSVCFGF  286

Query  300   EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
             +G+KKYL FFK YLLVAHVDPRGRHQVN+YDLQNKFIAFNWTLT             + A
Sbjct  287   DGDKKYLGFFKQYLLVAHVDPRGRHQVNLYDLQNKFIAFNWTLT-------------NTA  333

Query  360   PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
                   G RFG D  EEIRHVV EFGA+FV SS+G+VYRL E DTTSKL+ILFRK+LYSI
Sbjct  334   KGGGGGGGRFGDDAAEEIRHVVSEFGAVFVQSSLGYVYRLLEVDTTSKLDILFRKHLYSI  393

Query  420   AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
             AISLAFSSNYD+ SIMDIFR YGDHLYQKGD+DGSLRQYARTIG+VEPSYVIR+FLDAQR
Sbjct  394   AISLAFSSNYDLTSIMDIFRAYGDHLYQKGDFDGSLRQYARTIGYVEPSYVIRQFLDAQR  453

Query  480   IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539
             IHNLT YLEALH KAFA +EHTTLLLNCYTKLKDVKKLD F+ +D+    KK  L+    
Sbjct  454   IHNLTTYLEALHAKAFATSEHTTLLLNCYTKLKDVKKLDSFLLIDDDPKEKKQPLT----  509

Query  540   IANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLAK  599
                                                  FD+ETA++VL +NYP HALTLAK
Sbjct  510   -------------------------------------FDVETALTVLRDNYPTHALTLAK  532

Query  600   KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLRKYGRT  659
             KH EHSWYLKIQLDRI       S  LS  ++ RV DAL YI+ LSF EA+ NLRKYGRT
Sbjct  533   KHHEHSWYLKIQLDRIH------SETLSESDQARVLDALTYIEGLSFGEANLNLRKYGRT  586

Query  660   LVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQLKEFLQYIVEVETVS  719
             LVTH+PGPTTELLK LCTG+F   ++  K+DP +FLHLFVSHRAQL+EFL+YIV+VETV+
Sbjct  587   LVTHVPGPTTELLKALCTGRF--HDSTDKADPANFLHLFVSHRAQLREFLEYIVDVETVA  644

Query  720   NTSIGNTLLEMVLS--GSADETRSEEEVED----------AVMAILDNPRVKYDEDHALI  767
             N  IGNTLLEMVL   G +  T +EE+ ED          AV+A+LDNPRVKYDEDHALI
Sbjct  645   NPQIGNTLLEMVLGDVGRSPAT-AEEDAEDKPIIMATNEAAVLALLDNPRVKYDEDHALI  703

Query  768   HLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFA  827
              +QM G+K+GKRYLY KLHMYHML+Q H+EE DD +++D+V++HGE +PNLW LALKYF+
Sbjct  704   LMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGDDLAVLDQVKQHGESNPNLWLLALKYFS  763

Query  828   ERGPLPKGATSGEEWKELKQLLV-LIDSN---PVIpplqvvqvlsqsRELPVSVLKQYIV  883
             ++          ++   L+ LL  ++D++   P IPPLQVV +LSQ+R+LP+SV++ Y+V
Sbjct  764   DQ----------KDPGHLQTLLSWMMDTSVPAPPIPPLQVVAILSQARDLPLSVVRPYVV  813

Query  884   NQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHF  943
             +QL  D+  I+++  +IK F+ DT +M+ ++  L  KA+VFQATKCDLC+HDLDLP VHF
Sbjct  814   SQLKQDQAHIDKEKGEIKKFQQDTAKMRAQVTALSSKAMVFQATKCDLCSHDLDLPVVHF  873

Query  944   MCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIA  1003
             MC HSFH NCISET+REC+TC  +HRH + L++ L+ KA NHE FFNQLETA DGF+TIA
Sbjct  874   MCGHSFHQNCISETDRECMTCGPEHRHFVALQSSLQAKASNHELFFNQLETATDGFNTIA  933

Query  1004  EYFGKGIFKS--------NEVPVDDGSFDMRFSAEF  1031
             EYFGKGIFK         N V    GS + RFS E+
Sbjct  934   EYFGKGIFKPVDDDDDDENRVAESVGS-NERFSNEY  968

>SPRG_03282
Length=1004

 Score = 1239 bits (3205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/1066 (62%), Positives = 791/1066 (74%), Gaps = 97/1066 (9%)

Query  1     MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
             MAQWRRF FFD++ LKD NG WL+GVD+T MS NRG++ VGDA G IH+ANRQLETR F+
Sbjct  1     MAQWRRFNFFDRDLLKDGNGNWLRGVDVTCMSGNRGLLIVGDAQGQIHMANRQLETRAFR  60

Query  61    AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEE--MYASKQT  118
             AH+HFVSHVVMMK++N+LVSIGDG D R  +L   SKAVAEA R+    +E  MYAS  +
Sbjct  61    AHDHFVSHVVMMKKTNVLVSIGDGKDPRDPDLIQSSKAVAEANRTQAQTDEQQMYASTGS  120

