Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_17028161701836183687990.0
PYIW_17750161701735184259260.0
PYU1_G001970161701794186448960.0
PPTG_10183161701760186139140.0
PYAR_17128161701766184338190.0
PHYRA_84730161701943185538140.0
PYAP_16577161701744183637210.0
PYVX_14623161701765187135200.0
PHYSO_46670516170147876218940.0
SPRG_05305161701658178918900.0
PITG_2062816170144978017310.0
PITG_210651645961372314740.0
PHYCA_1229821645961372314163e-176
PHALS_0519216170167278213965e-162
H257_0628016170174278610759e-119
H310_0923716170174879010527e-116
SDRG_066081617012457319151e-100
PITG_21066164604722526031e-66
CCA189001617015647734878e-48
CCI451281617018317294807e-47
PYIR_219797179228101821.4
H310_152421515757473751.5
SDRG_004627179190115774.5
PYIW_19954717917251757.0
PYIW_168709272898276788.5
PYVX_231378042348558778.6
PHYKE_106496002356122769.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_17028

Length=1836
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYIR_17028                                                            3393    0.0   
PYIW_17750                                                            2287    0.0   
PYU1_G001970                                                          1890    0.0   
PPTG_10183                                                            1512    0.0   
PYAR_17128                                                            1475    0.0   
PHYRA_84730                                                           1473    0.0   
PYAP_16577                                                            1437    0.0   
PYVX_14623                                                            1360    0.0   
PHYSO_466705                                                          734     0.0   
SPRG_05305                                                            732     0.0   
PITG_20628                                                            671     0.0   
PITG_21065                                                            572     0.0   
PHYCA_122982                                                          550     3e-176
PHALS_05192                                                           542     5e-162
H257_06280                                                            418     9e-119
H310_09237                                                            409     7e-116
SDRG_06608                                                            357     1e-100
PITG_21066                                                            236     1e-66 
CCA18900                                                              192     8e-48 
CCI45128                                                              189     7e-47 
PYIR_21979                                                            36.2    1.4   
H310_15242                                                            33.5    1.5   
SDRG_00462                                                            34.3    4.5   
PYIW_19954                                                            33.5    7.0   
PYIW_16870                                                            34.7    8.5   
PYVX_23137                                                            34.3    8.6   
PHYKE_10649                                                           33.9    9.3   

>PYIR_17028
Length=1836

 Score = 3393 bits (8799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1836/1836 (100%), Positives = 1836/1836 (100%), Gaps = 0/1836 (0%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHK  60
             MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHENGDNNGDDDDEYDDDDKATGQQHK
Sbjct  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHENGDNNGDDDDEYDDDDKATGQQHK  60

Query  61    QQSKSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGasdnsnnddass  120
             QQSKSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGASDNSNNDDASS
Sbjct  61    QQSKSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGASDNSNNDDASS  120

Query  121   canGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRL  180
             CANGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRL
Sbjct  121   CANGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRL  180

Query  181   KATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRK  240
             KATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRK
Sbjct  181   KATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRK  240

Query  241   GLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNA  300
             GLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNA
Sbjct  241   GLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNA  300

Query  301   RLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAY  360
             RLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAY
Sbjct  301   RLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAY  360

Query  361   LKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALR  420
             LKQLEDAKAELSSEKAKAILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALR
Sbjct  361   LKQLEDAKAELSSEKAKAILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALR  420

Query  421   LEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYL  480
             LEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYL
Sbjct  421   LEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYL  480

Query  481   CNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQ  540
             CNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQ
Sbjct  481   CNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQ  540

Query  541   MVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNV  600
             MVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNV
Sbjct  541   MVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNV  600

Query  601   SAGAVSGKALPSRSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppksktsEFSQT  660
             SAGAVSGKALPSRSSASRSGLVTTASSAGPTPTMETSLSSTSFSSSNSPPKSKTSEFSQT
Sbjct  601   SAGAVSGKALPSRSSASRSGLVTTASSAGPTPTMETSLSSTSFSSSNSPPKSKTSEFSQT  660

Query  661   AAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAEC  720
             AAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAEC
Sbjct  661   AAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAEC  720

Query  721   EELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLS  780
             EELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLS
Sbjct  721   EELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLS  780

Query  781   VMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMY  840
             VMDLLDALKDDDEEKLAAFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMY
Sbjct  781   VMDLLDALKDDDEEKLAAFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMY  840

Query  841   HRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVN  900
             HRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVN
Sbjct  841   HRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVN  900

Query  901   PPPPASEIEEEGERVENPQEggvaatatitagggsgvtPRSEPVPAHPEKPQKTGKQTDA  960
             PPPPASEIEEEGERVENPQEGGVAATATITAGGGSGVTPRSEPVPAHPEKPQKTGKQTDA
Sbjct  901   PPPPASEIEEEGERVENPQEGGVAATATITAGGGSGVTPRSEPVPAHPEKPQKTGKQTDA  960

Query  961   SPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPESSAPDAELp  1020
             SPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPESSAPDAELP
Sbjct  961   SPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPESSAPDAELP  1020

Query  1021  teppvvppqpSISAGEPEAGSVDEETlalaarqqlqqnqVMEKVTVEFLRLEIPVSVMEH  1080
             TEPPVVPPQPSISAGEPEAGSVDEETLALAARQQLQQNQVMEKVTVEFLRLEIPVSVMEH
Sbjct  1021  TEPPVVPPQPSISAGEPEAGSVDEETLALAARQQLQQNQVMEKVTVEFLRLEIPVSVMEH  1080

Query  1081  MLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSGRLGVQIYQP  1140
             MLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSGRLGVQIYQP
Sbjct  1081  MLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSGRLGVQIYQP  1140

Query  1141  RMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISCQAQLPMQTS  1200
             RMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISCQAQLPMQTS
Sbjct  1141  RMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISCQAQLPMQTS  1200

Query  1201  LAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLRACTSQLFPDLT  1260
             LAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLRACTSQLFPDLT
Sbjct  1201  LAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLRACTSQLFPDLT  1260

Query  1261  SCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQNQVVQLAQSFKAR  1320
             SCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQNQVVQLAQSFKAR
Sbjct  1261  SCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQNQVVQLAQSFKAR  1320

Query  1321  YQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMVETNEPK  1380
             YQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMVETNEPK
Sbjct  1321  YQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMVETNEPK  1380

Query  1381  KSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQLELTPVEFdps  1440
             KSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQLELTPVEFDPS
Sbjct  1381  KSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQLELTPVEFDPS  1440

Query  1441  ggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNFVQEVSAKCREDTRQIYQQEGK  1500
             GGGGADGSGDSVLRDRDVVDEQDMSPSSSLSSNALFLNFVQEVSAKCREDTRQIYQQEGK
Sbjct  1441  GGGGADGSGDSVLRDRDVVDEQDMSPSSSLSSNALFLNFVQEVSAKCREDTRQIYQQEGK  1500

Query  1501  LEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLALAPESALGDFLKR  1560
             LEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLALAPESALGDFLKR
Sbjct  1501  LEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLALAPESALGDFLKR  1560

Query  1561  SKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQALSDREVSRSQQ  1620
             SKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQALSDREVSRSQQ
Sbjct  1561  SKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQALSDREVSRSQQ  1620

Query  1621  TVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDLKPFSGEELPklk  1680
             TVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDLKPFSGEELPKLK
Sbjct  1621  TVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDLKPFSGEELPKLK  1680

Query  1681  rkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEA  1740
             RKSLKRLRKVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEA
Sbjct  1681  RKSLKRLRKVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEA  1740

Query  1741  QQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHRSLVSARDTAYAAYMA  1800
             QQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHRSLVSARDTAYAAYMA
Sbjct  1741  QQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHRSLVSARDTAYAAYMA  1800

Query  1801  FCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATMHD  1836
             FCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATMHD
Sbjct  1801  FCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATMHD  1836

>PYIW_17750
Length=1735

 Score = 2287 bits (5926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1241/1842 (67%), Positives = 1432/1842 (78%), Gaps = 113/1842 (6%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQ--RAHengdnngddddeyddddKATGQQ  58
             MALKSRAEVQLLQVLNQNKAK+VS YLKEQQQ  R   N  +    D + DD+++     
Sbjct  1     MALKSRAEVQLLQVLNQNKAKTVSFYLKEQQQKVRNSTNSADGNSSDLDSDDNNEDASAS  60

Query  59    HKQQSKSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGasdnsnndda  118
             H + SK H    GDLAQ+R+ NRKD RPVR+EDE++AQVRQLQD FYIVG + NS+N+ +
Sbjct  61    HNKHSKKH---SGDLAQYRRGNRKDARPVRDEDEMIAQVRQLQDKFYIVGDASNSSNNTS  117

Query  119   sscanGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDS  178
             +      ++ IE+NAI RRDKHMAAQ  YTE VKR+SEDIESAII CADA+KDAL   D+
Sbjct  118   ADQE---RTQIELNAITRRDKHMAAQQTYTEHVKRVSEDIESAIIACADAIKDALVHIDA  174

Query  179   RLKATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRV  238
             RL+  S SL DDVLLL ++N+D+LRMW  EM+AIC+QRT+Q+A+FAQ+LD IELTRT+RV
Sbjct  175   RLQTVSRSLEDDVLLLTSTNEDILRMWTVEMDAICSQRTQQLASFAQQLDAIELTRTQRV  234

Query  239   RKGLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFV  298
             R+GL +LT                     AYELN VV SNRKVYADLVARMATADVD   
Sbjct  235   REGLERLTA--------------------AYELNAVVISNRKVYADLVARMATADVD---  271

Query  299   NARLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRL  358
                                        +LNS LFTDPDERR++L EI ++QE +HN +RL
Sbjct  272   --------------------------RVLNSQLFTDPDERREVLNEIRVHQERVHNNQRL  305

Query  359   AYLKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREA  418
              +LKQLEDA+AEL+S+KA+ +L  ISTTQ +EE++NH FFE+LM VHV K  +AQ LRE 
Sbjct  306   TFLKQLEDAQAELTSKKAREVLSRISTTQHDEESENHAFFERLMGVHVRKAGDAQMLREE  365

Query  419   LRLEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELI  478
             LRLE+HGFGAMA+EGEIELCQS LATL++  SLEEFFRM GGLRGELD+VVKRL I+ELI
Sbjct  366   LRLEVHGFGAMAREGEIELCQSTLATLVSATSLEEFFRMAGGLRGELDAVVKRLKIAELI  425

Query  479   YLCNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQ  538
             Y CNLQPLT SLQV+L ALPLEEVMET GKGAERKALQATLEKIRKAGKHEILPLLP+LQ
Sbjct  426   YSCNLQPLTASLQVVLCALPLEEVMETHGKGAERKALQATLEKIRKAGKHEILPLLPALQ  485

Query  539   TQMVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPT  598
              QM  LSNLNDMSEEFK+ELE+I  QLDQL+QEYGL     T+ E SS + +++GA   T
Sbjct  486   AQMAVLSNLNDMSEEFKSELEDIVLQLDQLIQEYGLGV---TENEGSSGALAETGATGAT  542

Query  599   NVSAGAVSGKALPSRSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppksktsEFS  658
             +           P+  +++ + L +T +S  P  T                   KTSEFS
Sbjct  543   S-----------PAGQASTETSLASTTASHSPPRT-------------------KTSEFS  572

Query  659   QTAAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITA  718
             Q A YNFIDLQAIRKVQRRL TLLYASELN  IQ HL  I+EQL LQA AN+VVD+V+  
Sbjct  573   QAATYNFIDLQAIRKVQRRLGTLLYASELNASIQAHLRFISEQLALQAVANEVVDRVVAT  632

Query  719   ECEELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYID  778
             EC+++LD+RHQES+IFLEAMGREME QSA LH+QTEKLA+FCL+V LCMEQSV+KVRYID
Sbjct  633   ECDDVLDARHQESRIFLEAMGREMEHQSAHLHDQTEKLARFCLSVVLCMEQSVEKVRYID  692

Query  779   LSVMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYR  838
             LSVMDLLDALKD+DE++LAAFE QYLQ+CARLRHAPND VLQ EF+ SSTLLQQIE EYR
Sbjct  693   LSVMDLLDALKDEDEDRLAAFETQYLQNCARLRHAPNDTVLQSEFETSSTLLQQIETEYR  752

Query  839   MYHRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDI  898
             +YHRK GLATDHH  AIEKQRQ+FL KLC+YF L+V  +DAN EALDVD FL+AKYIEDI
Sbjct  753   VYHRKTGLATDHHATAIEKQRQVFLRKLCEYFGLTVVLSDANPEALDVDTFLNAKYIEDI  812

Query  899   VNPPPPASEIEEEGE-RVENPQEggvaatatitagggsgvtPRSEPVPAHPEKPQ-KTGK  956
             V+PPPP S +  E + RVENPQEGG +A       G +   PR+E   ++PEKP  K  K
Sbjct  813   VSPPPPVSAVAVEADDRVENPQEGGGSAVVAAPPNGST---PRTEVSASYPEKPPVKARK  869

Query  957   QTDASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPESSAPD  1016
              T  SPR  P   AA  K+PFR SSG EA VV  VPELL+KIL+HVDADE  EP   +P 
Sbjct  870   PTVTSPR-QPGVPAASVKEPFRVSSGLEAEVVCEVPELLAKILSHVDADEPVEP---SPS  925

Query  1017  AELpteppvvppqpSISA-GEPEAGSVDEETlalaarqqlqqnqVMEKVTVEFLRLEIPV  1075
              EL +EP       + SA  E EA  VDE+ LALAARQ+LQQ  V+EKV VEFLRLEIP+
Sbjct  926   TELSSEPMAQLVNATPSATDESEAEIVDEQALALAARQELQQKLVLEKVAVEFLRLEIPI  985

Query  1076  SVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSGRLGV  1135
              +ME MLTT+RDA+VS+YD   K+T +VTA TRE+R+A+S+FLLE++LRMHWPRSGRLGV
Sbjct  986   PLMERMLTTLRDAYVSKYDRGSKRTNDVTAATRERRLAESSFLLEEQLRMHWPRSGRLGV  1045

Query  1136  QIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISCQAQL  1195
             QIYQPRMGEL+SHRQRQERQ RSVLKKADAQE  FASQ KLA  H+EQ RVKQIS QAQL
Sbjct  1046  QIYQPRMGELLSHRQRQERQVRSVLKKADAQEVVFASQTKLAFGHVEQTRVKQISFQAQL  1105

Query  1196  PMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLRACTSQL  1255
             PMQ SLAALQG EGKSKKLLKAFK +G E+ + LR MIE+DL+SLIS L DFLRACTSQL
Sbjct  1106  PMQASLAALQGQEGKSKKLLKAFKADGGERVDALRTMIESDLNSLISLLNDFLRACTSQL  1165

Query  1256  FPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQNQVVQLAQ  1315
             FPDL SCDVISGCDYHPDE+S LKEKMV  E QL+++I  REQK+KEIVEAQ+ V+QLAQ
Sbjct  1166  FPDLASCDVISGCDYHPDELSALKEKMVTIEAQLQDKIGAREQKVKEIVEAQSHVLQLAQ  1225

Query  1316  SFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMVE  1375
             +FK RYQ CMQ LSMKDG GQKYGLPRRTAQERYRSEVTRCDERSAKIDELL +LN MVE
Sbjct  1226  TFKTRYQKCMQELSMKDGLGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLVALNKMVE  1285

Query  1376  TNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQLELTPV  1435
             TNEP +  +          RK  LSS ILR L+QLRAKMY+RGR FGLLKNLSQLEL PV
Sbjct  1286  TNEPTQQGNG--------SRKGDLSSVILRILMQLRAKMYSRGRYFGLLKNLSQLELCPV  1337

Query  1436  EFd-psggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNFVQEVSAKCREDTRQI  1494
              FD    G G + S D+V+RDRDVVDEQDM+ S+  S    FL+FVQEVSAKC +DTRQI
Sbjct  1338  VFDPSGDGSGENNSADNVIRDRDVVDEQDMTSSTPSS----FLDFVQEVSAKCNKDTRQI  1393

Query  1495  YQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLALAPESAL  1554
             YQQEGKL+ELPNGSVPPSLEEYLHGL++KAR YV+HQE+ YREQVH+FGELLALAPESAL
Sbjct  1394  YQQEGKLDELPNGSVPPSLEEYLHGLADKARAYVLHQELTYREQVHYFGELLALAPESAL  1453

Query  1555  GDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQALSDRE  1614
              D L RS+      NERLS+ LE EFAAFM+QKNRH++ELRPELCSPNN  QLQALSDRE
Sbjct  1454  TDLLTRSQRSQRSHNERLSSALETEFAAFMDQKNRHTLELRPELCSPNNTPQLQALSDRE  1513

Query  1615  VSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDLKPFSGE  1674
             V+RSQQTVARLQHFRAQVM TQ Q++FAFE ELVA+ R F  ILDT V TLDDL+P SGE
Sbjct  1514  VARSQQTVARLQHFRAQVMATQVQSAFAFESELVALSRYFFAILDTSVMTLDDLQPVSGE  1573

Query  1675  ELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPSIKAFGA  1734
              LPKLKRKSL+RLRK ARIQEFGD  EVKR +AELQKLTQLGE PRFPKRSWP I  FGA
Sbjct  1574  ALPKLKRKSLQRLRKAARIQEFGDSREVKRPEAELQKLTQLGEHPRFPKRSWPPISGFGA  1633

Query  1735  HAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHRSLVSARDTA  1794
             H +WEAQQ QIL+HD QH+LP DE  KALDCS+FA +D+  CVALLTHAHRSLVSARD  
Sbjct  1634  HLVWEAQQAQILSHDEQHELPADETTKALDCSRFAVSDESTCVALLTHAHRSLVSARDAV  1693