Query  119   GK-TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177
              + +TA+V++WRTDQQDR+GKPKL+ Q+ +FAK +PEEAVTAFAV++D SQ AVGL NGA
Sbjct  121   VQNSTALVKMWRTDQQDREGKPKLILQLKIFAK-FPEEAVTAFAVSEDASQIAVGLSNGA  179

Query  178   VILFRTDLKRRSDR-----PPHLLQPAGQYPVTGLEFTSKPV-------TNTASHVFLYA  225
             +ILFR+++KRR+       PP LLQ A   PVT L F  KP        T+T + ++LYA
Sbjct  180   IILFRSEMKRRAPGMSGGGPPLLLQSAINSPVTNLSFAMKPKPAAGPGKTSTENALYLYA  239

Query  226   STRRGLTCYHCTHDDPALVKSAGTSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAV  285
             +T+RGLTCYHC  DD   VKS  +  L PR+VVLDERGV  +C CVN++G++ +GQTDAV
Sbjct  240   ATKRGLTCYHC--DD---VKSKNS--LMPRSVVLDERGVALHCGCVNDDGDMCMGQTDAV  292

Query  286   YFYTTEDRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltnt  345
             YFYT EDR+ CFGFEG+KKYL FFKHYLLVAH D RGR+Q+N+YDLQNK IAFNW LTNT
Sbjct  293   YFYTPEDRTGCFGFEGDKKYLGFFKHYLLVAHADSRGRNQLNIYDLQNKCIAFNWILTNT  352

Query  346   ttkgstggRKLSVAPNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDT-  404
                     + L  A +      RFG +E+EEIRHVV EFGA+FVV+S G V    E++  
Sbjct  353   A-------KALPGASSRNVVATRFGYEEVEEIRHVVSEFGAVFVVTSFGSVCLPFEREGH  405

Query  405   TSKLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGH  464
               + +  F KNLY IAISLAFSSNYD++SIMDIFRMYGD LY KGDYDGSLRQYARTIGH
Sbjct  406   RVQAQHSFDKNLYPIAISLAFSSNYDLSSIMDIFRMYGDFLYNKGDYDGSLRQYARTIGH  465

Query  465   VEPSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLD  524
             VEPSYVIRRFLDAQRIHNLT YLE LH KAFA AEHTTLLLNCYTKLKDVKKLD F+ +D
Sbjct  466   VEPSYVIRRFLDAQRIHNLTTYLETLHTKAFATAEHTTLLLNCYTKLKDVKKLDAFLLID  525

Query  525   EIIDGKKGDLSGDLLIANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAIS  584
             +                +GSS+ +                         AL FD+ETA++
Sbjct  526   D----------------DGSSAKE---------------------GTPQALTFDVETALT  548

Query  585   VLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHL  644
             VL ENYPQHAL LAKKH EHSWYLKIQLDRIS         LS  E  RVADAL+YI+ L
Sbjct  549   VLRENYPQHALALAKKHGEHSWYLKIQLDRISDT-------LSDAEHARVADALDYIRGL  601

Query  645   SFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKFVPGNAGLKSDPGDFLHLFVSHRAQ  704
             SF+EAD NLRKYGRTLVTHLPGPTTELL+QLCTG+F       KSDPGDFLHLFVSHR Q
Sbjct  602   SFAEADMNLRKYGRTLVTHLPGPTTELLQQLCTGRF-SATTNAKSDPGDFLHLFVSHRTQ  660

Query  705   LKEFLQYIVEVETVSNTSIGNTLLEMVLSGS------ADETRSEEEV---------EDAV  749
             L++FL+YIV+VE+VSNTSIGNTLLEMVL+ +       D+   E EV         E AV
Sbjct  661   LRDFLEYIVQVESVSNTSIGNTLLEMVLNDTHKREVPKDDEGDEPEVTEAPSPVTTEAAV  720

Query  750   MAILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEENDDQSIIDEVR  809
             +++LDNPRVKYDEDHALI +QM G+K+GKRYLY KLHMYHML+Q H+EE +D ++++ V+
Sbjct  721   LSLLDNPRVKYDEDHALILMQMHGLKQGKRYLYQKLHMYHMLLQHHMEEGEDAAVLELVK  780

Query  810   KHGEKDPNLWSLALKYFAERGPLPKGAT--SGEEWKELKQLLVLIDSNPV--Ipplqvvq  865
             +  + D NLW LAL+YFAERGP PKGA+  S +EW ELKQLL L+D  P   IPPLQVV 
Sbjct  781   Q--QTDSNLWLLALRYFAERGPYPKGASARSTDEWSELKQLLALVDVTPTLQIPPLQVVS  838

Query  866   vlsqsRELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQ  925
             +LSQSRE+P+SV++ Y+V+QL  D+  I+ D ++IK +K DT +M+ ++  L  KA+VFQ
Sbjct  839   ILSQSREMPLSVVRPYVVSQLKKDQAHIDADSDEIKKYKQDTAKMRTQMTALSSKAMVFQ  898

Query  926   ATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNH  985
             ATKCDLC+HDLDLP VHFMC HSFH NCISETERECITC+ +HRH++ LK  LE KAGNH
Sbjct  899   ATKCDLCSHDLDLPVVHFMCGHSFHQNCISETERECITCAPEHRHLLSLKQSLEVKAGNH  958

Query  986   EQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             EQFFNQLETAADGF+TIAEYFGKGIFKS        S   RFS E 
Sbjct  959   EQFFNQLETAADGFNTIAEYFGKGIFKSEAALDRRPSGVARFSNEL  1004

>PYAR_24779
Length=699

 Score = 1099 bits (2843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/705 (79%), Positives = 605/705 (86%), Gaps = 34/705 (5%)

Query  1    MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
            MAQWRRFAFFDKE LKDANG W+KGVDIT+MSANRGMICVGDADGF+HLANRQLE RKF+
Sbjct  1    MAQWRRFAFFDKEVLKDANGDWMKGVDITAMSANRGMICVGDADGFVHLANRQLEMRKFR  60

Query  61   AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSA--NSVEEMYASKQT  118
            AHEHFVSH+VMMKRSN+LV+IGDGMD RSEELR QS+A+AEAGR++  N+ E+MYA+K T
Sbjct  61   AHEHFVSHIVMMKRSNVLVTIGDGMDPRSEELREQSRAIAEAGRASTGNASEDMYATKTT  120

Query  119  -GKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGA  177
             GK++A+VR+WRTDQQDRDG PKLLQQ+PVFAKKYPEEAVTAFAV+DDI QFAVGLKNGA
Sbjct  121  AGKSSAMVRIWRTDQQDRDGSPKLLQQMPVFAKKYPEEAVTAFAVSDDIGQFAVGLKNGA  180

Query  178  VILFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCT  237
            VILFR DLKR+ DRPPHLLQPAGQ+PVTGL FTSKPVT T +H FLYA+TRRGL+CYHC 
Sbjct  181  VILFRIDLKRKVDRPPHLLQPAGQFPVTGLSFTSKPVTATVAHSFLYAATRRGLSCYHCN  240

Query  238  HDDPALVKSAGTSG------LPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTE  291
            H+D ALVK+ G +       +PPRTVVLDERGVD N SCVN+EGE+AVGQ DAVYFYTTE
Sbjct  241  HEDQALVKAVGQAAAAGGGGMPPRTVVLDERGVDLNASCVNDEGELAVGQVDAVYFYTTE  300

Query  292  DRSVCFGFEGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltnttt----  347
            DRSVCFGFEGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNW+LT        
Sbjct  301  DRSVCFGFEGEKKYLQFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWSLTQMARRPGG  360

Query  348  -kgstggRKLSVAPNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTS  406
              G +G R+ +   N RAPGARFGLD+MEEIRHVVCEFGAIFVVSSVG VYRLTEKDTTS
Sbjct  361  GVGPSGTRRTASVSNARAPGARFGLDDMEEIRHVVCEFGAIFVVSSVGCVYRLTEKDTTS  420

Query  407  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVE  466
            KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLY+KGD+DGSLRQY RTIGHVE
Sbjct  421  KLEILFRKNLYSIAISLAFSSNYDINSIMDIFRMYGDHLYEKGDFDGSLRQYVRTIGHVE  480

Query  467  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEI  526
            PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+
Sbjct  481  PSYVIRRFLDAQRIHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEL  540

Query  527  IDGKKGDLSGD-----------LLIANGSSSGDRKVSHsgqdglsggadggkkragaaaL  575
            +D  K + +             L   NG  +   + S         G+ G         +
Sbjct  541  VDANKLNGAAGGDAGATANGKALAKTNGGDNAHPRPSEQEGQIAKPGSGG---------M  591

Query  576  NFDIETAISVLWENYPQHALTLAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVA  635
            NFDIETAISVLWENYP HAL LAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVA
Sbjct  592  NFDIETAISVLWENYPTHALILAKKHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVA  651

Query  636  DALEYIKHLSFSEADSNLRKYGRTLVTHLPGPTTELLKQLCTGKF  680
            DALEYI+HLSFSEAD+NLRKYGRTLVTHLPGPTT+LLK+LCTG F
Sbjct  652  DALEYIQHLSFSEADANLRKYGRTLVTHLPGPTTDLLKRLCTGTF  696

>PHYKE_6407
Length=934

 Score = 1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/655 (84%), Positives = 590/655 (90%), Gaps = 25/655 (4%)