Query  1795  YAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATMHD  1836
             YA+YMA C  +N++LVD IQEKLRDELKW+QSWQQ +ATM+D
Sbjct  1694  YASYMASCTQENRELVDGIQEKLRDELKWLQSWQQSLATMND  1735

>PYU1_G001970
Length=1794

 Score = 1890 bits (4896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1089/1864 (58%), Positives = 1322/1864 (71%), Gaps = 101/1864 (5%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHK  60
             MALKSRAE+QLLQVLNQ+KAKS S YLKEQQQ+A                       Q  
Sbjct  1     MALKSRAEMQLLQVLNQHKAKSASFYLKEQQQKA-----------------------QQD  37

Query  61    QQSKSHRLKQGDLAQFRKENRK-DVRPVREEDELVAQVRQLQDNFYIVGasdnsnnddas  119
                K H     DLAQ+RK NRK D     E++E++AQVRQLQ +FY+VG   N +  +  
Sbjct  38    DVDKQHFTATHDLAQYRKANRKHDGNAGDEDNEMIAQVRQLQGDFYVVGDPQNQDEVNEQ  97

Query  120   scanGPKSHI-EVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDS  178
                  P + I  +NAIARR+KHM AQ +YTE VK+ISEDIE AII+ AD VK+ALA  DS
Sbjct  98    -----PSNEIIALNAIARREKHMMAQQQYTEHVKQISEDIEVAIIQAADLVKEALANSDS  152

Query  179   RLKATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRV  238
             RL A+  +L D+ LLL+++++DV+ MW   ME ICTQRT+ I  FAQ LD IE TRT RV
Sbjct  153   RLCASEQTLTDEDLLLRSTHEDVVSMWS-AMEQICTQRTQLITQFAQTLDTIERTRTSRV  211

Query  239   RKGLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFV  298
             R  L  LT VLMDTAHALPPE+ERIIE+EAYELNVVV SNR VYADL+ARMA  DVDVFV
Sbjct  212   RNELQTLTAVLMDTAHALPPEIERIIEAEAYELNVVVISNRNVYADLIARMAMVDVDVFV  271

Query  299   NARLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRL  358
               RLAWE GQR WRQ+RH DAI R+Q  +NSTLFTDPDER +I++EI M+QE +H  KRL
Sbjct  272   ATRLAWENGQRRWRQIRHHDAIRRYQDTMNSTLFTDPDERLEIVREIRMFQERVHTEKRL  331

Query  359   AYLKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREA  418
             A L +LE A A+L+S+ A  IL +I  TQ EEE +NH FF +LM+VHVDK +EAQ +RE 
Sbjct  332   AALTRLEAAGAQLASDTANEILATIRATQVEEEDQNHAFFARLMAVHVDKANEAQLMREH  391

Query  419   LRLEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELI  478
             LRLEIHGFGA+A+EG+I   +  LA  LN  +LEEFFRM GGLR ELDS+VK L  ++LI
Sbjct  392   LRLEIHGFGALAEEGDIAYARDHLAATLNTDTLEEFFRMAGGLRSELDSIVKHLCTADLI  451

Query  479   YLCNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQ  538
             Y  NLQPLTTSLQVLLS LPLE VME QGKG ERKALQATLEK+RKAGKH+IL LLP L 
Sbjct  452   YEANLQPLTTSLQVLLSTLPLESVMEAQGKGVERKALQATLEKMRKAGKHDILALLPPLH  511

Query  539   TQMVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTD--IEDSSTSPSDSGAVA  596
             TQ + L+NL +MSE F+ E++EI  QLDQL+ EYG+   +  D  + D   +   S  +A
Sbjct  512   TQTMLLANLTNMSEVFQAEVQEIVAQLDQLILEYGVHERSEIDGKLTDVGIASGLSTMMA  571

Query  597   PTNVSAGAV--SGKALPSRSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppkskt  654
                 S G    S  +  + ++AS  G  ++   + P+ ++                    
Sbjct  572   NRPQSQGTTLHSSMSAATATTASSHGPTSSPPKSKPSESLGL------------------  613

Query  655   sEFSQTAAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQ  714
                  T++   IDL AIRKVQRRL  LLYASEL  PIQ HL  I++QL LQ++AN VVD+
Sbjct  614   --IPTTSSNVTIDLLAIRKVQRRLGALLYASELGAPIQDHLGFISDQLALQSSANGVVDE  671

Query  715   VITAECEELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKV  774
             VI   C ELLD+RHQES+IFLE+MG+EME QSA LH+QTEKL  FCL VA CMEQSV+K 
Sbjct  672   VINKACNELLDARHQESRIFLESMGKEMEHQSARLHDQTEKLTTFCLRVAQCMEQSVEKF  731

Query  775   RYIDLSVMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIE  834
             RYIDLS MDLLD LKDD+EE LA  E Q+L+SCAR+RHAPN+ VLQ EFQV+STLLQQ+E
Sbjct  732   RYIDLSAMDLLDHLKDDNEEVLAELEVQFLESCARVRHAPNEIVLQQEFQVASTLLQQME  791

Query  835   AEYRMYHRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVT----STDANQEALDVDKFL  890
             A+YR++HRK  LA  HHVI IE+   +FL +L + F L+V     S+D N++ALDV KFL
Sbjct  792   AQYRIHHRKGNLAAAHHVITIERHHALFLDRLLESFGLAVVQQPASSDTNEDALDVGKFL  851

Query  891   SAKYIEDIV-NPPPPASEIEEEGERVE-NPQEggvaatatitagggsgvtPRSEPVPAHP  948
             S KYIEDIV  PPPP  E EE+ + VE NPQE           G GSG TPR++   AHP
Sbjct  852   STKYIEDIVNPPPPPQPENEEQADGVETNPQE--------GLDGKGSGTTPRTDIPAAHP  903

Query  949   EK-----PQKTGKQ-TDASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHV  1002
             E      PQ+ GK  T ASPRV  E   A  K+  R SSG +      +P L+++IL+  
Sbjct  904   ETKHQQPPQRGGKGLTKASPRVVEE--PAVIKEMHRTSSGLDTKACVTIPALVARILSQN  961

Query  1003  DADESAEPESSAPDAELpteppvvppqpSISAGEPEA--GSVDEETlalaarqqlqqnqV  1060
             D  E  E   +  + E   +   +P     +A +  A   + DE  +  AA  +L+Q  V
Sbjct  962   DDVEDNEEVETIKELETVGDADPIPTTHDPAATQSTADDATADEIDIEAAATHELRQRLV  1021

Query  1061  MEKVTVEFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLE  1120
             ++KV V FLRLEIP +VMEH++ T+R+  VS+YD D K T   TA TRE+R+AD N LLE
Sbjct  1022  IDKVAVAFLRLEIPAAVMEHLVATLREEMVSKYDDDSKLTKQRTAATREERLADGNLLLE  1081

Query  1121  DRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDH  1180
             +RLRMHWPR+GRL VQ+YQPR+GEL+SHRQR ERQ RSV KK + QE+ FA   + A+D 
Sbjct  1082  ERLRMHWPRNGRLDVQMYQPRVGELVSHRQRLERQLRSVRKKVETQESVFAKHAQQALDQ  1141

Query  1181  IEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSL  1240
             IEQVRVKQISC AQLPMQ+SLAALQGLEGKSKKLLKAF++E  +K + L  MI+AD+++L
Sbjct  1142  IEQVRVKQISCHAQLPMQSSLAALQGLEGKSKKLLKAFQIENADKLDALHTMIKADVTTL  1201

Query  1241  ISSLQDFLRACTSQLFPDLTSCD-VISGCDYHPDEISGLKEKMVAFEGQLRERISEREQK  1299
             +SS+QDF+R C++Q FP+LTS + +I+GCDYHP+E++G+ EK++A E QLRE+I  RE +
Sbjct  1202  VSSMQDFVRTCSNQQFPELTSYESIITGCDYHPEEVAGVNEKIMAVEAQLREKIQARELQ  1261

Query  1300  IKEIV-EAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDE  1358
             I EIV ++Q QV+ LAQ+FKARYQACMQ+LSMKDG GQKYGLPRR AQERYRSEVTRCDE
Sbjct  1262  INEIVAQSQTQVLDLAQTFKARYQACMQSLSMKDGLGQKYGLPRRIAQERYRSEVTRCDE  1321

Query  1359  RSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRG  1418
             +SAK DELLA+L+ +V  N   +S  + K  +  D      S  ILR LLQLRAKMY RG
Sbjct  1322  QSAKTDELLAALHVIVLAN--NESTQHAKPVAGGDG-----SRTILRMLLQLRAKMYVRG  1374

Query  1419  RCFGLLKNLSQLELTPVEFdpsggggadgsg---dsVLRDRDVVDEQDMspssslssNAL  1475
             R FGLLKN+SQLE TPVEF+ SG             VLRDRD+VDEQD    +       
Sbjct  1375  RYFGLLKNISQLEPTPVEFNSSGNSIHVSEQQGHTFVLRDRDIVDEQDQQLPTP------  1428

Query  1476  FLNFVQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKY  1535
             FL FVQ+VSA+CREDTRQ+YQQEGKLEELPNGSVPPSLEEYL GL++KAR YV+ QE+K+
Sbjct  1429  FLEFVQDVSARCREDTRQVYQQEGKLEELPNGSVPPSLEEYLLGLADKARSYVLQQELKF  1488

Query  1536  REQVHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELR  1595
              EQVHFF ELLALAPE+AL D L RS E L   +E ++ ELE E+AA  EQK++H  ELR
Sbjct  1489  CEQVHFFEELLALAPEAALVDLLNRSSEALRQRSESVAQELEREYAALTEQKDKHMEELR  1548

Query  1596  PELCSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFM  1655
             PELCSPNN  QLQAL DRE SRSQ TVARL+++R QVM T    S  FE ELVA+FRCFM
Sbjct  1549  PELCSPNNADQLQALRDREASRSQHTVARLRYYRTQVMDTHVGLSADFENELVALFRCFM  1608

Query  1656  TILDTCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQL  1715
             TILDTCV TLDDLKPFSG+ELPKLKRKSLKRLRKVARI EFGD  EVKRTD EL+ LTQ 
Sbjct  1609  TILDTCVMTLDDLKPFSGDELPKLKRKSLKRLRKVARILEFGDAREVKRTDKELESLTQR  1668

Query  1716  GEVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKA--LDCSKFATADD  1773
             GEVPRFPKRSWP+I  FG  A+W+AQ  QIL HD + +LP+D+ I+A  L  S  A AD+
Sbjct  1669  GEVPRFPKRSWPAIPNFGLRALWDAQHAQILRHDEEQKLPSDDTIQALGLGTSNGAVADE  1728

Query  1774  --GACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
               GA V LLTHAHRSLV  RDT YA+Y A C  Q++Q++D I EKL DELK ++ W  GI
Sbjct  1729  DAGASVGLLTHAHRSLVGMRDTMYASYAALCKTQSEQMLDAIHEKLCDELKSIERWNDGI  1788

Query  1832  ATMH  1835
               MH
Sbjct  1789  DAMH  1792

>PPTG_10183
Length=1760

 Score = 1512 bits (3914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 890/1861 (48%), Positives = 1201/1861 (65%), Gaps = 174/1861 (9%)

Query  3     LKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHKQQ  62
             LKSRAEVQLL  LNQ KA S S YLKE+Q                     KA  ++  QQ
Sbjct  39    LKSRAEVQLLNSLNQKKASSTSLYLKEEQ--------------------LKAEDEEDSQQ  78

Query  63    SKSHRLKQGDLAQFRKENR---KDVRPVREEDELVAQVRQLQDNFYIVGasdnsnnddas  119
             +++              NR   + +    EE  ++++VRQL+D+F+IVGA +N       
Sbjct  79    TQAR-------------NRISFEAMSACSEEARMISEVRQLEDDFFIVGAENNQKLLQTQ  125

Query  120   scanGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSR  179
                 GP S IE+NA+ RRD+HM AQ +Y E+VK ISED+E AII+ AD VK+ LA  D  
Sbjct  126   PE--GP-SQIELNAVRRRDRHMEAQMQYGEEVKAISEDVEVAIIRAADHVKEVLATVDLA  182

Query  180   LKATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVR  239
             ++   ++L ++ LLL + N  +LRMW  E++A+C +RT +IA FA +L++IE +R  R+R
Sbjct  183   IQEAKSALTNNELLLASDNYKILRMWS-ELDAVCQRRTDEIAQFAAQLEEIEQSRINRIR  241

Query  240   KGLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVN  299
              GL +LT VLM+TAHALPPEVERIIE+EAYE+N VV SNR+VYADLVARM TA+VDVF+N
Sbjct  242   MGLQRLTCVLMETAHALPPEVERIIEAEAYEVNTVVISNRRVYADLVARMETANVDVFLN  301

Query  300   ARLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLA  359
             ARLAWE+GQ  WR LRH+D I +FQ  LNS LFTDP+ER+++L++I ++QE IH+ +RLA
Sbjct  302   ARLAWEQGQIRWRHLRHEDVIAKFQATLNSPLFTDPEERQQLLEQIRVFQERIHDEQRLA  361

Query  360   YLKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREAL  419
              LKQL+DA A L+S++AK  L  +S TQ  EE KN  FF +L  +H  K   A+ LREAL
Sbjct  362   VLKQLKDAGASLTSDQAKRFLEELSCTQQFEEEKNQSFFSELRGLHESKDDAAKGLREAL  421

Query  420   RLEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIY  479
             RLE+HGFGAMAKEG I   +  L TLL+D S+E+FFR  GGL+ ELD++ K+L I++LIY
Sbjct  422   RLELHGFGAMAKEGAIAEAKKTLLTLLSDDSMEDFFRAAGGLKVELDTLAKQLCIADLIY  481

Query  480   LCNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQT  539
               NL+P+ +S+ +LLS+LPL  VME QGK AERKA+Q+TL+K+RKA K EI+ LLPSLQT
Sbjct  482   NSNLEPVVSSVGILLSSLPLANVMEKQGKEAERKAVQSTLDKVRKATKGEIMSLLPSLQT  541

Query  540   QMVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTN  599
             Q+  L NL +MS++FK EL +IA QLD +++EYG        I+D+    S+S A++   
Sbjct  542   QISMLMNLEEMSDKFKAELGDIAAQLDTIIREYG-------SIQDNEA--SNSSAISTIT  592

Query  600   VSAGAVSGKALPS-------RSSASRSGLVTTAS-SAGPTPTMEtslsstsfsssnsppk  651
                GA + K  PS       +S+      +TT S S G T                    
Sbjct  593   SLMGASNDKRPPSVAAPASVKSTTKIPATITTTSLSKGKT--------------------  632

Query  652   sktsEFSQTAAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKV  711
                 + SQ    N +DLQAIRKVQR L TLLYASEL  P Q+HL  IA+QL LQ NAN++
Sbjct  633   ---IDISQNNG-NAVDLQAIRKVQRSLGTLLYASELGLPWQEHLHFIADQLQLQTNANRI  688

Query  712   VDQVITAECEELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSV  771
             VD+VIT EC  L+++R QES++ +E MG+ MEQQSA LH+  EKLA+F L V LC+E+SV
Sbjct  689   VDEVITKECNALIETRQQESRLLVEEMGKRMEQQSAQLHDHVEKLARFFLRVVLCLEESV  748

Query  772   DKVRYIDLSVMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQ  831
             DKV+Y++LSVMDLLD LKD+DE+ LA  E +  QS ARLRH+PN  VL++EFQ SS LL 
Sbjct  749   DKVQYVNLSVMDLLDTLKDNDEDALADLETKLTQSSARLRHSPNSNVLREEFQRSSDLLM  808

Query  832   QIEAEYRMYHRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLS  891
              IE EYR Y ++  LA D++V+AI+KQR ++L +LC +F L  T+     ++ ++D FLS
Sbjct  809   HIEGEYRTYDKRVSLAADNNVVAIDKQRLLYLQRLCDFFGLHQTNQPQGDDSFNLDYFLS  868

Query  892   AKYIE---DIVNPPPPASEIEEEGERVENPQEggvaatatitagggsgvtPRSEPVPAHP  948
             A++I+    +VNP P         E+  N                        EP PA  
Sbjct  869   AQHIDIPISVVNPVPQ--------EKTSN----------------SIVEAWTGEPPPASD  904

Query  949   EKPQKTGKQTDASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADES-  1007
             E P+            PPE      K+ FR +SG E  VV ++  L   IL   + +++ 
Sbjct  905   E-PE------------PPE------KEIFRTTSGLEMVVVLSLTGLAQNILIQSEEEDTE  945

Query  1008  ---------AEPESSAPDAELpteppvvppqpSISAGEPEAGSVDEETlalaarqqlqqn  1058
                       +P SS  +     +      + + +  EP++    E+T            
Sbjct  946   QQLVEEVGPTDPSSSEQNTPRDDKLSSRTNEENTTEFEPQSSRSLEQT------------  993

Query  1059  qVMEKVTVEFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFL  1118
              V+EKV  EFL L +P + +E +L T RDA +S+YD D   T   T ETR++R A S+ L
Sbjct  994   -VLEKVQTEFLVLSVPSNTVESLLATFRDAILSKYDSDATTTATQTEETRDERHASSSML  1052

Query  1119  LEDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAI  1178
             LE+RLR+HWPR GRL VQ YQPRMGEL++H+QRQER  R V  K D Q+  FA +V+ A+
Sbjct  1053  LEERLRVHWPRKGRLDVQFYQPRMGELLNHQQRQERHLRGVWLKVDEQQAAFAKKVEEAL  1112