Query  1    MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
            MAQWRRFAFFDKE LKDANG W+KGVDITSMSANRG+ICVGDADGF+HL+NR LE RKFQ
Sbjct  1    MAQWRRFAFFDKEVLKDANGPWMKGVDITSMSANRGLICVGDADGFVHLSNRSLEARKFQ  60

Query  61   AHEHFVSHVVMMKRSNILVSIGDGMDHRSEELRAQSKAVAEAGRSANSVEEMYASKQTGK  120
            AHE FVSHVVMM+RSN+LV+IGDG+D RSEELRAQSKA+AEAGR+ N+ E+MY SK +GK
Sbjct  61   AHELFVSHVVMMQRSNVLVTIGDGIDPRSEELRAQSKAIAEAGRAPNA-EDMYTSKPSGK  119

Query  121  TTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAVIL  180
            +TAVVR WRTDQQDR+GKPKLLQQIP+FAKKYPEEAVTAFAVNDD+SQFAVGLKNGAVIL
Sbjct  120  STAVVRFWRTDQQDREGKPKLLQQIPIFAKKYPEEAVTAFAVNDDLSQFAVGLKNGAVIL  179

Query  181  FRTDLKRRSDRPPHLLQPAGQYPVTGLEFTSKPVTNTASHVFLYASTRRGLTCYHCTHDD  240
            FR+DLKRR+DRPPHLLQPAGQYPVTGL FTSKPVT + SHVFLYASTRRGLTCYHC+HDD
Sbjct  180  FRSDLKRRTDRPPHLLQPAGQYPVTGLSFTSKPVTASVSHVFLYASTRRGLTCYHCSHDD  239

Query  241  PALVKSAG-TSGLPPRTVVLDERGVDTNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299
            PALVKSAG  + LPPRT VLDERGVD NCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF
Sbjct  240  PALVKSAGGAAALPPRTTVLDERGVDMNCSCVNEEGEIAVGQTDAVYFYTTEDRSVCFGF  299

Query  300  EGEKKYLHFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWtltntttkgstggRKLSVA  359
            EGEKKYL FFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNT++K     RK  +A
Sbjct  300  EGEKKYLCFFKHYLLVAHVDPRGRHQVNVYDLQNKFIAFNWTLTNTSSKAGM--RKPPLA  357

Query  360  PNNRAPGARFGLDEMEEIRHVVCEFGAIFVVSSVGHVYRLTEKDTTSKLEILFRKNLYSI  419
             N RAPGARFGLDEMEE+RHVVCEFGAIFVVSS+GHVYRL+EKDTTSKLEILFRKNLYSI
Sbjct  358  ANARAPGARFGLDEMEEVRHVVCEFGAIFVVSSMGHVYRLSEKDTTSKLEILFRKNLYSI  417

Query  420  AISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIGHVEPSYVIRRFLDAQR  479
            AISLAFSSNYD+NSI+DIFRMYGDHLYQKGDYDGSLRQY RTIGHVEPSYVIRRFLDAQR
Sbjct  418  AISLAFSSNYDVNSIIDIFRMYGDHLYQKGDYDGSLRQYVRTIGHVEPSYVIRRFLDAQR  477

Query  480  IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEIIDGKKGDLSGDLL  539
            IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDE+ID KK        
Sbjct  478  IHNLTAYLEALHEKAFANAEHTTLLLNCYTKLKDVKKLDKFIQLDEVIDAKK--------  529

Query  540  IANGSSSGDRKVSHsgqdglsggadggkkragaaaLNFDIETAISVLWENYPQHALTLAK  599
              NG+ SG            S       + AGA+ LNFD+ETAISVLWENYPQHALTLAK
Sbjct  530  -TNGTKSG------------SDSGMTTPRGAGASNLNFDVETAISVLWENYPQHALTLAK  576

Query  600  KHEEHSWYLKIQLDRISYVESEDSVALSAHEKERVADALEYIKHLSFSEADSNLR  654
            KHEEHSWYLKIQLD ISYV+SEDSVALS +EKERVADALEYI+HLSFSEADSNLR
Sbjct  577  KHEEHSWYLKIQLDHISYVDSEDSVALSENEKERVADALEYIEHLSFSEADSNLR  631

 Score = 507 bits (1305),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 280/292 (96%), Gaps = 0/292 (0%)

Query  740   RSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKLHMYHMLVQFHIEEN  799
             RS EE E+AV+ ILDNPRVKYDEDHALIHLQM G+KKGKRYLYNKLHMYHMLVQFHIEEN
Sbjct  643   RSIEEKEEAVLRILDNPRVKYDEDHALIHLQMHGMKKGKRYLYNKLHMYHMLVQFHIEEN  702

Query  800   DDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLVLIDSNPVIp  859
             DDQSI++EVRKHG+KDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLL LID+NP IP
Sbjct  703   DDQSILEEVRKHGDKDPNLWSLALKYFAERGPLPKGATSGEEWKELKQLLALIDTNPAIP  762

Query  860   plqvvqvlsqsRELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGG  919
             PLQVVQVLSQSRELPVSV+KQY+VNQL +DEKKIEED+EKIKAFK DTKQMKEEIAQL  
Sbjct  763   PLQVVQVLSQSRELPVSVIKQYVVNQLASDEKKIEEDEEKIKAFKGDTKQMKEEIAQLSS  822

Query  920   KAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQLE  979
             +AVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET+RECITCSMDHRHI+GLKTQLE
Sbjct  823   RAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETDRECITCSMDHRHILGLKTQLE  882

Query  980   QKAGNHEQFFNQLETAADGFHTIAEYFGKGIFKSNEVPVDDGSFDMRFSAEF  1031
             QKAGNHEQF+NQLETAADGFHTIAEYFGKGIFKSNEV +D+GSF+ RFSAEF
Sbjct  883   QKAGNHEQFYNQLETAADGFHTIAEYFGKGIFKSNEVLLDEGSFEARFSAEF  934

>PYAR_24374
Length=325

 Score = 468 bits (1204),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/326 (76%), Positives = 276/326 (85%), Gaps = 25/326 (8%)

Query  730   MVLS--GSADET--RSEEEVEDAVMAILDNPRVKYDEDHALIHLQMRGVKKGKRYLYNKL  785
             MVLS  G +DE   R+  E EDAVMAILDNPRV+YDEDHALIHLQM G+KKGKRYLYNKL
Sbjct  1     MVLSADGESDEAKERTVAEKEDAVMAILDNPRVRYDEDHALIHLQMHGMKKGKRYLYNKL  60

Query  786   HMYHMLVQFHIEENDDQSIIDEVRKHGEKDPNLWSLALKYFAERGPLPKGATSGEEWKEL  845
             H+YHMLVQFHIEENDD SIIDEVRKHG+KDPNLWSLALKYFAERGPLPKG  +GEEW +L
Sbjct  61    HLYHMLVQFHIEENDDSSIIDEVRKHGDKDPNLWSLALKYFAERGPLPKGVKTGEEWHDL  120

Query  846   KQLLVLIDSNPVI-----------------pplqvvqvlsqsRELPVSVLKQYIVNQLLN  888
             KQLL LID+NP I                   ++   VLSQSRELPV+V+KQYIVNQLL+
Sbjct  121   KQLLALIDTNPAIPPLHVVQVLSQSRELPVAVVKQYIVLSQSRELPVAVVKQYIVNQLLS  180

Query  889   dekkieeddekikAFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHS  948
             DE+KIEED++KIK +K+DTK+MKEEI +L  KAVVFQATKC+LCNHDLDLPAVHFMC+HS
Sbjct  181   DERKIEEDEDKIKTYKADTKKMKEEIGELNSKAVVFQATKCELCNHDLDLPAVHFMCKHS  240

Query  949   FHLNCISETERECITCSMDHRHIMGLKTQLEQKAGNHEQFFNQLETAADGFHTIAEYFGK  1008
             FHLNCISETERECITCS++HRHIMGLKTQLEQKAGNHEQF+NQLETAADGF TIAEYFGK
Sbjct  241   FHLNCISETERECITCSLEHRHIMGLKTQLEQKAGNHEQFYNQLETAADGFQTIAEYFGK  300

Query  1009  GIFKSNEVPV---DDGSFDMRFSAEF  1031
             GIFK+ E+     DDG+FD RFSAEF
Sbjct  301   GIFKT-EIASGDDDDGAFDHRFSAEF  325

>PYAP_19745
Length=725

 Score = 37.7 bits (86),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query  119  GKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFAVNDDISQFAVGLKNGAV  178
            G    VV  W T  Q R G    +           E  VTA   +DD   FAVG  NG  
Sbjct  196  GCEDGVVECWDTRSQSRVGVLDSVVGHCGGGVGDAEVGVTALEFDDDGLTFAVGTSNGHC  255

Query  179  ILFRTDLKRRSDRPPHLLQPAGQY--PVTGLEF--TSKPVTNTASHVF  222
            +L+  DL  RS +P  LLQ   QY  P+  ++F   S+ V +T + V 
Sbjct  256  LLY--DL--RSSKP--LLQKTHQYGLPIVDVKFHDYSRKVLSTDAKVI  297

>PYAP_13607
Length=270

 Score = 37.0 bits (84),  Expect = 0.50, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 0/38 (0%)

Query  927  TKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITC  964
            T C +C   +D P V   C H FH+ CI    R   TC
Sbjct  73   TSCVVCMETMDQPCVQLPCHHYFHVGCIEPWLRMHSTC  110

>PYIR_16790
Length=744

 Score = 37.4 bits (85),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 55/122 (45%), Gaps = 18/122 (15%)

Query  118  TGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFA--KKYPEEA---VTAFAVNDDISQFAVG  172
             G     V  W T  Q R G   +L  I  FA      +EA   VTA   +DD   F VG
Sbjct  195  VGCEDGTVECWDTRSQRRVG---ILDGISTFAGGPAGADEAPVQVTALEFDDDGLTFGVG  251