Query  1179  DHIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLS  1238
              H+EQ RV QI+ QAQLP+Q SLAALQGLE K+KK L  FK E  E    L+AM  +D++
Sbjct  1113  AHVEQTRVTQINFQAQLPLQQSLAALQGLEVKTKKRLGVFKGEAMEILAALQAMTASDIN  1172

Query  1239  SLISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQ  1298
             SL+SS QD++RAC+SQLFPDLTS ++I+GCDYHP+EIS +KEK+ A E Q R++ISERE+
Sbjct  1173  SLLSSCQDYIRACSSQLFPDLTSTEIITGCDYHPEEISAIKEKLAAVEAQTRDQISEREK  1232

Query  1299  KIKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDE  1358
             +I EI   Q Q++ + ++FK R Q CMQ+L+MK+G GQK+GLPRRTAQERYRSE+TRC+ 
Sbjct  1233  QIDEISSKQGQILDMWEAFKTRSQMCMQSLAMKEGLGQKFGLPRRTAQERYRSEMTRCEA  1292

Query  1359  RSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRG  1418
             RSA I+ LLASL ++V+  +    +++L     L+++   L+  +L KL+QLRAK+Y+RG
Sbjct  1293  RSAAINTLLASLVSLVDEGKSGGHSESL-----LNEQD--LTRDVLSKLMQLRAKIYHRG  1345

Query  1419  RCFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLN  1478
               FG L++ SQLEL P EF       A G  + ++RD +VVDE+D   +        FL 
Sbjct  1346  MYFGFLRSPSQLELKPAEF-----NPATGREEEMIRDHEVVDEEDRVLAVP------FLE  1394

Query  1479  FVQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQ  1538
             F  +VSAKC+E+T+ +YQ EGK EELP   VP  LEEYL G  EKAR +V+ QE+ YREQ
Sbjct  1395  FAGQVSAKCQEETKALYQHEGKNEELPPSGVPAVLEEYLSGQLEKARAFVMLQEMSYREQ  1454

Query  1539  VHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPEL  1598
             V  F +LL LAP     +  +++K  +      + +  E+++ ++M+ KNRH++ELRP L
Sbjct  1455  VDLFADLLTLAPGVVARNLAEQAKLEMRRKISEMVSAFESQYQSWMDLKNRHTLELRPHL  1514

Query  1599  CSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTIL  1658
             CSPNN   L+ L +RE +RS  T   L + R+Q +  Q Q S AFE  L+ + +C M +L
Sbjct  1515  CSPNNVHLLKELEEREKARSTSTQVALYNLRSQFLAEQIQISLAFEARLIGLCQCLMLLL  1574

Query  1659  DTCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEV  1718
             D+ V +LDDLKPFSGEELPK KRKSLKRLRKVAR+ EFGD  EVKRT AELQKLTQ GE 
Sbjct  1575  DSSVLSLDDLKPFSGEELPKRKRKSLKRLRKVARVNEFGDSREVKRTAAELQKLTQGGET  1634

Query  1719  PRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPT-----DEAIKALDCSKFATADD  1773
             PRFP RSW  I +FG  ++WE  +  I   D   Q P      D +++ L C   A+ +D
Sbjct  1635  PRFPLRSWTGIPSFGVQSLWEEVKADIQAKDLARQSPESVVQHDTSVQDLICLPLAS-ND  1693

Query  1774  GACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGIAT  1833
             GACVALLT AHR+L+ ARD+AY  YM FC  + ++ +D + E++ DE+KW+ SW++GI+ 
Sbjct  1694  GACVALLTPAHRALIRARDSAYTDYMIFCREETRRFLDNLHERIEDEVKWMLSWEKGISN  1753

Query  1834  M  1834
             M
Sbjct  1754  M  1754

>PYAR_17128
Length=1766

 Score = 1475 bits (3819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 859/1843 (47%), Positives = 1168/1843 (63%), Gaps = 117/1843 (6%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHK  60
             MAL+SRAEVQLL VL+QNKAK+VSGYL+ +QQR  +                    QQ +
Sbjct  11    MALQSRAEVQLLTVLHQNKAKNVSGYLRVEQQRVEDE-------------------QQQQ  51

Query  61    QQSKSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGasdnsnnddass  120
             Q++K       +L Q+R    K+     E D+++  VRQL+ +  +      S  +   +
Sbjct  52    QKTK-------NLKQYRVGAGKNAPSPSEADDMIGAVRQLEHHVVV------STPEALDA  98

Query  121   canGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRL  180
                   + IE  AI RR+ HM A   YTE VK ISE+IE AII+ AD +K+ LA  DS L
Sbjct  99    EDVETPNQIEQIAIRRREIHMEALRVYTESVKTISEEIEGAIIRQADVIKETLAVLDSEL  158

Query  181   KATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRK  240
                 + L DD LLL   + DVL +W   M+AIC +RT+ + AF ++L+ IE +R  RV  
Sbjct  159   TKKKSELQDDALLLTCEHGDVLALWA-AMDAICERRTKAVDAFGEQLEFIEKSRVDRVGA  217

Query  241   GLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNA  300
             GL  LT+ LMDTAHALPPEVERIIE+EAYELNVVV SNR+ YADL+ RMAT DVDV V  
Sbjct  218   GLRGLTKTLMDTAHALPPEVERIIEAEAYELNVVVISNRRAYADLITRMATQDVDVLVQR  277

Query  301   RLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAY  360
             RL WE GQ+ WR+LRH DA+ +F   + STL+TDPDER++I+ ++  +Q++ H  +R++ 
Sbjct  278   RLEWEVGQQRWRRLRHDDALQKFCNTITSTLYTDPDERQQIMAQLRAFQDTTHRERRVST  337

Query  361   LKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALR  420
             L+ L DA A+L+S+  +++L  ++ TQ  EE +N  +F++L S++ DK  EAQ LREALR
Sbjct  338   LRSLRDAGADLTSQHVQSVLAGLTETQRHEEEQNASYFQKLTSLYDDKIHEAQQLREALR  397

Query  421   LEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYL  480
             LE+HGFGAMA+EGEI L + KL  LL D SLEEFFRM GGL+ ELD + K+L+I+ELIY 
Sbjct  398   LELHGFGAMAQEGEIGLSREKLTGLLGDESLEEFFRMAGGLKSELDLIAKKLNIAELIYQ  457

Query  481   CNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQ  540
              NL PL  S+ VL SALPLEE+ME QGKGAERKA+QATL+++RKA KHEI+ LLP LQ Q
Sbjct  458   ANLTPLRISVDVLRSALPLEEIMENQGKGAERKAVQATLDRMRKAAKHEIIGLLPVLQGQ  517

Query  541   MVGLSNLNDMSEEFKNELEEIAFQLDQLVQEY----GLAAAASTDIEDSSTSPSDSGAVA  596
             +  L NL D S+ FK ELE++  QL  ++QE+        A  TD  ++   PS   AV 
Sbjct  518   VSMLLNLADTSDVFKAELEDVGVQLRLILQEHESQSNTGEAGMTDARETRL-PSPPAAV-  575

Query  597   PTNVSAGAVSGKALPSRS--SASRSGLVTTASSAGPTPTMEtslsstsfsssnsppkskt  654
             P+ VS+    GK+L + +  ++S + L +  SSAG                         
Sbjct  576   PSGVSS---PGKSLATSTFGTSSLASLTSDVSSAGS------------------------  608

Query  655   sEFSQTAAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQ  714
                        IDL AIRKVQRRL TL+YASEL+   Q HL  IAEQL LQ  AN VVD 
Sbjct  609   -----------IDLHAIRKVQRRLGTLVYASELSPAFQDHLMYIAEQLELQTRANDVVDS  657

Query  715   VITAECEELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKV  774
             V+T  C++ L  R +ES +FL  +G+ +E+QS  LH   E++A+F L V   ME+  ++V
Sbjct  658   VVTTRCDDQLMGREEESMLFLTQIGQHVERQSLQLHEICERIAQFVLRVVQKMEEGEERV  717

Query  775   RYIDLSVMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIE  834
             R+++LSV+DLLD L+++DE+     E QY  +CARLRHAP+  VLQ EF+ ++ LLQQ+E
Sbjct  718   RFVNLSVLDLLDTLQENDEKANGDLEEQYAATCARLRHAPDGTVLQTEFENATDLLQQME  777

Query  835   AEYRMYHRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKY  894
             + YR+Y ++  LA  HHV A  KQ  +FL + C  F L   +     E  DV++FLS + 
Sbjct  778   SSYRVYQKRVALAAQHHVTATHKQHDLFLFQQCSLFGLVAPTA---LEQFDVERFLSVQC  834

Query  895   IEDIVNPPPPASEIEEEGERVEN--PQEggvaatatitagggsgvtPRSEPVPAHPEKPQ  952
             I +     PP+         V+N  P E   +     ++G G G        P       
Sbjct  835   INEATTFKPPS---------VDNVPPSEHSDSQATGESSGQGGGGPSHDSKAPPSKSSKD  885

Query  953   KTGKQTDASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPES  1012
             +  K+  +          A  +  F  +SG E      +PEL+ KIL   +ADE    ++
Sbjct  886   RANKEKKSKGDSKEPAAVAPVRDRFHTTSGLELDFQLTIPELVEKILTEQNADEGGAEQA  945

Query  1013  SAP---DAELpteppvvppqpSISAGEPEAGSVDEETlalaarqqlqqnqVMEKVTVEFL  1069
             ++    + +        P   + +AGE      +EE +A    +  +  +V   V  +FL
Sbjct  946   NSTVYIETQQHEIVIPTPQADAHAAGEDALIEENEEEIARRQARNDRLQRVHNHVARDFL  1005

Query  1070  RLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPR  1129
              L I  S+ E +L  +R+  ++++D   K      + T+ QRV D N LLE+RLRMHWPR
Sbjct  1006  SLAIEHSLQEELLHRLRETMLTKFDLSFKSHIASASATQTQRVQDCNLLLEERLRMHWPR  1065

Query  1130  SGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQI  1189
              GRL VQ+YQPR+GEL SHR+R +R  R++  K D  + TF  Q+      +E+  VKQ+
Sbjct  1066  RGRLDVQLYQPRIGELYSHRERYDRHIRTMTAKVDTLQVTFERQLSALQKSLEEANVKQL  1125

Query  1190  SCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLR  1249
             + QAQLPMQ SLAALQGLE KSKKLL A + +  EK   L+ M  +DL++L S +QD+LR
Sbjct  1126  TLQAQLPMQQSLAALQGLEVKSKKLLSACRSDSDEKLAKLKMMASSDLATLASLVQDYLR  1185

Query  1250  ACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQNQ  1309
              CTSQ+FPDLTSC+VISGCD+HPDE+S ++ K+ A E +LRE +  RE  + ++ E Q  
Sbjct  1186  VCTSQVFPDLTSCEVISGCDFHPDEVSIVETKIHAVETKLREILERREPMLVQMGEKQRA  1245

Query  1310  VVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLAS  1369
             ++  A  FK+RYQ+C+Q+LSM+DG GQKYGLPRRTAQERYRSE TR +E S+KIDELLAS
Sbjct  1246  LLDSAHDFKSRYQSCLQSLSMRDGLGQKYGLPRRTAQERYRSETTRAEELSSKIDELLAS  1305

Query  1370  LNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQ  1429
             L ++VE  +  K        S L D  + +++ +L  LL+LRAK++ RG+ FGLLKN SQ
Sbjct  1306  LQSIVENKQTVKM-------SRLPD--SDVATQVLHLLLKLRAKLFYRGKYFGLLKNTSQ  1356

Query  1430  LELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNFVQEVSAKCRE  1489
             LE  PV+F          +    + D+D VDE+       + S  LFL+FV++VSAKCR+
Sbjct  1357  LEPLPVKF-----DAGGVANRPTITDKDAVDEE-----YRVPSPLLFLDFVKQVSAKCRD  1406

Query  1490  DTRQIYQQEGKLEELPNGS-VPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLAL  1548
             DTRQ+YQQEGKL+ELP+ S VP +LEEYL GLSEKAR +V+  E+K+REQV  FGELLAL
Sbjct  1407  DTRQLYQQEGKLDELPSASAVPAALEEYLAGLSEKARAFVLQHELKFREQVDLFGELLAL  1466

Query  1549  APESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQ  1608
             AP +AL D + R++E +         +++  F A+M+QKNR+ V+LRP+LCSPNN  QLQ
Sbjct  1467  APVTALSDLVCRARETVSRETIAAHEDVQLRFLAWMDQKNRNMVDLRPDLCSPNNVAQLQ  1526

Query  1609  ALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDL  1668
             AL +RE  RS  T A L+  R Q++     +S  FEKEL+A+   F  +LDT V  LDDL
Sbjct  1527  ALCEREGQRSDTTFASLRACRLQILTRMIGSSSDFEKELIALCNAFQILLDTSVMVLDDL  1586

Query  1669  KPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPS  1728
             KPFSGEELP+L+RKSLKRLRK+ARIQE+GD  EVKR+D E +KLTQL EVPRFP+R WP+
Sbjct  1587  KPFSGEELPRLQRKSLKRLRKLARIQEYGDPREVKRSDEETKKLTQLNEVPRFPRRGWPA  1646

Query  1729  IKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHRSLV  1788
             I AFG+H  WEA++V+++  D   Q P DE+++AL  ++ A   DGAC ALLTHAHR L+
Sbjct  1647  IPAFGSHVRWEAKRVELMQDDEAMQAPKDESMQALAITQ-AVNSDGACTALLTHAHRCLM  1705

Query  1789  SARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
              +RD  YAAY  F  + +++L+  +QE+LRDE+KW +SW+ GI
Sbjct  1706  HSRDEVYAAYETFSCSHSQKLLADLQERLRDEIKWSESWRLGI  1748

>PHYRA_84730
Length=1943

 Score = 1473 bits (3814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 853/1855 (46%), Positives = 1155/1855 (62%), Gaps = 169/1855 (9%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHK  60
             MALKSRAEVQL+ VLNQ KA+S S YLKE+Q++A                          
Sbjct  233   MALKSRAEVQLVSVLNQKKARSASFYLKEEQEKA--------------------------  266

Query  61    QQSKSHRLKQGDLAQFRKENRKD------VRPVREEDELVAQVRQLQDNFYIVGasdnsn  114
                         LA+   E+++D      +    EE  LV++VR LQD+++IVG   N +
Sbjct  267   ------------LAEDGDESKRDRVAFEALPSCSEEARLVSEVRLLQDDYFIVGTRGNQS  314

Query  115   nddasscanGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALA  174
                      GP S I++N + RRD+HM AQ +Y ++VK ISED+E AII+ AD VK+ L 
Sbjct  315   RQKPKE---GP-SQIQLNDVRRRDRHMEAQMQYADEVKAISEDVEVAIIRAADQVKEVLV  370

Query  175   QFDSRLKATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTR  234
               D+ +     +L  + LLL + N+ +L MW RE++A+C +RT +I  FA +L++IE TR
Sbjct  371   TIDAAIDEAKVALTSNELLLASDNESILGMW-RELDAVCQRRTDEITQFAAQLEEIEQTR  429

Query  235   TKRVRKGLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADV  294
               RVR  L +LT  LM+TAHALPPEVERIIE+EAYE+N VV SNR+VYADL ARM TA+V
Sbjct  430   IHRVRAELQRLTSTLMETAHALPPEVERIIEAEAYEVNTVVISNRRVYADLAARMGTANV  489

Query  295   DVFVNARLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHN  354
             D F+NARL WE+GQ  WR LRH  AI RFQ  L+S LFTDPDER+++L++I ++QE +H 
Sbjct  490   DAFLNARLDWEQGQMRWRVLRHDAAIARFQATLSSPLFTDPDERQQVLQQIRVFQEEVHA  549

Query  355   GKRLAYLKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQH  414
              +RLA LKQL DA A LSSE+AK IL  +S TQ  EE KN  FF  L  +H  K   A+ 
Sbjct  550   EQRLAVLKQLNDAGAALSSEQAKRILEELSATQQFEEEKNQSFFADLRELHESKRGAAKA  609

Query  415   LREALRLEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDI  474
             LRE LRLE+HGFGAMAKEG IE  +  L  LL+D S+E+FFR  GGL+ ELD + K+L +
Sbjct  610   LREVLRLELHGFGAMAKEGAIEEAKGTLVALLSDDSMEDFFRAAGGLKAELDILAKQLCV  669

Query  475   SELIYLCNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLL  534
             ++LIY  NL+P+  S+  LLSALPLE VME QGK AERKA+Q+TL+KIRKA K EI+ LL
Sbjct  670   ADLIYSDNLEPVVRSVGTLLSALPLESVMERQGKEAERKAVQSTLDKIRKATKGEIMSLL  729

Query  535   PSLQTQMVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGA  594
             P LQTQ+  LSNL +M ++FK EL EI  QLD ++QEY  A+  +TD    + SP  S +
Sbjct  730   PPLQTQISMLSNLEEMGDDFKRELSEIMAQLDTIIQEY--ASLPATDA--LALSPLGSAS  785

Query  595   VAPTNVSAGAVSGKALP-------SRSSASRSGLVTTASSAGPTPTMEtslsstsfsssn  647
                + V A +      P       S  S  +S  +  A+S+  + T+E            
Sbjct  786   TLKSPVEASSDKAVTRPPSVVAPGSSKSTRKSSAMFGATSSSRSKTIEMP----------  835

Query  648   sppksktsEFSQTAAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQAN  707
                          +  N +DLQAIRKVQRRL TL+YASEL  P QQHL  IA+QL+ Q +
Sbjct  836   ------------PSNGNAVDLQAIRKVQRRLGTLMYASELGAPWQQHLHFIADQLVFQTS  883

Query  708   ANKVVDQVITAECEELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCM  767
             AN +VD  I+ ECE LL++R QES++ +E +G+ ME+QSA L    EKL +F L V LCM
Sbjct  884   ANCIVDDTISRECESLLETRQQESRLLVEEIGKRMERQSAQLQEHVEKLTRFFLRVVLCM  943

Query  768   EQSVDKVRYIDLSVMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSS  827
             E+S DKV+Y++LSVMDLLD LK+ +++ LA  E Q+ QSCARLRH+PND VL+ EFQ S 
Sbjct  944   EESGDKVQYVNLSVMDLLDTLKESNDDVLAGLETQFKQSCARLRHSPNDNVLRGEFQRSL  1003

Query  828   TLLQQIEAEYRMYHRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVD  887
              LL  IE EYR Y ++  LA D++V+AI ++R+ +L +LC +F L       + +AL++D
Sbjct  1004  DLLTHIEGEYRTYDKRASLAADNNVVAIARKREEYLQRLCDFFGLRRLHQPKSDDALNLD  1063

Query  888   KFLSAKYIEDIVNPPPPASEIEEEGERVENPQEggvaatatitagggsgvtPRSEPVPAH  947
              FLS ++IED+++P                                            A 
Sbjct  1064  YFLSVQHIEDVLSP--------------------------------------------AS  1079

Query  948   PEKPQKTGKQTDASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADES  1007
             PE         +ASP  P   + +  ++ F A+SG E     ++  L   IL   + DE 
Sbjct  1080  PEVIANDSTHGNASPTQP--ELPSSDEEMFIAASGLELVATISLATLARNILTQ-NEDEG  1136

Query  1008  AEPESSAPDAELpteppvvppqpSISAGEPE-AGSVDEETlalaarqqlqqnqVMEKVTV  1066
              E ++     E          Q      E    G  D+ T   +   +L Q  V++KV  
Sbjct  1137  GEGQAETSSNE----------QVGFHGDEGNRQGDGDDTTENGSDSSRLWQQSVLDKVQA  1186

Query  1067  EFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMH  1126
             EF+ + IP   ++ +L   RDA +SRYD D   T++ T ETR++R A S  LLE+RLR+H
Sbjct  1187  EFMVIRIPSDTVKSILAAFRDAILSRYDSDAGATSSQTEETRDERHASSAMLLEERLRIH  1246

Query  1127  WPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRV  1186
             WPR GRL VQ YQPRMGEL++H+QRQER  R V KK   Q+  F  +V+ A  H++Q R+
Sbjct  1247  WPRKGRLDVQFYQPRMGELLNHQQRQERLLRGVWKKVGEQQAAFVKRVEEAYGHVDQARM  1306

Query  1187  KQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQD  1246
              QIS QAQLP+Q SLAALQGLE K+KK L  FK E  E+   LRAM E+D +SL+SS QD
Sbjct  1307  AQISFQAQLPLQLSLAALQGLEVKAKKRLGIFKSEAMERLVSLRAMTESDSNSLLSSCQD  1366

Query  1247  FLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEA  1306
             ++RAC+SQLFPDLTSC++ISGCDYHP+EI+ ++EK+   E Q R++I ERE+++ +I ++
Sbjct  1367  YIRACSSQLFPDLTSCEIISGCDYHPEEIAAIREKLATVEAQARDQIFEREKRVIDISDS  1426

Query  1307  QNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDEL  1366
             Q QV++  Q+FKARYQ CMQ+L+MK+G GQK+GLPRR AQERYRSE+TRC+ RSA I+ L
Sbjct  1427  QGQVLETWQAFKARYQGCMQSLAMKEGLGQKFGLPRRAAQERYRSEMTRCEARSASINTL  1486

Query  1367  LASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKN  1426
             LASL ++V+ +                D  + L+ +ILR L+QLRAK+Y+RG  FG L++
Sbjct  1487  LASLQSLVDRD--------------TKDAHSELTGSILRMLMQLRAKIYHRGMYFGFLRS  1532

Query  1427  LSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNFVQEVSAK  1486
              SQLEL PVEF     G  +  G+ V+RD +VVDE+D + +        FL F   V+AK
Sbjct  1533  PSQLELKPVEF-NPVVGRHEEKGEGVIRDLEVVDEEDRTLAVP------FLEFADHVNAK  1585

Query  1487  CREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELL  1546
             C+E+T+ +YQQEGK+EELP   VP +LEEYL G  EKAR +VV QE  YREQV+ F  LL
Sbjct  1586  CQEETKTLYQQEGKIEELPPSGVPAALEEYLSGQLEKARSFVVQQEGLYREQVNLFAHLL  1645

Query  1547  ALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQ  1606
              + P   +  F+  +++ +      +++  + ++  +M  KN+H++ELRP LCSPNN   
Sbjct  1646  TVVPGIVVMTFMDHAQQQMCKGIGAMASAFDTQYQLWMNLKNQHTLELRPHLCSPNNAHL  1705

Query  1607  LQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLD  1666
             L+ L +RE +RS  T   L + R Q +  Q Q S   E  LV + +C M +LD+ V + +
Sbjct  1706  LRELEERESARSDSTQVALHNHRRQFLAGQIQVSLTVEARLVELCQCLMLLLDSSVLSPE  1765

Query  1667  DLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSW  1726
             DLKPF G+ELPKLKRKSLKRLRK+AR+ E GD  EV+R+ AELQKL Q GE PRFP R+W
Sbjct  1766  DLKPFLGDELPKLKRKSLKRLRKMARVNELGDPREVQRSGAELQKLAQSGESPRFPLRAW  1825

Query  1727  PSIKAFGAHAIWEAQQVQILNHDGQHQ-------LPTDEAIKALDCSKFATADDGACVAL  1779
               I +FG  + WE  +  IL  +   Q       L  D +I+ + C   A+ +DGACV L
Sbjct  1826  AGIPSFGLQSQWEELKAGILAKEAAAQKVSSTSILKPDSSIQDVACEPSAS-NDGACVTL  1884

Query  1780  LTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATM  1834
             LT AHR+L+ AR++AYA ++  C  +    +D + E+L DE+KW  SW++GI  M
Sbjct  1885  LTPAHRALIRARNSAYAHFVGLCREETTHFLDAVHERLEDEVKWTLSWEKGIENM  1939

>PYAP_16577
Length=1744

 Score = 1437 bits (3721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 852/1836 (46%), Positives = 1152/1836 (63%), Gaps = 119/1836 (6%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHK  60
             MALKSRAEVQL+  LNQ+KAKS SGYL+ +QQRA E                      H+
Sbjct  11    MALKSRAEVQLVHTLNQHKAKSASGYLRAEQQRASEEPS-------------------HE  51

Query  61    QQSKSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGasdnsnnddass  120
             Q  +  R +Q D  QFR  + ++  P  E+DE++A V++L+ +           +     
Sbjct  52    QPGQEARTRQLDYKQFRIGSERNPLPATEQDEMIAAVKELEQHVL--------PSRKTYE  103

Query  121   canGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRL  180
              + G  + IE+NA+ RR++HMAAQ EY+E VK +SEDIE AII  AD +K+ LA  D+ L
Sbjct  104   ESEGTPNQIEINAVRRREEHMAAQREYSEVVKAVSEDIEGAIIHAADVIKETLAGVDNEL  163

Query  181   KATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRK  240
                +  L +D LLL   ++DVL MW   ME +C +RT+ +  F +EL+ IE +R  RV  
Sbjct  164   AKVARDLENDTLLLACKHEDVLAMWA-AMEHLCERRTKAVEDFGRELEKIECSRIDRVGA  222

Query  241   GLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNA  300
             GL KLT+VLM+TAHALPPEVERIIE+EAYE+NVVV +NRKVYADL+ARM T DVDVF  +
Sbjct  223   GLKKLTKVLMETAHALPPEVERIIEAEAYEVNVVVVTNRKVYADLMARMGTQDVDVFAQS  282

Query  301   RLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAY  360
             RL WE GQ  WR+LRH DAI +F   + S  FTDP ER  I++++   Q+++H  +RLA 
Sbjct  283   RLQWETGQVRWRKLRHDDAIQQFHTTIASEKFTDPSERGHIMQKVRENQQNVHEKERLAA  342

Query  361   LKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALR  420
             L+QL  A A L+S+ A+  L  +S TQ  EE +N +FF++L S+H +++ E Q LRE+LR
Sbjct  343   LQQLSAAGANLTSQGAQQSLAQLSETQRREEEENAKFFQELRSLHDERSREGQLLRESLR  402

Query  421   LEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYL  480
             LEIHGFGA+A EG++   + +LA LL+D SLE+FFRM GGLR EL+++VK+LDI+ LIY 
Sbjct  403   LEIHGFGALAPEGDVVGSRDQLALLLSDASLEDFFRMAGGLRTELEAIVKQLDIASLIYQ  462

Query  481   CNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQ  540
              NL PL TS+ VLLSALPL  +ME QGKGAERKA+Q TL+K+RKA KHEI  LLP LQ+Q
Sbjct  463   GNLIPLCTSVDVLLSALPLANIMENQGKGAERKAIQTTLDKMRKAAKHEIAALLPPLQSQ  522

Query  541   MVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNV  600
             +  L NL +M++ FK E+E++  QL  +VQEY           ++S   +DS  V     
Sbjct  523   VATLLNLGEMNDIFKAEVEDVDTQLRHIVQEY-----------EASMLNNDSQLVMDNEA  571

Query  601   SAGAVSGKALPSRSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppksktsEFSQT  660
             S  +  G A  S+  +S      T  SA   P + T     S S                
Sbjct  572   SGHSSPGSAGQSQEKSS------TLMSAASNPLLTTHAGDLSIS----------------  609

Query  661   AAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAEC  720
                  +DLQA+RKVQRRL TL+YASELN   QQ L  I+ QL LQ  AN+VVD V T EC
Sbjct  610   -----LDLQAVRKVQRRLGTLVYASELNGAFQQLLGYISRQLQLQMRANEVVDIVTTTEC  664

Query  721   EELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLS  780
             E  L +R +E K+FL+ +G  +E Q A +H+Q E+LAKF L VA  ME S D+VR+++LS
Sbjct  665   EGPLAAREEEGKLFLKQIGHRIEHQCAGIHDQCERLAKFFLKVAQLMELSEDRVRFVNLS  724

Query  781   VMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMY  840
             V+DLLD LK++D+      E +Y   CARLRHAP+   LQDEF  ++ LL+ + A YR+Y
Sbjct  725   VLDLLDTLKENDDNANVDLENRYSVCCARLRHAPDGMSLQDEFAKATKLLEAMVASYRLY  784

Query  841   HRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVN  900
              ++  +A ++HV+A  KQR +FL +LC  F L    +    E  +   FLS+ YI+++  
Sbjct  785   QKRVSMAAENHVVATGKQRDLFLNQLCTLFGLL---SPTPPEDFNFGYFLSSAYIDELTI  841

Query  901   PPPPASEIEEEGERVENPQEggvaatatitagggsgvtPRSEPVPAHPEKPQK-TGKQTD  959
             P PP            +      ++  +         +PR +      EKP   +GK+  
Sbjct  842   PKPPVGN---------DESSEEQSSGESSEQVAHKVSSPRQDLQAQSKEKPATMSGKK--  890

Query  960   ASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPESSAPDAEL  1019
               P    E+        F+ SSG +  V   +PEL+ KIL    AD++ E    A   EL
Sbjct  891   --PVKADESHEKPEVNHFQTSSGLDLIVQLHIPELVEKILTERSADDAEEEAEEALPTEL  948

Query  1020  pteppvvppqpSISAGEPEAGSVDEETlalaarqqlqqnqVMEKVTVEFLRLEIPVSVME  1079
             P++         +   E  A    EE +     + +   +V+++V  +FL LE+  S  +
Sbjct  949   PSD--------PVPGAENIAPEESEEGIVARKARAVCLGRVLDQVARDFLILELDNSTKD  1000

Query  1080  HMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSGRLGVQIYQ  1139
              +L+T RDA ++++D   K   +   E    R  D N LLE+RLRMHWPR GRL VQ YQ
Sbjct  1001  ALLSTFRDAVLTKFDVTFKTHLSAATELHADRQRDCNLLLEERLRMHWPRKGRLDVQTYQ  1060

Query  1140  PRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISCQAQLPMQT  1199
             PR+ EL SHRQR +R  RS+  K ++Q+  F          IE   VKQ++ QAQLPMQ 
Sbjct  1061  PRIAELYSHRQRYDRHVRSMTTKVESQQKVFEQLASELQAFIEDTAVKQVTLQAQLPMQQ  1120

Query  1200  SLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLRACTSQLFPDL  1259
             SLAALQGLE KSKKL+ AF+ +  EK   L+AM  +D S L S ++DF R C +Q+FPDL
Sbjct  1121  SLAALQGLEVKSKKLVSAFRSDSLEKLEKLKAMTVSDHSMLTSLVEDFTRVCMAQVFPDL  1180

Query  1260  TSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQNQVVQLAQSFKA  1319
             +SC+V++GCDYHPDEI  ++ K+   E QLRE +  R   I+E+  AQ ++++ +Q+FK 
Sbjct  1181  SSCEVMNGCDYHPDEIVIVRTKLETIEAQLREAVDARATPIQELEAAQRELLENSQTFKT  1240

Query  1320  RYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMVETNE-  1378
             RYQAC+Q+LSMK+G GQKYGLPRRTAQERYRSE TR D  SAKIDELLA L ++VE    
Sbjct  1241  RYQACLQSLSMKEGLGQKYGLPRRTAQERYRSETTRADVLSAKIDELLAGLQSVVENKRV  1300

Query  1379  ---PKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQLELTPV  1435
                P+   D++ T+             +L  L++LRA +Y RG  FGLLKN SQLE   +
Sbjct  1301  IKAPRLPEDSISTQ-------------VLHLLVRLRAMLYYRGMYFGLLKNTSQLEPISI  1347

Query  1436  EFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNFVQEVSAKCREDTRQIY  1495
              +          S      DR+ V++Q ++  S       FL FV++V  KCREDT+Q+Y
Sbjct  1348  SY-----NAGGVSDRPTFTDRETVEDQYLTAPSIS-----FLEFVRQVGVKCREDTKQLY  1397

Query  1496  QQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLALAPESALG  1555
             QQEG+ E+LP   VP +LEEYL G SEKAR YV+ QE+K+REQV  FGELLALAPE+AL 
Sbjct  1398  QQEGRTEDLPPSGVPIALEEYLTGQSEKARAYVIQQELKHREQVDHFGELLALAPETALK  1457

Query  1556  DFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQALSDREV  1615
             D+++R++  L  S   +  EL A++   M+ KNR++V+LRP+LCSPNN  QLQAL DRE 
Sbjct  1458  DYVERARSQLSLSTTTIHEELVAKYKRQMDAKNRNTVDLRPDLCSPNNAPQLQALCDREA  1517

Query  1616  SRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDLKPFSGEE  1675
             SRS+QTV  L   RA++M     AS  FE+EL+AMF+ F+ +LDT V TLDDL+PFSGEE
Sbjct  1518  SRSEQTVHLLCECRARLMDMLIVASTEFERELLAMFQTFVLLLDTSVMTLDDLQPFSGEE  1577

Query  1676  LPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPSIKAFGAH  1735
             LPKLKRKSLKRLRK+ARI EFGD  EVKR+D E++KL QLGE PRFP+R W  I  FGA 
Sbjct  1578  LPKLKRKSLKRLRKMARINEFGDPREVKRSDEEIKKLVQLGETPRFPRRGWHGIPGFGAQ  1637

Query  1736  AIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHRSLVSARDTAY  1795
               WE ++++++  D  H +  D  + +L  ++ A   DGACVALLTHAHR+L+ +RD  Y
Sbjct  1638  TWWEKKKMELVQDDEFHGMLPDALLASL-VTQQAVQTDGACVALLTHAHRALLQSRDEVY  1696

Query  1796  AAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
             AAY+ F  + +++L+D IQE+LRDE+KW +SW+ G+
Sbjct  1697  AAYIEFTKSHSQKLLDDIQERLRDEVKWAESWRVGV  1732

>PYVX_14623
Length=1765

 Score = 1360 bits (3520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/1871 (44%), Positives = 1133/1871 (61%), Gaps = 158/1871 (8%)

Query  1     MALKSRAEVQLLQVLNQNKAKSVSGYLKEQQQRAHengdnngddddeyddddKATGQQHK  60
             MA KSRAE+ LL  L+++KA+S S YLK+QQ+ A                          
Sbjct  1     MAYKSRAEISLLDALSRSKARSPSSYLKQQQELA--------------------------  34

Query  61    QQSKSHRLKQGDLAQFRKENRKDVRPVREEDE-LVAQVRQLQDNFYIVGasdnsnnddas  119
              Q +S R    +L QF  +N   V P   +DE L+ QVR L+D+  ++G     N   + 
Sbjct  35    -QDESERPDGDNLPQFDLKNA--VMPSATDDEVLIGQVRTLEDD--VLGVRQLENQHLSE  89

Query  120   scanGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSR  179
                    S I++NA+ RRD+HM A   Y + V  ISE +E A+I  +D VKD+L   D R
Sbjct  90    GDKLEEPSQIQLNAVRRRDRHMQALVVYEKAVNEISEGVEVALIAASDHVKDSLQAIDDR  149

Query  180   LKATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVR  239
             L+   N    D +LL A    VL  W  E E I  QRT+++A FA+ELD IE +R  RVR
Sbjct  150   LQQRQNHFKQDEVLLAADKRLVLAEWT-ENEQITQQRTQELARFARELDGIENSRVGRVR  208