Query  173  LKNGAVILFRTDLKRRSDRPPHLLQPAGQY--PVTGLEF--TSKPVTNTASHVFLYASTR  228
              NG  +L+  DL  RS +P  LLQ + QY  P+  L+F   ++ V +T + V      R
Sbjct  252  TSNGHCLLY--DL--RSSKP--LLQKSHQYGLPIIDLKFHDYARKVISTDAKVIKIWDKR  305

Query  229  RG  230
             G
Sbjct  306  DG  307

>PYVX_13258
Length=646

 Score = 37.4 bits (85),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 74/171 (43%), Gaps = 30/171 (18%)

Query  91   ELRAQSKAVAEAGRSANSVEEMYASKQTGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAK  150
            +LR +++A    G   N V ++      G    VV  W T Q  R G+            
Sbjct  176  QLRPEAQAANVVG--LNPVHQLLG---VGCEDGVVECWDTRQATRVGE----------LD  220

Query  151  KYPEEAVTAFAVNDDISQFAVGLKNGAVILFRTDLKRRSDRPPHLLQPAGQY--PVTGLE  208
             +    VTA A +DD   FA G  +G V LF  DL  RS RP  LL    QY  P+  ++
Sbjct  221  AHSGSQVTALAFDDDGLTFATGSSDGIVKLF--DL--RSSRP--LLSKTHQYGLPIVNVQ  274

Query  209  F--TSKPVTNTASHVFLYASTRRG--LTCYHCTHD--DPALVKSA-GTSGL  252
            F   ++ V +T + V      R G  LT      D  D  +V+SA G SG+
Sbjct  275  FHDYARKVLSTDAKVIKIWDPRDGQALTNVETPADVNDVCVVESAQGQSGV  325

>PYVX_16007
Length=90

 Score = 33.9 bits (76),  Expect = 0.69, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query  929  CDLCNHDLDLP-AVHFMCQHSFHLNCISETERECITCSMDHRH  970
            C +C     +   V   C H FHL+CIS  ER  I     H H
Sbjct  43   CSICREPFGVKEQVILSCSHMFHLDCISSFERSDIIAYWHHNH  85

>H310_10523
Length=262

 Score = 36.2 bits (82),  Expect = 0.71, Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 30/64 (47%), Gaps = 1/64 (2%)

Query  902  AFKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLD-LPAVHFMCQHSFHLNCISETERE  960
            ++K  +  + E++A     A       C +C + LD    V   C+HS+H +CI +    
Sbjct  56   SYKPTSHSILEKLATWQVPATKLDDATCAVCMNSLDDATVVALPCKHSYHTDCIRQWLAR  115

Query  961  CITC  964
            C TC
Sbjct  116  CNTC  119

>H257_05049
Length=338

 Score = 36.2 bits (82),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 53/138 (38%), Gaps = 25/138 (18%)

Query  1    MAQWRRFAFFDKETLKDANGLWLKGVDITSMSANRGMICVGDADGFIHLANRQLETRKFQ  60
            M  W   A +  E L DA G     VD+T       +  VG  + F+    R +  R F 
Sbjct  49   MDSWPAMAKWTNEYLVDALGETQVTVDVTPFGYGDAVTTVGTENVFVMPEERSMAFRDFL  108

Query  61   AHEHFVSHVVMMKRSNILVSIGDG---MDHRSEELRAQSKAVAEAGRSANSVEEM--YAS  115
            A  H                  DG   + H+++ LR Q  A+ +       V+ M  +AS
Sbjct  109  AILH--------------DPCFDGVPYLSHQNDSLRDQFPALVD------DVDPMLAFAS  148

Query  116  KQTGKTTAVVRLWRTDQQ  133
            +  G T   V LW  D++
Sbjct  149  EAFGNTPEAVNLWIGDER  166

>PYU1_G011262
Length=730

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

Query  107  NSVEEMYASKQTGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEA-------VTA  159
            N + +M      G     V  W T  Q R G   +L  I  +A      +       VTA
Sbjct  187  NPIHQMLG---VGCEDGTVECWDTRSQRRVG---ILDGIVAYAGGVSASSFDEAPVQVTA  240

Query  160  FAVNDDISQFAVGLKNGAVILFRTDLKRRSDRPPHLLQPAGQY--PVTGLEF--TSKPVT  215
               +DD   F VG  NG  +L+  DL  RS +P  LLQ + QY  P+  L+F   SK V 
Sbjct  241  LEFDDDGLTFGVGTSNGHCMLY--DL--RSSKP--LLQKSHQYGLPIIDLKFHDYSKKVV  294

Query  216  NTASHVFLYASTRRG  230
            ++ + V      R G
Sbjct  295  SSDAKVIKIWDKRDG  309

>H257_03925
Length=290

 Score = 35.4 bits (80),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 28/62 (45%), Gaps = 6/62 (10%)