Query  240   KGLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVN  299
             K L +LT  LM+TA+ALPPEVER+IE++A+E N VV SNRKVYADLVARM+TA+VDVFV+
Sbjct  209   KQLQQLTVELMETAYALPPEVERVIEAQAFEANAVVISNRKVYADLVARMSTANVDVFVD  268

Query  300   ARLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLA  359
             +RLAWE  Q HWR LRH  AI  F+ +L S  FTDPD+R++IL EI  +Q+S+H+ +RL 
Sbjct  269   SRLAWEAAQSHWRHLRHDHAIQEFRSMLESPAFTDPDDRQRILAEIRSHQQSVHDERRLL  328

Query  360   YLKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREAL  419
              LKQLE+  A L+S++ + IL  ++ TQ E++  N  FF +L + H    + A+ L+EAL
Sbjct  329   ALKQLEEGGAALTSQRVQQILADLAATQQEDDEANQVFFSRLRASHESHAATAEALQEAL  388

Query  420   RLEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIY  479
             RLE+HGFGA+A+EG+IE  +++L  LL++ +LE+FFR +GGLR ELDS+ KRL +S+LIY
Sbjct  389   RLELHGFGALAREGDIEAAKTELEKLLDNDTLEDFFRSSGGLRAELDSIAKRLVLSDLIY  448

Query  480   LCNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEIL-------P  532
               N+  L  ++Q+LLSALPL +VME+QGK AERKA+QATLEKIRKA KH+          
Sbjct  449   NSNVAALLENVQLLLSALPLAQVMESQGKEAERKAVQATLEKIRKATKHDXXXXXXXXAA  508

Query  533   LLPSLQTQMVGLSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDS  592
             LLP LQTQ+  L +L+ M + FK ELE++A QL  +  + G    A++ +       + +
Sbjct  509   LLPPLQTQLQVLVHLDGMDDVFKAELEDLANQLSAIATQSGATMQATSALSKGGQDANTA  568

Query  593   GAVAPTNVSAGAVSGKALPSRSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppks  652
                 PT V+A  +   +  S SS + + +     ++  +P  E S               
Sbjct  569   APSPPTEVTATFIRQPSTLSNSSKT-TAISPPGRTSLTSPRQEPS---------------  612

Query  653   ktsEFSQTAAYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVV  712
                          IDLQA+R+VQRRL+TL++ASEL  PIQQHL  IA+QL+LQ +AN+ V
Sbjct  613   -------------IDLQAVRRVQRRLATLVFASELPSPIQQHLQFIADQLVLQTDANQTV  659

Query  713   DQVITAECEELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVD  772
             D+V++ EC+E++++R QES+ FLE +GR ME QS LLH Q E++AKF L V  C+EQS  
Sbjct  660   DKVVSDECDEIVNARQQESRAFLEEVGRRMEHQSTLLHAQCERIAKFHLGVVTCVEQSAA  719

Query  773   KVRYIDLSVMdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQ  832
             KV +++L+V+DLLD LKD ++E + A E +Y QSCA+LRHAPND+ LQ  F  S+ LL  
Sbjct  720   KVEFVNLTVLDLLDELKDSNDESIGALELEYSQSCAKLRHAPNDSELQANFHRSTELLAN  779

Query  833   IEAEYRMYHRKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSA  892
             +E EYR Y ++   A +H+V A++ Q  ++L +LC  F L+  +   +   LD+D FLS+
Sbjct  780   METEYRRYDKRVRTAAEHNVKALDAQSAVYLYQLCGLFGLAPAAPPPSGIELDLDVFLSS  839

Query  893   KYIEDIVNP---------------PPPASEIEE-EGERVENPQEggvaatatitagggsg  936
             K+I ++V+P                 P  E+E  E     NP                  
Sbjct  840   KHIGELVDPRCKTEKSSESSESDTSKPIGEVENREAGGGSNP------------------  881

Query  937   vtPRSEPVPAHPEKPQKTGKQTDASPRVPPETVAAGAKQPFRASSGFEAGVVSAVPELLS  996
              + RSE          K G    +SPRV  E +A     P+  ++G E   +     L+ 
Sbjct  882   PSARSE----------KGG--VGSSPRVN-EPLA-----PYHTAAGTELQSMVTAEALIE  923

Query  997   KILAHVD-----ADESAEPESSAPDAELpteppvvppqpSISAGEPEAG---SVDEETla  1048
             +IL   D     ADE     S+ P  +    P       S      + G   SVD E   
Sbjct  924   RILNRDDEQVDTADEEVATSSTTPREQAANGPSQPASARSNPPDGNDGGELSSVDAENEK  983

Query  1049  laarqqlqqnqVMEKVTVEFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETR  1108
               A Q +    +  K+  E L LEI  S +  ++   RDA +++++ D + T+    ETR
Sbjct  984   RTAIQLI----IQAKLEQECLHLEIASSHVTTLVCAFRDAVLNKFEADERATSEAAIETR  1039

Query  1109  EQRVADSNFLLEDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQET  1168
              QR   S+ LLE+RLRMHWPR GRL VQIYQPRMGEL++HRQR ER  R++ K+ +AQ+ 
Sbjct  1040  HQRAEASSLLLEERLRMHWPRKGRLDVQIYQPRMGELLNHRQRTERHLRALAKRIEAQQV  1099

Query  1169  TFASQVKLAIDHIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANV  1228
              F  +   A  HIE+VR  Q++ QAQLP+QTSLAALQGLE ++KK L A K EG E+ + 
Sbjct  1100  AFTKKGGDATTHIEKVRATQVTFQAQLPLQTSLAALQGLESRAKKNLGALKSEGNERLDG  1159

Query  1229  LRAMIEADLSSLISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQ  1288
             L+AM+++D++SL +S  +F+RAC++QLFPDLT CDV+SG DYHP+E+  +++ +   E Q
Sbjct  1160  LQAMVDSDVASLTNSSNEFVRACSAQLFPDLTGCDVLSGSDYHPEEVEAIQQALANVERQ  1219

Query  1289  LRERISEREQKIKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQER  1348
             +R++ +ERE +I  I +    V+Q+  +FK RYQAC+Q+LSMK+G GQK+GLPRRTAQER
Sbjct  1220  VRDQTTEREAQIAAIRDTLEHVLQMWPTFKTRYQACLQSLSMKEGLGQKFGLPRRTAQER  1279

Query  1349  YRSEVTRCDERSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLL  1408
              RSE+TRC+ERS  ID+LL SL ++    E   +   + T +        +   IL  L+
Sbjct  1280  IRSEMTRCEERSTGIDQLLTSLQSLCNLKEATPAETQVDTPT--------IQHQILVALI  1331

Query  1409  QLRAKMYNRGRCFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspss  1468
             QLRAK+ +RG  FG LKN SQLEL P+EF         G G  V+RD D+VDE D S  S
Sbjct  1332  QLRAKVLHRGLYFGFLKNTSQLELCPLEF-------DPGRGGQVIRDVDIVDEWDRSRPS  1384

Query  1469  slssNALFLNFVQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYV  1528
                    FL F + VS++CREDT+ ++QQEGKL+ELP   VP +LEEYL    +KAR +V
Sbjct  1385  EG-----FLAFFESVSSRCREDTKLLFQQEGKLDELPPSGVPDALEEYLTEQQQKARAFV  1439

Query  1529  VHQEIKYREQVHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKN  1588
             + QE+KY EQ+   G+LL LAP  A+ D  KR+K     +  R   E++AEF   M  K+
Sbjct  1440  LQQEVKYHEQLQQLGDLLVLAPGVAIADLAKRTKARASAATTRQVREIDAEFERSMAVKH  1499

Query  1589  RHSVELRPELCSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELV  1648
             RH+ ELRP+L SPNN  QL AL  RE  RS   V  L  FR + + +QA+ + AFE ELV
Sbjct  1500  RHTSELRPQLSSPNNAEQLAALCSRERDRSLSVVCLLGKFRVECLTSQAEHAVAFEDELV  1559

Query  1649  AMFRCFMTILDTCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAE  1708
             AM RC M +LDT V  L+D KP +GEELPK  RK LKRLRK+AR+ E GD  E+KR D E
Sbjct  1560  AMSRCLMKLLDTIVMGLEDAKPTNGEELPKHHRKQLKRLRKLARVLESGDPKELKRPDKE  1619

Query  1709  LQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDE---AIKALDC  1765
             +  L +LGE PRFP+R+W +I   G H ++E  +  IL+ +       D+   +I +  C
Sbjct  1620  IDALQKLGETPRFPRRTWGAIPTIGVHRLFEQTKQSILDAEALDTAVEDKEACSIASAAC  1679

Query  1766  SKF--ATADDGACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKW  1823
              +   AT  D +   LLT AHR++V ARD A+A Y AFC  +    + T  E+++DE KW
Sbjct  1680  GRAEGATITDTSGEGLLTSAHRAMVKARDGAHAEYTAFCSTELGAAMATAHERIQDEHKW  1739

Query  1824  VQSWQQGIATM  1834
               +W+ GIA M
Sbjct  1740  RSNWECGIANM  1750

>PHYSO_466705
Length=1478

 Score = 734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/762 (54%), Positives = 525/762 (69%), Gaps = 62/762 (8%)

Query  141  MAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKATSNSLADDVLLLKASNDD  200
            M AQ +Y E V+ ISED+E AII+ AD VK+ LA  D+ ++    +L D+ LLL + N+ 
Sbjct  1    MEAQMQYAEDVRAISEDVEVAIIRAADEVKEVLAAIDAGIREAQAALTDNELLLASDNES  60

Query  201  VLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLMKLTEVLMDTAHALPPEV  260
            +L MW RE+EA+C +RT +IA FA  LD+IE TR  RVR GL  LT VLM+TAHALPPEV
Sbjct  61   ILAMW-RELEAVCQRRTNEIARFAARLDEIEQTRIHRVRVGLQHLTHVLMETAHALPPEV  119

Query  261  ERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLAWEKGQRHWRQLRHKDAI  320
            ERIIE+EAYE+N VV SNR+VYADLVARM TA+VD F++ARLAWE+GQ  WR LRH+DAI
Sbjct  120  ERIIEAEAYEVNTVVISNRRVYADLVARMGTANVDEFLSARLAWEQGQVRWRHLRHEDAI  179

Query  321  YRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAYLKQLEDakaelssekakaIL  380
             +FQ  LNS LFTDP+ERR +L++I ++QE IH  +RL  LK+L+DA A LSSE+AK IL
Sbjct  180  DKFQATLNSPLFTDPEERRHVLEQIRVFQEKIHREQRLEVLKRLKDAGAALSSEQAKRIL  239

Query  381  HSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEIHGFGAMAKEGEIELCQS  440
              +STTQ  EE KN  FF  L  +H  K   A+ LRE LRLE+HGFGAMAKEG IE  +S
Sbjct  240  EELSTTQQFEEEKNQSFFSDLRGLHESKGDAAKSLREDLRLELHGFGAMAKEGAIEEAKS  299

Query  441  KLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQPLTTSLQVLLSALPLE  500
             L +LL+D ++E+FFR  GGL+ ELD++ K+L +++LIY  NL+P+ +S+ VLLSALPLE
Sbjct  300  TLVSLLSDDTMEDFFRAAGGLKTELDTLAKQLCVADLIYSANLEPVVSSVGVLLSALPLE  359

Query  501  EVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGLSNLNDMSEEFKNELEE  560
             VME QGK AERKA+QATLEKIRKA K EIL LLP LQTQ+  L NL +MS+ FK ELE+
Sbjct  360  SVMENQGKEAERKAVQATLEKIRKASKGEILSLLPFLQTQISMLMNLEEMSDSFKGELED  419

Query  561  IAFQLDQLVQEYGLAAAASTDIEDSSTSP-SDSGAVAPTNVSAGAVSGKALPSRSSASRS  619
            I  QL  ++QE G   A +   EDS +SP   +G+++PT+                    
Sbjct  420  IMAQLGAIIQESGPLQATT---EDSPSSPLKRTGSMSPTS-------------------D  457

Query  620  GLVTTASSAGPTPTMEtslsstsfsssnsppksktsEFSQTAAYNFIDLQAIRKVQRRLS  679
            GL +  S+                                      +DLQAIRKVQRRL 
Sbjct  458  GLQSNGSA--------------------------------------VDLQAIRKVQRRLG  479

Query  680  TLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECEELLDSRHQESKIFLEAMG  739
            TL+YASEL  P QQHL  IA+QL+LQ +AN  VD+VI  EC+ L+++R QES++ +E M 
Sbjct  480  TLVYASELGPPWQQHLHFIADQLLLQKHANSTVDEVIARECDNLIETRQQESRLLVEEMR  539

Query  740  REMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVMdlldalkdddeeklaaF  799
            + MEQQS LLH+Q EKLAKF L V LCME+S DKV Y++LSVMDLLD LK++DEE LA  
Sbjct  540  KRMEQQSGLLHDQVEKLAKFFLQVVLCMEESADKVEYVNLSVMDLLDTLKENDEETLAEL  599

Query  800  EAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHRKNGLATDHHVIAIEKQR  859
            E ++ QSCA LRH+PND VL+DEFQ SS LL  IE EYR Y ++  LA D++V+AI KQR
Sbjct  600  ETKFTQSCACLRHSPNDNVLRDEFQRSSELLMLIEGEYRAYDKRVSLAADNNVVAIAKQR  659

Query  860  QMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVNP  901
             ++L +LC +F L       + +A ++D FLSA++IE ++NP
Sbjct  660  SLYLQRLCDFFGLRQLHAPPSADAFNLDHFLSAQHIEQVLNP  701

 Score = 723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/776 (50%), Positives = 516/776 (66%), Gaps = 69/776 (9%)

Query  1060  VMEKVTVEFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLL  1119
             V+EKV  EFL L +P   +E ML   RD  VS+YD +   T+  T +TR++R A S+ LL
Sbjct  768   VLEKVEAEFLVLTVPSDTIESMLAVFRDVIVSKYDSNAAATSTQTEDTRDERHASSSMLL  827

Query  1120  EDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAID  1179
             E+RLR+HWPR GRL VQ YQPRMGEL++H+QRQER  R +  K + Q+ +F+ + + A+ 
Sbjct  828   EERLRVHWPRKGRLDVQFYQPRMGELLNHQQRQERHLRGLWAKVEEQQASFSKKTEEALA  887

Query  1180  HIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSS  1239
             ++EQ R+ QI+ QAQLP+Q SLAALQGLE K+KK L  FK E  +K  VLRAM E+D++ 
Sbjct  888   NVEQARIAQIAFQAQLPLQLSLAALQGLEVKAKKRLGVFKSEAMDKLAVLRAMTESDING  947

Query  1240  LISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQK  1299
             L+SS QD++RAC+SQLFPDLTSC++ISGCDYHP+EI+ +KEK+ A E Q R+RI ERE++
Sbjct  948   LLSSCQDYVRACSSQLFPDLTSCEIISGCDYHPEEIAAVKEKLSAIEAQARDRILEREKR  1007

Query  1300  IKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDER  1359
             + EI  +Q  V+ + Q+FKARYQAC+Q+L+MK+G GQK+GLPRR AQERYRSE+TRC+ R
Sbjct  1008  MTEISSSQALVLDMWQAFKARYQACVQSLAMKEGLGQKFGLPRRAAQERYRSEMTRCEAR  1067

Query  1360  SAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGR  1419
             SA I+ LLASL ++                                    LRAK+Y+RG 
Sbjct  1068  SASINALLASLQSI------------------------------------LRAKIYHRGM  1091

Query  1420  CFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNF  1479
              F  L++ SQLE  PVEF+P    G +    +V RDR+VVDE+D + ++       FL+F
Sbjct  1092  YFRFLRSPSQLEPRPVEFNPVAAQGDEEGLSTV-RDREVVDEEDQALATP------FLDF  1144

Query  1480  VQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQV  1539
               +VSAKC+E+T+ +YQQEGK EELP   VP +LEEYL    EKAR +V+ QE  Y EQ 
Sbjct  1145  ADQVSAKCQEETKALYQQEGKTEELPPSGVPVALEEYLASQQEKARSFVIQQEELYSEQ-  1203

Query  1540  HFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELC  1599
                                 ++K+ +      ++   EA++ ++M  K++H++ELRP LC
Sbjct  1204  --------------------QAKQQMRLRVSDITTVFEAQYQSWMNIKSQHTLELRPHLC  1243

Query  1600  SPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILD  1659
             SPNN   LQ L +RE SRS  T   L + R Q +  Q Q S AFE  LV +F+C M +LD
Sbjct  1244  SPNNAHLLQELEEREKSRSASTRVALLNHRNQFLAGQIQLSMAFEARLVGLFQCLMLLLD  1303

Query  1660  TCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVP  1719
             + V + DDLKPFSGEELPK KRKSLKRLRK+AR+ E GD  EVKRT AE+QKLTQ GE P
Sbjct  1304  SSVLSPDDLKPFSGEELPKAKRKSLKRLRKMARVNEVGDPREVKRTAAEMQKLTQSGEAP  1363

Query  1720  RFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPT----DEAIKALDCSKFATADDGA  1775
             RFP RSWP I +FG  ++WE  + + L  D      +    + +I+ L C   A+ +DGA
Sbjct  1364  RFPLRSWPGIPSFGLQSLWEEIKAETLTKDEGIAFASTGTAESSIQDLACVPLAS-NDGA  1422

Query  1776  CVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
             CVALLT AHR+L+ ARDTAYAAY+ FC  + ++L+D++ E+L DE+KW QSWQ+GI
Sbjct  1423  CVALLTPAHRALIKARDTAYAAYVGFCREETRRLLDSLHERLEDEVKWTQSWQKGI  1478

>SPRG_05305
Length=1658

 Score = 732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/1789 (32%), Positives = 867/1789 (48%), Gaps = 183/1789 (10%)

Query  64    KSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGasdnsnnddasscan  123
             K+  +   D+  +R E+R     V EED +V +VR+L              +  + + A 
Sbjct  31    KALNISDADMRSYRIEHRG----VTEED-MVTEVRELYHQ----------RSTTSEAPAE  75

Query  124   GPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKAT  183
                  I+ NA+ RR++H AAQ  Y  Q+K ISE +E  I++ +D +KD L    +     
Sbjct  76    KKNDKIQANAMRRRERHTAAQALYQVQLKTISEQLEGDILRISDTIKDDLLVVKTTTDEH  135

Query  184   SNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLM  243
                L     L+ AS+D V   W R +E +  QRT  I +F + L+ IE +R++ V   L 
Sbjct  136   FGRLRSKPWLIAASHDLVDDAW-RALEQLWIQRTLTIVSFGESLEAIEQSRSELVGAELR  194

Query  244   KLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLA  303
             KLTE  +  A+ LPPEVER+IE EA+ELN+V+ +NR+ +A L++R+   DV  FV+ R A
Sbjct  195   KLTETCVAAAYVLPPEVERLIEVEAHELNIVLITNRRSHAHLLSRLLKEDVHKFVDIRTA  254

Query  304   WEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAYLKQ  363
             WE  +R+WR L H  AI  FQ  L S L+  P     IL ++   Q  +H  +RL  L+Q
Sbjct  255   WEDCERNWRALNHDHAIEVFQTTLTSPLYMAPPSLHAILSQLRDAQRLVHENERLLLLQQ  314

Query  364   LEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEI  423
             L+   A L S+  + ++ S +    +EE +N  +F+ L        ++A  LRE LR   
Sbjct  315   LDQHGANLPSDAIQKLVVSFAEMYKKEEERNATYFDMLFRCQASIVADAVGLREQLRATC  374

Query  424   HGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNL  483
             H  GA A EG +    ++LA  L +  L++FFR+ GGLR EL S+ +RL   E+IY  N+
Sbjct  375   HRVGAKADEGCLGQHAAQLAAFLGNKDLDDFFRIAGGLRSELASIEERLASPEMIYQANV  434

Query  484   QPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVG  543
               L   + +L+ ALPLE +++ QGK  ERK LQ TLE++RKA K+EIL +LP +  Q V 
Sbjct  435   AALEPRVGLLVHALPLESILDAQGKSNERKTLQGTLERLRKAPKNEILSILPLVHAQTVS  494

Query  544   LSNLNDMSEEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNVSAG  603
             L+ +  +    ++ELEEIA +LD L+QE   + A+ST     ++ P  S A    ++   
Sbjct  495   LAAIQGLHPMLQSELEEIAKRLDILMQENS-SDASSTHAATIASDPPGSAASKSKSIGLD  553

Query  604   AVSGKALPS-RSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppksktsEFSQTAA  662
             A     +   R +  R G +  AS   PT                               
Sbjct  554   AFQIIDIQGIRKAQRRLGTLVYASDLPPT-------------------------------  582

Query  663   YNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECEE  722
                        VQ  L+ +L A                 L +Q +AN VVD ++  EC+ 
Sbjct  583   -----------VQSLLAVILDA-----------------LRVQGHANDVVDAIVATECDG  614

Query  723   LLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVM  782
             L+  R  E K  L  +G  +E Q+  LH   +++ +F      C+E   ++ R ++L+V+
Sbjct  615   LIALREAEMKALLTLVGAGLEAQTTTLHLSCDRVTRFVHKAVTCLEAYEERTRVVNLTVL  674

Query  783   dlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHR  842
             DLLD LK+  E+ +AA E  +    + LRHAP++A L+ EF     LL++I+ EYR Y++
Sbjct  675   DLLDTLKESHEDNVAALEEAFSARRSALRHAPDEAALEAEFANCLGLLERIDDEYRKYNK  734

Query  843   KNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVNPP  902
             K  LA+ +H IAI +Q  ++   L  +F   V S   + E  D+D  +SA+ IE  +N P
Sbjct  735   KVTLASTNHPIAITRQAALYRNMLSSHF--GVVSATHDDET-DIDALVSAECIERAINDP  791

Query  903   PPASEIEEEGERVENPQEggvaatatitagggsgvtPRSEPVPAHPEKPQKTGKQTDASP  962
              P +        V  P+               +G      P  A PE   + G     S 
Sbjct  792   EPVAAA------VIEPEPPAPVVEVPPGPTPRNGKKELVTPGRAVPEPAMEAGTGATVSA  845

Query  963   RVPPETVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPE-----------  1011
                P T A   K+  R  S           ELL  ILAH       EP            
Sbjct  846   PTKPATPAVKPKKEARVCSS---------DELLEFILAHKILLPGEEPSDDDVDAAPDAV  896

Query  1012  SSAPDAELpteppvvppqpSISAGEPEAGSVDEETlalaarqqlqqnqVMEKVTVEFLRL  1071
             ++  D  +  +           A  P  G V                          + L
Sbjct  897   NTDDDTAMIHDAVSSELVAPAVANVPALGDV-------------------------IVVL  931

Query  1072  EIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSG  1131
              +P   +  +L  +R+A ++ ++   K          +  V +  FLLE+ LRMHWPR G
Sbjct  932   TVPKPYLLSLLEQLRNAMLASFESKSKLHVQSAKCDADAHVEEYAFLLEECLRMHWPRKG  991

Query  1132  RLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISC  1191
             R  VQIYQPR GEL+SHRQR  R  +++LKK   QE+ F    + A+  +       +  
Sbjct  992   RTDVQIYQPRAGELVSHRQRHGRHIKNILKKLTLQESAFLELHESALACVRNQENILLGL  1051

Query  1192  QAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVL----RAMIEADLSSLISSLQDF  1247
             QAQL MQTSLAALQGLE +SK     FK      AN+L    R  +  + ++L +  ++ 
Sbjct  1052  QAQLLMQTSLAALQGLESRSKTTYVEFK---SAWANILSTKMRVYLTDEPAALAAMCREL  1108

Query  1248  LRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQ  1307
             +  C+  +FPDL S +VISGCDYHPDE+  ++  +   E  +++ ++ R++ I  +   +
Sbjct  1109  VTTCSHHIFPDLNSVEVISGCDYHPDEVKYVQSLVGETEATIQKAVAHRKEMIDALEGLE  1168

Query  1308  NQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELL  1367
               ++ L  +FK RYQAC+QNLS+K+G GQKYG+PRR AQER RSE++R DE +  I+ LL
Sbjct  1169  QGILSLLATFKTRYQACIQNLSIKEGLGQKYGMPRRNAQERLRSEMSRSDEMARSIESLL  1228

Query  1368  ASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNL  1427
             ++L  M  + E       LK   +  +    L S I    L+LR  MY RG   G+LKN 
Sbjct  1229  STLRVMTTSRECA-----LKGPHAPSNLVRQLRSVI----LELRHIMYTRGLYLGVLKN-  1278

Query  1428  SQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssN-ALFLNFVQEVSAK  1486
              ++++ P                 V  D +   + D        ++   F+ +  +  A+
Sbjct  1279  -KMQVAP---------------RKVPDDLEATTKYDTDVRHEAIADIKTFMEWTVQFEAQ  1322

Query  1487  CREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIK-YREQVHFFGEL  1545
             C  DT+ ++Q EGK  ELP   VP +L+EYL     KA +Y VH +IK ++ QV  F  +
Sbjct  1323  CIADTKSLFQAEGKAMELPPDGVPDTLKEYLADQKSKATIY-VHAQIKAFKGQVKAFAAV  1381

Query  1546  LALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKL  1605
             LA+AP  AL + + R+K  +      L    EAE A +  QK RH   L P+LCSPN   
Sbjct  1382  LAVAPAVALDNIVARAKAAVEAKVHGLVTAFEAERADWEAQKQRHKSSLTPDLCSPNRVA  1441

Query  1606  QLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTL  1665
              ++AL  +E +R+ Q  A +++ R  V+      +    K L+A F   M ILD+CV   
Sbjct  1442  AVEALCAKEAARTLQVQAAIRNVRWSVLEEHIGNARVVHKRLLAAFVSLMEILDSCVMPD  1501

Query  1666  DDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRS  1725
             D  K   G+E  K ++   +  + + ++ E GD      +  E + L    E  RFPKR+
Sbjct  1502  DLAKDEDGDEEEKKRKSLKRLRKALRKV-EHGDPLAAALSIDERKVLDAAKETQRFPKRA  1560

Query  1726  WPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHAHR  1785
             WP +    A  I  A Q      D + ++   E +            +GA VA LT AHR
Sbjct  1561  WPGLPIVAAFEIPLAVQ-----EDTKGKVFAAEVVDG----------NGAMVAYLTEAHR  1605

Query  1786  SLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATM  1834
             + V  RD+ Y AY A+C A  +         L +E  W  +W + I +M
Sbjct  1606  AAVLGRDSTYNAYRAYCAAAIETWTKHYTALLTEEELWFLNWGKLIQSM  1654

>PITG_20628
Length=1449

 Score = 671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/780 (48%), Positives = 497/780 (64%), Gaps = 77/780 (10%)

Query  1060  VMEKVTVEFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLL  1119
             V+EKV  EFL L +P   +E +L + RDA +S+Y  D  K    T ETR+ R A  + LL
Sbjct  734   VLEKVQAEFLVLNVPSDTVESLLASFRDAILSKYHTDAAKNDTQTKETRDDRQASFSMLL  793

Query  1120  EDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAID  1179
             ++RLR+HWPR+GRL VQ+YQPR+GEL++H+QRQER  R V  K D Q+  FA++V+ A+ 
Sbjct  794   KERLRVHWPRNGRLDVQLYQPRVGELLNHQQRQERLLRGVWLKMDEQQVAFATKVEEALV  853

Query  1180  HIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSS  1239
             HIEQ R+ QI  QAQLP+Q SLAALQGLE K+KK L  FK E  E   VLRAM  +D+ S
Sbjct  854   HIEQTRMAQIGFQAQLPLQQSLAALQGLEVKAKKRLGVFKGEAMEILAVLRAMTASDIDS  913

Query  1240  LISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQK  1299
             L+SS QD++RAC+SQLFPDL S ++ISGCDYHP EI+ ++EK+   E Q R++ISERE++
Sbjct  914   LLSSCQDYVRACSSQLFPDLMSSEIISGCDYHPGEITAIREKLATIEAQARDQISEREKQ  973

Query  1300  IKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDER  1359
             I EI   Q+Q + + ++FKAR Q CMQ+L+MK+G GQK+GLPRRT QERYRSE+TRC+ R
Sbjct  974   IDEISSKQSQNMDIWETFKARSQTCMQSLAMKEGLGQKFGLPRRTDQERYRSEMTRCEAR  1033

Query  1360  SAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGR  1419
             SA I+ LLASL+++                                    LRAK+Y+RG 
Sbjct  1034  SATINTLLASLDSL------------------------------------LRAKIYHRGM  1057

Query  1420  CFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNF  1479
              FG L+N SQLEL P EFDP+ G   +     V+RD +VVDE+D   +        FL F
Sbjct  1058  YFGFLRNPSQLELKPAEFDPATGRQDE-----VIRDHEVVDEEDRILAVP------FLEF  1106

Query  1480  VQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQV  1539
               +VSAKC+E+T+ +Y+QEGK EELP   +P +LEEYL    EKAR +V+ QE+ YREQ 
Sbjct  1107  ADQVSAKCQEETKALYEQEGKNEELPPVYLPAALEEYLSSQMEKARSFVLQQEVSYREQ-  1165

Query  1540  HFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELC  1599
                          A  +  ++  ++            E  + ++M+ K  H++ELRP LC
Sbjct  1166  -------------AKQEIRRKISDIFFA--------FEPLYQSWMDLKTHHTLELRPHLC  1204

Query  1600  SPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILD  1659
             SPNN   LQ L  RE  RS  T + L   R+  +    Q S +FE  L+ +  C M  LD
Sbjct  1205  SPNNGHLLQELEKREKVRSTSTQSALDDIRSLFLADHIQISLSFEARLIRLSHCLMLFLD  1264

Query  1660  TCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVP  1719
             + V +LDD+KPFSGE+L  LKRKSLKRLRKVAR++EFG   EVKRT AELQ LTQ GEVP
Sbjct  1265  SSVLSLDDVKPFSGEKL--LKRKSLKRLRKVARVKEFGYSHEVKRTAAELQILTQSGEVP  1322

Query  1720  RFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQ-----LPTDEAIKALDCSKFATADDG  1774
             RFP RSW  I  FG  ++WE  +  I   D   Q     + TD +I+ L C   A+ +DG
Sbjct  1323  RFPLRSWAGIPFFGLQSLWEEVKADIQAKDLARQCYGSDVQTDFSIQNLTCVPLAS-NDG  1381

Query  1775  ACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGIATM  1834
             ACVALLT AHR+L+ ARDT+YA Y+ FC  + ++ +D + E++ DE+KW + W++GI  M
Sbjct  1382  ACVALLTPAHRALIQARDTSYADYITFCREEIRRCLDNLHERMDDEVKWTRGWEKGILRM  1441

 Score = 644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/761 (48%), Positives = 494/761 (65%), Gaps = 68/761 (9%)

Query  141  MAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKATSNSLADDVLLLKASNDD  200
            M AQ  Y E+VK ISED+E AII  AD VK+ LA  DS ++     L ++ LLL +  D 
Sbjct  1    MEAQVLYAEEVKAISEDVEVAIIHAADHVKEVLAVIDSGIREAKVVLTNNELLLASDADK  60

Query  201  VLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLMKLTEVLMDTAHALPPEV  260
            +L MW  E++A+C  RT +I  FA  L++IE  R +R+R  L +LT VLM+TAHALPPEV
Sbjct  61   ILGMWS-ELDAVCQHRTDEIEQFAAGLEEIEQARIRRIRGRLQRLTYVLMETAHALPPEV  119

Query  261  ERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLAWEKGQRHWRQLRHKDAI  320
            ERIIE+EAYE+N VV SNR+V+ADLVAR+ TA+VD+F++ARLAWE+GQ  WR LRH +AI
Sbjct  120  ERIIEAEAYEVNTVVISNRRVFADLVARLETANVDIFLDARLAWERGQTRWRHLRHDEAI  179

Query  321  YRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAYLKQLEDakaelssekakaIL  380
              FQ  L+S LFTDP+ERR +L++I ++QE +H  +RLA L+QL++A A L+S++   IL
Sbjct  180  ASFQATLHSPLFTDPEERRLVLEQIRVFQEKLHIEQRLAVLQQLKEAGASLTSDQVTRIL  239

Query  381  HSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEIHGFGAMAKEGEIELCQS  440
              +S TQ  EE  N  F  +L  +   K   A+ LREALRLE+HGFG+MAKEG I+  ++
Sbjct  240  EELSCTQQIEEENNQFFLSELKQLDESKGDAAKALREALRLELHGFGSMAKEGAIQEAKA  299

Query  441  KLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQPLTTSLQVLLSALPLE  500
             L  LL+D S+E+ FR  GGL+ ELD++ K+L+ ++LIY  NL+P+ +S+ VLLSALPL 
Sbjct  300  ALVMLLSDDSMEDLFRAAGGLKTELDTLAKQLNTADLIYNTNLEPVVSSVGVLLSALPLT  359

Query  501  EVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGLSNLNDMSEEFKNELEE  560
             VME QGK A RKA+Q+TLEK+RKA K EI+ LLPSLQ+Q+  L+NL  M ++F+ EL +
Sbjct  360  NVMEKQGKEAGRKAVQSTLEKVRKATKGEIMSLLPSLQSQISMLTNLEGMGDKFQAELGD  419

Query  561  IAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNVSAGAVSGKALPSRSSASRSG  620
            I+ QL+ +++E G              S   +GA  P  +S         P+ S    SG
Sbjct  420  ISVQLNTILRENG--------------SVQGTGASIPAPISMN-------PTSSVPQCSG  458

Query  621  LVTTASSAGPTPTMEtslsstsfsssnsppksktsEFSQTAAYNFIDLQAIRKVQRRLST  680
                                                       N +DLQAIRK+QRRL  
Sbjct  459  -------------------------------------------NAVDLQAIRKMQRRLGM  475

Query  681  LLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECEELLDSRHQESKIFLEAMGR  740
            LLYASEL+ P Q+HL  IAEQL LQ NAN++VD++I+ EC+  +D+R Q+ +I ++ MG+
Sbjct  476  LLYASELDVPWQEHLHFIAEQLELQTNANRIVDEIISRECDPQIDTRQQKGRILVDEMGK  535

Query  741  EMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVMdlldalkdddeeklaaFE  800
             MEQQSA L++  EKLAKF L V  C+E+SVDKV+Y++LSVM   D L   DE+ LA  E
Sbjct  536  RMEQQSAQLYDHVEKLAKFFLRVVRCLEESVDKVQYVNLSVM---DLLDTLDEDTLADLE  592

Query  801  AQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHRKNGLATDHHVIAIEKQRQ  860
             ++ QSC RLRH+P   VL++EFQ SS LL  IE EYR Y ++  LA  ++V AI  QR 
Sbjct  593  TKFTQSCTRLRHSPTTNVLREEFQRSSDLLLLIEGEYRTYDKRVSLAAGNNVAAIATQRL  652

Query  861  MFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVNP  901
            ++L +LC  F L       + E L+VD FLSA++IE+++ P
Sbjct  653  LYLERLCDLFGLKQLHQTKSDEVLNVDHFLSAQHIEEMLKP  693

>PITG_21065
Length=613

 Score = 572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/723 (46%), Positives = 439/723 (61%), Gaps = 123/723 (17%)