Query  924  FQATKCDLCNH---DLDL---PAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQ  977
             + T C +C     D+D    P  H  C H FHL+CI E  +   TC +  R +  ++  
Sbjct  133  IKTTSCAICWESCGDIDFCSSPPHHLPCGHGFHLSCIREWMKRDATCPLCRRALPSVQDT  192

Query  978  LE  979
             E
Sbjct  193  FE  194

>CCA20583
Length=365

 Score = 34.7 bits (78),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (7%)

Query  924  FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET---ERECITC  964
            FQ+ +C +C ++L        C H FHL CI E    +++C  C
Sbjct  102  FQSQECLICLNELQTNLAAVQCGHVFHLICIKEAFEYKKQCPVC  145

>PYAP_13333
Length=346

 Score = 34.7 bits (78),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (43%), Gaps = 13/82 (16%)

Query  127  LWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAF--------AVNDDISQFAVGLKNGAV  178
             WR  ++ ++ K   L   PV  K++PE   T          A+ D +   A+GL     
Sbjct  115  FWRMGERPKNTKFAELNAEPVIPKEFPEWETTMNMWGGKMLDAITDLVEMAAIGLG----  170

Query  179  ILFRTDLKRRSDRPPHLLQPAG  200
             L +  L +R    PHLL P G
Sbjct  171  -LEKDALSKRIQNAPHLLAPTG  191

>PYIW_24265
Length=283

 Score = 34.3 bits (77),  Expect = 3.1, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 41/89 (46%), Gaps = 9/89 (10%)

Query  600  KHEEHSWYLKIQ--LDRISYVESEDSVALS--AHEKERVADALEYIKHLSFSEADSNLRK  655
            KH+     LK+     R  +   +DS  LS   H   RV DA+EY KH S S AD+  R 
Sbjct  166  KHQRAVRALKLHNASPRFLFSCGDDSAVLSWDFHHGGRVRDAVEYDKHASASAADNGFRN  225

Query  656  YGRTLVTHLPGPTTELLKQLCTGKFVPGN  684
                 V H   P +  ++ +  G F+P N
Sbjct  226  S----VEHQQQPASLQVEHV-AGGFLPWN  249

>PHALS_11598
Length=1421

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 54/104 (52%), Gaps = 9/104 (9%)

Query  364  APGARFGLDEMEEIRHVVCEFGAIFVVSSV-GHVYRLTEKDTTSK--LEILFR------K  414
            A GA    D++  ++  V EFG  FV+SS+ G +Y+L E  +  K  ++ +F+      K
Sbjct  285  AVGAFLSSDDVNHLKAFVREFGLRFVLSSLEGRIYQLNEIVSAMKKGVKNVFKSWLRKPK  344

Query  415  NLYSIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQY  458
            +L    +S + + +Y  ++I    R+  D  +   DY+ +L+ Y
Sbjct  345  DLRMSNVSASGNVSYKSDAIESQTRLLADTAFLVRDYELALQMY  388

>SPRG_13639
Length=179

 Score = 33.5 bits (75),  Expect = 3.8, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query  927  TKCDLC-----NHDLDLPAV--HFMCQHSFHLNCISETERECITCSMDHRHI  971
            T+C +C       D ++P V     C H FH  CI+E      TC +   HI
Sbjct  111  TECSICLVPFSRDDFEVPGVVVETQCTHVFHQGCIAEWIETAATCPICRHHI  162

>PYAR_20912
Length=266

 Score = 33.9 bits (76),  Expect = 4.0, Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%)

Query  927  TKCDLCNHDLDLPAVHFMCQHSFHLNCIS---ETERECITC  964
            T C +C   +  P     CQH FH++CI    +    C TC
Sbjct  72   TNCVVCMETMREPCAKLPCQHHFHIHCIEPWLKLHSTCPTC  112

>PHYCA_123937
Length=287

 Score = 33.9 bits (76),  Expect = 4.4, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  925  QATKCDLCNHDLDL--PAVHFMCQHSFHLNCISE  956
            +A +C +C  ++D+  P++   CQH+FH  CI E
Sbjct  205  EALQCMICLEEVDVEPPSIVLPCQHTFHRECIFE  238

>SPRG_14870
Length=246

 Score = 33.9 bits (76),  Expect = 4.7, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 22/52 (42%), Gaps = 7/52 (13%)

Query  927  TKCDLC-----NHDLDLPAV--HFMCQHSFHLNCISETERECITCSMDHRHI  971
            T+C +C       D  LP V     C H FH  CI+E      TC +   HI
Sbjct  178  TECSICLVPFSRDDFHLPGVVVETQCTHVFHQGCIAEWIETAATCPICRHHI  229

>PYIR_17525
Length=1023

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 42/97 (43%), Gaps = 9/97 (9%)