Query  1117  FLLEDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKL  1176
              LLE+RLR+HWPR+GRL VQ+YQPR+GEL++H+QRQER  R V  K D Q+  FA++V+ 
Sbjct  1     MLLEERLRVHWPRNGRLDVQLYQPRVGELLNHQQRQERLLRGVWLKMDEQQVAFATKVEG  60

Query  1177  AIDHIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEAD  1236
             A+ HIEQ R+ QI  QAQLP+Q SLAALQGLE K+KK                       
Sbjct  61    ALVHIEQTRMAQIGFQAQLPLQQSLAALQGLEVKAKKRW---------------------  99

Query  1237  LSSLISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISER  1296
                L+SS QD++RAC+SQLFPDL S ++ISGCDYHP EI+ ++EK+   E Q R++ISER
Sbjct  100   --VLLSSCQDYVRACSSQLFPDLMSSEIISGCDYHPGEITAIREKLATIEAQARDQISER  157

Query  1297  EQKIKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRC  1356
             E++I EI   Q+Q + + ++FKAR Q CMQ+L+MK+G GQK+GLP+RTAQERYRSE+TRC
Sbjct  158   EKQIDEISSKQSQNMDIWETFKARSQTCMQSLAMKEGLGQKFGLPKRTAQERYRSEMTRC  217

Query  1357  DERSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYN  1416
             + RSA I+ LLASL+++                                    LRAK+Y+
Sbjct  218   EARSATINTLLASLDSL------------------------------------LRAKIYH  241

Query  1417  RGRCFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALF  1476
             RG  FG L+N SQLEL P EFDP+ G   +     V+RD +VVDE+D   +        F
Sbjct  242   RGMYFGFLRNPSQLELKPAEFDPATGRQDE-----VIRDHEVVDEEDWILAVP------F  290

Query  1477  LNFVQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYR  1536
             L F  +VSAKC+E+T+ +Y+QEGK EELP    PP L                 +++ YR
Sbjct  291   LEFADQVSAKCQEETKALYEQEGKNEELP----PPPL----------------WRKVSYR  330

Query  1537  EQVHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRP  1596
             EQV  + +LL LAP   L                         + ++M+ K  H++ELRP
Sbjct  331   EQVDLYADLLTLAPGFPL-------------------------YQSWMDLKTHHTLELRP  365

Query  1597  ELCSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMT  1656
               CSPNN   LQ L  RE  RS  T + L   R+  +    Q S +FE  L+ +  C M 
Sbjct  366   HYCSPNNGHLLQELEKREKVRSTSTQSALYDIRSLFLADHIQISLSFEARLIRLSHCLML  425

Query  1657  ILDTCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLG  1716
              LD+ V +LDD+KPFSGE+L  LKRKSLKRLRKVAR++EFG   EVKRT AELQ LTQ G
Sbjct  426   FLDSSVLSLDDVKPFSGEKL--LKRKSLKRLRKVARVKEFGYSHEVKRTAAELQILTQSG  483

Query  1717  EVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQ-----LPTDEAIKALDCSKFATA  1771
             EVPRFP RSW  I  FG  ++WE  +  I   D   Q     + TD +I+ L C   A+ 
Sbjct  484   EVPRFPLRSWAGIPFFGLQSLWEEVKADIHAKDLARQCYGSDVQTDSSIQNLTCVPLAS-  542

Query  1772  DDGACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
             +DGACVALLT AHR+L+ ARDT+YA Y+ FC  + ++ +D + E++ DE+KW   W++GI
Sbjct  543   NDGACVALLTPAHRALIQARDTSYADYITFCREEIRRCLDNLHERMDDEVKWTLGWEKGI  602

Query  1832  ATM  1834
               M
Sbjct  603   LRM  605

>PHYCA_122982
Length=613

 Score = 550 bits (1416),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 326/723 (45%), Positives = 424/723 (59%), Gaps = 122/723 (17%)

Query  1117  FLLEDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKL  1176
              LLE+RLR+HWPR GRL VQ YQPRMGEL++H+QRQER  R V  K D Q+  FA++VK 
Sbjct  1     MLLEERLRVHWPRKGRLDVQFYQPRMGELLNHQQRQERYLRGVWIKVDEQQLAFANKVKE  60

Query  1177  AIDHIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEAD  1236
             A++H+E  R+ QIS QAQLP+Q SLAALQGLE K+KK                       
Sbjct  61    ALEHVEHTRITQISFQAQLPLQLSLAALQGLEVKAKK----------------------H  98

Query  1237  LSSLISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISER  1296
             L  L+SS QDF+RAC+SQLFPDLTSC++ISGCDYHP+EI+  KE++ A E Q R++ISER
Sbjct  99    LGVLLSSCQDFVRACSSQLFPDLTSCEIISGCDYHPEEIAATKERLAAVEAQARDQISER  158

Query  1297  EQKIKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRC  1356
             E++I +I   Q+QV+ + Q FKARYQ   Q+L+MK+G GQK+GLPRR AQERYRSE+TRC
Sbjct  159   ERQILDISTKQSQVLDIWQDFKARYQVYTQSLAMKEGLGQKFGLPRRAAQERYRSEMTRC  218

Query  1357  DERSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYN  1416
             + RS  IDELL+SL++                                     LRAK+Y+
Sbjct  219   ESRSTAIDELLSSLDS-------------------------------------LRAKIYH  241

Query  1417  RGRCFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALF  1476
             RG  FG L+  SQLE   VE+               +RD +VVDE+D + +        F
Sbjct  242   RGMKFGFLRCPSQLEPKAVEY----DPSVGQEKGEAIRDVEVVDEEDRTLAVP------F  291

Query  1477  LNFVQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYR  1536
             L F  +V  +C+E+T+++YQQEGK+EEL     PPS                  QE+ YR
Sbjct  292   LEFADQVGLRCQEETKRLYQQEGKMEEL-----PPS-----------------GQEVSYR  329

Query  1537  EQVHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRP  1596
             EQV  F  LL+L P                           A++ ++ + K++HS+ELRP
Sbjct  330   EQVASFVHLLSLVPGI-------------------------AQYQSYTQVKSQHSLELRP  364

Query  1597  ELCSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMT  1656
              LCS NN   L+ L +RE  RS+ T   L   R Q +  Q Q S  FE   V + +C M 
Sbjct  365   NLCSLNNAQLLRELEERERVRSESTRLALLGLRIQFLTEQIQLSLVFEARFVKLCQCLMQ  424

Query  1657  ILDTCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLG  1716
             +LD+ V +LDDLK FS EE PK+KRKSLKRLRKVAR+ E GD  EVKRT  E QKLTQ G
Sbjct  425   LLDSSVLSLDDLKSFSQEEPPKVKRKSLKRLRKVARVNEHGDPKEVKRTSVEQQKLTQNG  484

Query  1717  EVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHD-----GQHQLPTDEAIKALDCSKFATA  1771
             E PRFP RSWP I +FG   +WE  + ++L  D           T   ++ L C    + 
Sbjct  485   ETPRFPLRSWPRIPSFGVKVLWEEVKAEVLAKDSTGLSLDSSSSTASTVQDLACIPLVSI  544

Query  1772  DDGACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
              DGACV LLT AHR+LV  RD+AY  Y+ FC    +  ++ + E+L DE+KW  SW++GI
Sbjct  545   -DGACVTLLTSAHRALVRVRDSAYGDYVNFCSEATRCFLEHLHERLEDEVKWTLSWEKGI  603

Query  1832  ATM  1834
              +M
Sbjct  604   DSM  606

>PHALS_05192
Length=1672

 Score = 542 bits (1396),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 328/782 (42%), Positives = 458/782 (59%), Gaps = 64/782 (8%)

Query  89   EEDELVAQVRQLQDNFYIVGasdnsnnddasscanGPKSHIEVNAIARRDKHMAAQHEYT  148
            EE+ ++ +++QL+D    VG   N +   +        S IE+N ++RR+ HM A  EY 
Sbjct  64   EEERIMLEIQQLRDIDSTVGTITNQSQYSSEIV-----SQIELNVVSRRNCHMGALMEYG  118

Query  149  EQVKRISEDIESAIIKCADAVKDALAQFDSRLKATSNSLADDVLLLKASNDDVLRMWERE  208
            + V+ ISED+ESAII+ AD VK  ++  DSR+     +L+ D +LL +    +L MW  E
Sbjct  119  QDVEAISEDVESAIIRAADDVKVTVSTIDSRIYDFEAALSKDTILLASDKAHILSMWN-E  177

Query  209  MEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLMKLTEVLMDTAHALPPEVERIIESEA  268
            ++AIC QRT  IA FA  LD IE +R   VR  L +LT  LMD A+ LP EVERIIESEA
Sbjct  178  LDAICQQRTDAIAQFAARLDGIERSRMHCVRDRLKRLTCALMDAAYVLPYEVERIIESEA  237

Query  269  YELNVVVTSNRKVYADLVARMATADVDVFVNARLAWEKGQRHWRQLRHKDAIYRFQGILN  328
            YE+N VV SN  VYADLVA+M T +VD+F+  RLAWE+ Q  WR LRH+DAI +F   L+
Sbjct  238  YEVNTVVISNGVVYADLVAKMDTKNVDIFLKIRLAWEQAQIRWRHLRHRDAITKFHSTLS  297

Query  329  STLFTDPDERRKILKEIWMYQESIHNGKRLAYLKQLEDakaelssekakaILHSISTTQA  388
            S LFTDPDER+ + K+I  +QE  +  +RL  +  L DA   LSS   K IL  +   + 
Sbjct  298  SPLFTDPDERQHVQKQIRDFQEKFYTEQRLDVITHLSDAGVTLSSVDVKQILEKLRCMRR  357

Query  389  EEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEIHGFGAMAKEGEIELCQSKLATLLND  448
             EE  N  F   L  V   K++ A  LRE+LR E+H  GA+AKEG IE  ++ L TLL+D
Sbjct  358  YEEESNRSFELALQDVGKLKSAAANVLRESLRFELHDCGALAKEGNIEDAKTALVTLLHD  417

Query  449  PSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQPLTTSLQVLLSALPLEEVMETQGK  508
               EE F    GL+ +LD + K+L ++ +IY  NL PL + ++VL+SA+PL+++ME QGK
Sbjct  418  DEAEELFSAASGLKTDLDHLAKQLCVANVIYCDNLAPLLSFVEVLVSAVPLKKMMEKQGK  477

Query  509  GAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGLSNLNDMSEEFKNELEEIAFQLDQL  568
              ER A+Q TL+KIRK  K +++ LLPSL  Q++ L NL +M + FK EL +IA QL   
Sbjct  478  DFERMAVQLTLKKIRKGTKRDMMALLPSLHAQVLMLLNLEEMGDCFKAELRDIAAQL---  534

Query  569  VQEYGLAAAASTDIEDSSTSPSDSGAVAPTNVSAGAVSGKALPSRSSASRSGLVTTASSA  628
                                             A  ++  +L     A+ + + T  +SA
Sbjct  535  --------------------------------KATLLAHDSLHGVEVAASTSMTTMETSA  562

Query  629  GPTPTMEtslsstsfsssnsppksktsEFSQTAAYNFIDLQAIRKVQRRLSTLLYASELN  688
             P                           +  A    +DL AIRKVQRRL  LLY SEL 
Sbjct  563  LPLNGK-----------------------TSDAVEEKLDLPAIRKVQRRLENLLYTSELG  599

Query  689  QPIQQHLSLIAEQLILQANANKVVDQVITAECEELLDSRHQESKIFLEAMGREMEQQSAL  748
               QQ LS I EQL+LQ  AN+VVD V+T EC+E++++R QE  +F++ + + +E QS  
Sbjct  600  ASWQQLLSFIFEQLLLQNAANRVVDDVVTRECDEVIETRQQEGMLFVKEIEKRIEMQSTQ  659

Query  749  LHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVMdlldalkdddeeklaaFEAQYLQSCA  808
            LHN+ E +  F L V LC+E+ +D+ ++++ S M LLD LK ++E  L   E + +QSC 
Sbjct  660  LHNRVENVVNFFLRVVLCLEEIIDRDKHVNTSAMSLLDTLKKNNENALQDLETKLMQSCT  719

Query  809  RLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHRKNGLATDHHVIAIEKQRQMFLGKLCK  868
            RLRH+PN  +L+DEFQ SS LL  IE  YR Y  +  LA +++V  I KQR ++  +LC+
Sbjct  720  RLRHSPNIDILRDEFQHSSDLLDHIEENYRTYAEQVSLAANNNVTVITKQRLLYRQRLCE  779

Query  869  YF  870
            +F
Sbjct  780  FF  781

 Score = 458 bits (1179),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 300/775 (39%), Positives = 443/775 (57%), Gaps = 26/775 (3%)

Query  1060  VMEKVTVEFLRLEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLL  1119
             V  KV  +FL L IP + +E +L   RDA + +YD +    +N +  T  +R A S  LL
Sbjct  914   VSSKVQEDFLVLNIPNARVESLLAIFRDAVLYKYDLETANVSNQSKTTCAERHASSAILL  973

Query  1120  EDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAID  1179
             ++R+R H PR  +L ++I+Q RMGEL  H++RQER  R +    + Q+  FA +++ +  
Sbjct  974   KERIRNHCPRKEKLDLEIHQTRMGELSIHQKRQERYLRGLCLMEEKQQLKFAKKLEESYA  1033

Query  1180  HIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSS  1239
             ++EQVR+  IS  AQLP+Q S+A LQ  E ++KK L   + E  +   +L AM     + 
Sbjct  1034  YVEQVRMVCISFYAQLPLQLSVATLQCFEAQAKKHLGVLRSESTKTFKMLEAMTAIGNNR  1093

Query  1240  LISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQK  1299
             L+SS QD++R C+ QLF DLTS  V+S CDYHP+EI  +KEK V  E + R+++ ERE++
Sbjct  1094  LLSSCQDYIRTCSLQLFSDLTSFQVVSKCDYHPNEIISIKEKFVTLEARARDQMLEREKQ  1153

Query  1300  IKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDER  1359
             I+E+   Q+QV ++ + FK R Q+C Q+L MK+G  Q   LPRR A E  R E++RC  R
Sbjct  1154  IEEVKNKQDQVFKMYEGFKERAQSCKQSLVMKEGLNQTLRLPRRIALESIREEMSRCKIR  1213

Query  1360  SAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGR  1419
             S  + ELL S+ ++V        +   K           ++   +R LLQLRAK+Y  G 
Sbjct  1214  STLVSELLRSVQSVVAGEHSGDHSHGQK-----------VTGDAIRILLQLRAKIYYLGM  1262

Query  1420  CFGLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNF  1479
               G+L+  +QLE  PV      G   +   D +  D  V +E  M           FL+F
Sbjct  1263  YLGILRCPNQLEPKPVVLRLGIGRKIEDKYDVIRDDVVVDNEDRMLAVP-------FLDF  1315

Query  1480  VQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQV  1539
             V +V+ KC+++T+ + + + K +E    +V  +LEE+L    EKAR ++  Q   YREQV
Sbjct  1316  VDQVNNKCQQETKTLLEHDVKNDETSKSNVFAALEEFLSTQLEKARDFLRLQRTSYREQV  1375

Query  1540  HFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELC  1599
               +  LL L PE  + +  K++KE L   +    + L+++   + +QK  H +EL P LC
Sbjct  1376  QLYAHLLTLVPEVVVINMAKQAKESLHQQSFEQMSTLQSQLKLWSDQKTSHMLELGPHLC  1435

Query  1600  SPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILD  1659
             + NN   L  L  RE SRS  T   L+  RA+ +  Q Q S  FE + + + +CF+++LD
Sbjct  1436  NANNLHLLHDLEVRERSRSTLTQVALRKARAEYLAKQIQMSLEFEAQFIELCQCFVSLLD  1495

Query  1660  TCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAEL-QKLTQLGEV  1718
             + V +LDDLKPFS EE    KRKSLKRLRK+AR  E  D  +     A++  +++Q  EV
Sbjct  1496  SSVLSLDDLKPFSSEENSAHKRKSLKRLRKLARGNELSDPQKAAYRSAKVPHQMSQHDEV  1555

Query  1719  PRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKAL-DCSKFA-TADDGAC  1776
             PRFP RSWPSI   G H  W   + ++L  +     PTD    A+ D S    T+DDG C
Sbjct  1556  PRFPLRSWPSIPTVGLHLHWAEVKAKLLADN-----PTDRPDLAICDLSIVPLTSDDGTC  1610

Query  1777  VALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGI  1831
             V+LLT AHR+L+ ARD AY  Y  FC  +  +++D I+E  +DE  W Q+W++ I
Sbjct  1611  VSLLTPAHRALIKARDRAYVDYGHFCREETSRILDNIKEWDQDEDNWAQNWEKKI  1665

>H257_06280
Length=1742

 Score = 418 bits (1075),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 277/786 (35%), Positives = 405/786 (52%), Gaps = 72/786 (9%)

Query  1071  LEIPVSVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRS  1130
             L++P S +  ML  +RDA ++ ++       +        R+    FLLE+ LRMHWPR 
Sbjct  1003  LDVPKSTLLSMLLRLRDATMTLFESRSAAHLDEANAEATARLDAYTFLLEECLRMHWPRK  1062

Query  1131  GRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQIS  1190
             GR  VQIYQPR GEL+SHRQR  R  ++VLKK   QE  F      A+  +      Q+ 
Sbjct  1063  GRTDVQIYQPRAGELVSHRQRHGRHVKNVLKKLAVQEARFVQLHDQALGCLRGQENAQLG  1122

Query  1191  CQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLS----SLISSLQD  1246
              Q+QL MQTSLAALQGLE +SKK+   FK       ++LR  +   L+    +LI++ ++
Sbjct  1123  LQSQLLMQTSLAALQGLESRSKKVHVEFKAAW---GDLLRVKMAVYLTDEPLALIATCRE  1179