Query  872  ELPVSVLKQYIVNQLLNdekkieeddekikAFKSDTKQMKEEIAQLGGKAV-VFQATKCD  930
            ++ +  LKQ +V+ + N   +        K F++D  Q+ +   +   KA  V   T+C 
Sbjct  857  DMEIDNLKQKLVDIIANYRIQQNLCTGCSKVFENDRVQLLQRQVKTHKKARRVSVKTQCL  916

Query  931  LCNHDLDLP--------AVHFMCQHSFHLNCISETER  959
            +CN  L  P           F C H +HL C+ E  R
Sbjct  917  ICNEVLRAPTSGKESFHVCVFECGHCYHLPCLEEKMR  953

>CCI42121
Length=582

 Score = 33.9 bits (76),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (7%)

Query  924  FQATKCDLCNHDLDLPAVHFMCQHSFHLNCISET---ERECITC  964
            FQ+ +C +C ++L        C H FHL CI E    + +C  C
Sbjct  227  FQSQECLICLNELQTNLATIQCGHVFHLICIKEALKYKEQCPIC  270

>PYAP_21787
Length=520

 Score = 33.9 bits (76),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  418  SIAISLAFSSNYDINSIMDIFRMYGDHLYQKGDYDGSLRQYARTIG  463
            S+  + +   +YD     DI R  G+  Y++GDY  +++ Y R++G
Sbjct  145  SVTTTSSAVKSYDGRPREDIEREEGNEHYKRGDYVAAIKSYTRSLG  190

>H310_07077
Length=301

 Score = 33.5 bits (75),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 25/62 (40%), Gaps = 6/62 (10%)

Query  924  FQATKCDLC------NHDLDLPAVHFMCQHSFHLNCISETERECITCSMDHRHIMGLKTQ  977
             Q T C +C      N      A H  C H FHL CI E  +   TC +  R +  ++  
Sbjct  143  IQTTSCSICWDSVTDNRGKCNAAHHLPCGHGFHLQCIREWMKRDSTCPLCRRSLPSVQDT  202

Query  978  LE  979
             E
Sbjct  203  FE  204

>SDRG_10146
Length=220

 Score = 33.1 bits (74),  Expect = 7.0, Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 0/51 (0%)

Query  914  IAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHSFHLNCISETERECITC  964
            +AQL    V      C +C   +D   +   CQH+FH  CI E      TC
Sbjct  65   LAQLPSWQVAASDDACVICMSPMDDDRIALPCQHAFHHTCIREWLSRRNTC  115

>H257_04916
Length=668

 Score = 33.5 bits (75),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query  929  CDLCNHDLDLPAVHFM---CQHSFHLNCISE---TERECITC  964
            C +C  +LDL A  +M   C H FH  C+ E    + EC TC
Sbjct  620  CVICMVELDLEARDYMIAPCDHVFHRPCLQEWMQVKMECPTC  661

>PYU1_G006110
Length=983

 Score = 33.5 bits (75),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (42%), Gaps = 2/110 (2%)

Query  102  AGRSANSVEEMYASKQTGKTTAVVRLWRTDQQDRDGKPKLLQQIPVFAKKYPEEAVTAFA  161
            + RS   +++++A         VV   R      D   KL +  P F    P  +V    
Sbjct  686  SARSGQEMDKVFAHSDGISAICVVGGNRFLTSSWDSTVKLWRYTPTFIVSSPVYSVLCLD  745

Query  162  VNDDISQFAVGLKNGAVILFRTDLKRRSDRPPHLLQPAGQYPVTGLEFTS  211
             + + +  A G +NG V LF  DL R + R    + P  +  V+ + FT+
Sbjct  746  TSPNGAFGAAGTRNGHVYLF--DLNRPAFRIDVFVSPTRRGDVSSISFTA  793

>PPTG_05364
Length=684

 Score = 33.5 bits (75),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 27/67 (40%), Gaps = 6/67 (9%)

Query  903  FKSDTKQMKEEIAQLGGKAVVFQATKCDLCNHDLDLPAVHFMCQHS---FHLNCISETER  959
            +     Q    IA  G   + F  + CD C H  D P   FM  +S    H+ C  ++  
Sbjct  72   YAGTPPQRASVIADTGSALMAFPCSGCDGCGHHTDQP---FMAANSSTLVHVTCAQKSFF  128

Query  960  ECITCSM  966
            +C  C +
Sbjct  129  QCKECKV  135

>PYVX_17912
Length=134

 Score = 31.6 bits (70),  Expect = 9.9, Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 16/39 (41%), Gaps = 3/39 (8%)

Query  929  CDLCNHDLDLPAVHFMCQHSFHLNCIS---ETERECITC  964
            C +C  + D P     C H FH  CI    +    C TC
Sbjct  31   CVVCMDEFDAPCAQLPCGHQFHPRCIEPWLKMHSTCPTC  69

Lambda      K        H        a         alpha
   0.320    0.135    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 86250730875

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40