Query  1247  FLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEA  1306
              +  C  Q+FPDL SCDVISGCDYHPDE+  ++  +   E Q++  ++ R+  I  +   
Sbjct  1180  LVTTCAHQIFPDLVSCDVISGCDYHPDEVKLVQVLVTEAETQIQAAVAARKATIDALEGQ  1239

Query  1307  QNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDEL  1366
             + +V  L  +FK RY +C+QNLSMK+G GQKYG+PRR AQER RSE+TR D  ++ ID+L
Sbjct  1240  EGRVGALLATFKTRYHSCLQNLSMKEGLGQKYGMPRRNAQERLRSEMTRSDNMASSIDDL  1299

Query  1367  L-----ASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCF  1421
             L     A+  A V +     SN               ++  + + +L+LR  +Y+RG   
Sbjct  1300  LHVLTQAATTATVPSGPKGPSN---------------VARHVRKVVLELRHLVYSRGLYL  1344

Query  1422  GLLKNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNAL---FLN  1478
             G+L N  QL   PV+                  D +   + D       +S A+   FL+
Sbjct  1345  GVLTNKMQLAPQPVK-----------------DDMEASTKYDADAPVDAASAAVSKSFLD  1387

Query  1479  FVQEVSAKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQ  1538
               ++   +C  DTR ++  EGK   L + S+P +L+ YLH   EK+  YV HQ   YR Q
Sbjct  1388  ITKQFEVQCVADTRALFAAEGK--PLDDHSIPDTLQAYLHEQHEKSVAYVRHQVAAYRAQ  1445

Query  1539  VHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPEL  1598
             VH F   LA AP  A+ D ++R+K  +      +    + +F A+   K++H  +L P+L
Sbjct  1446  VHAFEAALATAPRVAMEDIVRRAKSAVQSRVGAVEAAFQKQFLAWEGLKDQHRAKLTPDL  1505

Query  1599  CSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTIL  1658
             CSPN    ++ L  +E +R+      ++  R QV++     +  F + LVA+FR  M+IL
Sbjct  1506  CSPNQVAVVEGLCVKEATRTAAVQEAIRAVRWQVLVEYVVNARGFHRRLVAVFRAMMSIL  1565

Query  1659  DTCVTTLDDLKPFSG----------EELPklkrkslkrlrkVARIQEFGDVCEVKRTDAE  1708
             DTC  T D   P +           +  P  KRKSLKRLRK  R  E GD   V+ ++ E
Sbjct  1566  DTCTMTADIQPPAASGGAEGSNSHEDTEPTHKRKSLKRLRKALRKLEQGDPLAVELSEDE  1625

Query  1709  LQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKF  1768
                L +  E  RFPKR+WP + A  A  +  A  ++        Q  TD  +  +D    
Sbjct  1626  RDALDEANETQRFPKRAWPGLPAVPAFDV--AASIK--------QDTTDGVVPPVDP---  1672

Query  1769  ATADDGACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQ  1828
             A  D   CVA LT AHR+ V +R+  +AAY  + D     +       LR+E  W  +W 
Sbjct  1673  ADVDTAVCVAYLTDAHRAAVKSRNETHAAYCGWLDETMDAMGRKYTTLLREEELWFLNWG  1732

Query  1829  QGIATM  1834
             +   +M
Sbjct  1733  KLTQSM  1738

 Score = 315 bits (806),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 180/447 (40%), Positives = 274/447 (61%), Gaps = 8/447 (2%)

Query  129  IEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKATSNSLA  188
            I  NA  RRD+H AAQ +Y  ++K IS+ +E+ I++ +DA+K+ LA   +   AT+N  A
Sbjct  109  IAANAKRRRDRHTAAQSQYQLRLKAISDQLETDILRISDAIKEELAGVAA---ATANHFA  165

Query  189  ---DDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLMKL  245
               D+  L++AS+  V+  W   +  + + RT  I  F   L+ IE TR+      L  L
Sbjct  166  LLTDEPWLIQASHAMVVDQWT-HLNELWSGRTCTIRHFGDGLEAIEQTRSALAGAELQLL  224

Query  246  TEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLAWE  305
            TE  +  A+ LPPEVER IE EA+ELNVV+ +NR+ +  LV+RM   DV  FVN R  WE
Sbjct  225  TETCVAAAYVLPPEVERAIEDEAHELNVVLITNRRSHCHLVSRMLKEDVHKFVNVRTTWE  284

Query  306  KGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAYLKQLE  365
              +RHWR L H  AI+ F+  L S L+T P     IL+++   Q ++H  +RLA L QL+
Sbjct  285  DCERHWRVLNHDHAIHMFKATLESDLYTHPPRLHAILEKLRADQVAVHTNERLALLSQLD  344

Query  366  Dakael-ssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEIH  424
                   S+EK + ++ +++    +EE +N  +F+QL +   D  +EA  +RE LR   H
Sbjct  345  GLVTGGLSTEKVQRMVSALADMYKKEEERNAAYFDQLFTCQRDIVAEAAAMRELLRATCH  404

Query  425  GFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQ  484
              GA AKEG +    ++L TLL D +L+EFFR++GGLR EL ++  RL   ++IY  N+ 
Sbjct  405  RVGAKAKEGALATIATQLTTLLADKNLDEFFRISGGLRAELAAIEDRLASPDMIYQENVT  464

Query  485  PLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGL  544
             L   + +L++ALP+E +++ QGK +ERK +QATLE++RKA K+EI+PLLP+L  Q   L
Sbjct  465  ALVPRVAMLVAALPMEAILDAQGKSSERKLIQATLERLRKAPKNEIVPLLPTLLAQTTIL  524

Query  545  SNLNDMSEEFKNELEEIAFQLDQLVQE  571
            + +  + +  + EL++I  +LD L+Q+
Sbjct  525  AGIQGIDDTLRLELDDIGRKLDSLIQD  551

 Score = 149 bits (375),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 139/239 (58%), Gaps = 3/239 (1%)

Query  662  AYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECE  721
            A+   D+Q IRK QRRL TL+Y ++L  P Q  L +I + L +Q +AN VVD ++  EC 
Sbjct  571  AFQIADMQGIRKAQRRLGTLVYTTDLPPPFQALLHVILKALEVQTHANTVVDAIVALECN  630

Query  722  ELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSV  781
             L+  R +E    +  +G  +E  +  LH   +++A+F   +  C+E   DK R ++L+V
Sbjct  631  SLMAQREREMDALVAVVGSGLEAHTTTLHVTCDRIARFFYQLVACVENYEDKTRVVNLTV  690

Query  782  MdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYH  841
            MDLLD LKD  +  +AA EA++    + LRHAP++A L+ EF     LL+ +E EYR Y+
Sbjct  691  MDLLDTLKDTHDGNVAACEAEFAVKRSALRHAPDEATLEREFTGCLGLLEGLEDEYRKYN  750

Query  842  RKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVN  900
            +K  LA+ +H IAI +Q   F  +LC +F L   S   +     ++  LSA+ IE  ++
Sbjct  751  KKVSLASTNHPIAISRQNNAFQNELCAFFGLLSPSLGVSTA---INDLLSAERIEAAID  806

>H310_09237
Length=1748

 Score = 409 bits (1052),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 289/790 (37%), Positives = 403/790 (51%), Gaps = 69/790 (9%)

Query  1071  LEIPVSVMEHMLTTMRDAFVSRYDC-DGKKTTNVTAETREQRVADSNFLLEDRLRMHWPR  1129
             L++P S +  ML  +RDA +S ++   G       AE    RV    FLLE+ LRMHWPR
Sbjct  1003  LDVPQSTLLSMLLRLRDATMSLFETRSGAHLDEANAEA-HTRVEAYTFLLEECLRMHWPR  1061

Query  1130  SGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVK--  1187
              GR  VQIYQPR GEL+SHRQR  R  ++VLKK  AQE  F   VKL  D +  +R +  
Sbjct  1062  KGRTDVQIYQPRAGELVSHRQRHGRHIKNVLKKLAAQEAEF---VKLHDDALACLRAQEN  1118

Query  1188  -QISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEAD-LSSLISSLQ  1245
              Q+  Q+QL MQTSLAALQGLE +SKK+   FK    +   V  A+   D  ++LI++ +
Sbjct  1119  AQLGLQSQLLMQTSLAALQGLESRSKKVHIEFKAAWSDLLRVQMAVYLTDEPTALIATCR  1178

Query  1246  DFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVE  1305
             + +  CT Q+FPDL SCDVISGCDYHPDE+  +   +   E  +   ++ R+  +  +  
Sbjct  1179  ELVTTCTHQIFPDLVSCDVISGCDYHPDEVKLVHAIVSEAEMTIHTAVAGRKAVMDALES  1238

Query  1306  AQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDE  1365
              +++V  L  +FK+R+Q C+Q LSMK+G GQKYGLPRR AQER RSE+TR D  ++ I +
Sbjct  1239  QESRVGALLATFKSRHQTCLQTLSMKEGLGQKYGLPRRNAQERLRSEMTRSDNMASTISD  1298

Query  1366  LLASLN-AMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLL  1424
             LL  L  A   T  P                 + L+  + + LL+LR  MY RG   G+L
Sbjct  1299  LLDMLKQAATTTAAPPGPKG-----------PSNLARHVRKLLLELRHVMYIRGLYLGVL  1347

Query  1425  KNLSQLELTPVEFdpsggggadgsgdsVLRDRDVVDEQDMspssslssNALFLNFVQEVS  1484
              N  QL+  PV+ D                D D   + D +  +S      FL+  ++  
Sbjct  1348  VNKMQLQPKPVKDDLEASTKY---------DADAPLDHDFASVTS------FLDTTKQFE  1392

Query  1485  AKCREDTRQIYQQEGKLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGE  1544
             A+C  D+R ++  EGK   + + ++P +L+ YL    EK+  YV HQ   Y +QV  F  
Sbjct  1393  AQCVADSRALFAAEGK--PMDDNNIPDTLQAYLREQREKSVGYVEHQVAMYHDQVKAFEV  1450

Query  1545  LLALAPESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNK  1604
              LA+AP  A+ D ++R+K  +    + +    E +F  +   K +H  +L P+LCSPN  
Sbjct  1451  ALAIAPRLAMEDIVRRAKATVQRLVDAIEVAFETQFQEWEAVKEKHKSQLTPDLCSPNQV  1510

Query  1605  LQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTC---  1661
               +++L  +E +R+      ++H R QV++     +  F K L AMF   M+ILD+C   
Sbjct  1511  AVVESLCAKEAARTAAVQDAIRHVRWQVLVQHVICARGFHKRLTAMFHAMMSILDSCTMA  1570

Query  1662  ------------VTTLDDLK-PFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAE  1708
                          T  DD   P  G      K KSLKRLRK  R  E GD   V+ +D E
Sbjct  1571  RDIQSPPATSTHTTGTDDADGPNKGASDVFHKPKSLKRLRKALRKIEQGDPLAVELSDDE  1630

Query  1709  LQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKF  1768
                L    E+ RFPKR+WP +       I  A             +  D  I   D    
Sbjct  1631  KDALDDAKELQRFPKRAWPGLPIVPVFDIAPA-------------IKDDTKISPADVVPP  1677

Query  1769  A-TADDGACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSW  1827
                AD  ACVA LT AHR+ V AR+  +AAY  + DA    L       L DE  W  +W
Sbjct  1678  PEPADTAACVAYLTDAHRAAVKARNETHAAYCEWFDASMAALGTKYTTLLHDEELWFLNW  1737

Query  1828  QQGIATM-HD  1836
              + I +M HD
Sbjct  1738  GKLIQSMRHD  1747

 Score = 323 bits (827),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 184/449 (41%), Positives = 274/449 (61%), Gaps = 2/449 (0%)

Query  124  GPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKAT  183
            G    I  NA+ RRD+H AAQ +Y  ++K ISE +E+ I++ +DA+K+ LA   +     
Sbjct  108  GKVDKIAANAMRRRDRHTAAQAQYQARLKAISEQLETDILRISDAIKEELATVAAANDNH  167

Query  184  SNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLM  243
               L ++  L+ AS+  V+  W   +E + + RTR I  F   L+ IE TR+      L 
Sbjct  168  FALLTNEPWLIHASHAMVVEQWA-HLEGLWSGRTRTIRQFGDGLEAIEQTRSALAGVELQ  226

Query  244  KLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLA  303
             LTE  +  A+ LPPEVER IE EA+ELNVV+ SNR+ +  LV+RM   D   FV+ R+ 
Sbjct  227  LLTETCVAAAYVLPPEVERAIEVEAHELNVVLISNRRSHCHLVSRMLKEDAQKFVHVRIM  286

Query  304  WEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESIHNGKRLAYLKQ  363
            WEK +RHWR L H  AI  F+  L S L+T P    +IL  +   Q S+H  +RLA L Q
Sbjct  287  WEKCERHWRVLNHDHAIQHFKITLESPLYTHPPRLHEILANLRADQLSVHTNERLALLGQ  346

Query  364  LEDakae-lssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLE  422
            L+      LS+++   I+ +++    +EE +N ++F QL +   D  +EA  LRE LR  
Sbjct  347  LDGLVGGGLSTQRVHRIVLALADLYKKEEERNAEYFNQLFTCQRDIVAEAAALREQLRAT  406

Query  423  IHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCN  482
             H  GA AKEG++    ++L  LL D SL+EFFR++GGLR EL ++  RL   ++IY  N
Sbjct  407  CHRVGAKAKEGDLATIATQLTALLADKSLDEFFRLSGGLRAELAAIEDRLASPDMIYQEN  466

Query  483  LQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMV  542
            +  L   + +L++ALPLE +++ QGK +ERKA+QATLE++RKA K+EI+PLLP L  Q  
Sbjct  467  VAALMPRVAMLVAALPLESILDAQGKSSERKAIQATLERLRKAPKNEIVPLLPILLAQTT  526

Query  543  GLSNLNDMSEEFKNELEEIAFQLDQLVQE  571
             L+ +  + +  +++L++IA +LD L+Q+
Sbjct  527  TLAGIQGIDDTLRHDLDDIAGKLDSLIQD  555

 Score = 148 bits (373),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 139/239 (58%), Gaps = 3/239 (1%)

Query  662  AYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECE  721
            A+   D+Q IRK QRRL TL+Y ++L  P Q  L      L +Q +AN VVD +++ EC 
Sbjct  575  AFQIADMQGIRKAQRRLGTLVYTTDLPPPFQSLLHATLSALEVQTHANAVVDGIVSHECN  634

Query  722  ELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSV  781
             LL  R +E    +  +G  +E  + +LH   +++A+F   +  C E   D+ R ++L+V
Sbjct  635  GLLGLREREMDALVATVGAGLEAHTTILHVTCDRVARFFYQLVACTETYEDRTRVVNLTV  694

Query  782  MdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYH  841
            MDLLD LKD  +  +AA EA++  + + LRHAP++A L+ EF+    LL+++E EYR Y+
Sbjct  695  MDLLDTLKDTHDSHVAACEAEFSTTRSALRHAPDEAALEREFRQCLDLLERLEDEYRKYN  754

Query  842  RKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVN  900
            +K  LA+ +H IAI +Q   F   LC +F L      A      +D  LSA+ IE+ ++
Sbjct  755  KKVSLASTNHPIAIARQNHAFRNDLCAFFGL---QPPAGGVPAALDDLLSAEVIENAID  810

>SDRG_06608
Length=1245

 Score = 357 bits (915),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 254/731 (35%), Positives = 379/731 (52%), Gaps = 61/731 (8%)

Query  662   AYNFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECE  721
             A+   D+Q IRK QRRL TL+YAS+L   I+  LS+I + L +Q +AN VVD ++  EC+
Sbjct  556   AFQINDIQGIRKAQRRLGTLVYASDLPTSIKSLLSIILDALRVQGHANDVVDAIVATECD  615

Query  722   ELLDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSV  781
              L+  R  E K  L  +G  +E Q+  LH   +++ +F   V  C+E   ++ R ++L+V
Sbjct  616   GLIALREAEMKALLTLVGAGLEAQTTTLHLACDRVTRFVHMVVACLEAYEERTRVVNLTV  675

Query  782   MdlldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYH  841
             +DLLD LKD  EE +AA E  +    + LRHAP++A L+ EF    +LL++IE EYR Y+
Sbjct  676   LDLLDTLKDTHEENIAALEDAFSSRRSALRHAPDEAALEAEFVNCLSLLERIEDEYRKYN  735

Query  842   RKNGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVNP  901
             +K  LA+ +H IAI +Q  ++   L  +F +   + D   +  D+D  +SA+ IE  +N 
Sbjct  736   KKVTLASTNHPIAITRQAALYRNMLSGHFGVESNTHD---DETDIDALVSAECIERAIND  792

Query  902   PPPASEIEEEGERVENPQEggvaatatitagggsgvtPRSEPVPAHPEKPQKTGKQTDAS  961
             P P   + E       P+                   P +  V   P    + GK+   +
Sbjct  793   PAPVIAVME-------PE-------------------PPAPAVEVTPGPTPRNGKKELVT  826

Query  962   PR---VPPE-------TVAAGAKQPFRASSGFEAGVVSAVPELLSKILAHVDADESAEPE  1011
             P    V P        TV+  AK    A    +   V +  ELL  IL H       EP 
Sbjct  827   PGRAVVEPAMEAGTGATVSVPAKPATPAVKPKKEARVCSSDELLEYILVHKILLPGEEPS  886

Query  1012  SSAPDAELpteppvvppqpSISAGEPEAGSVDEETlalaarqqlqqnqVMEKVTVEFLRL  1071
                                       +  +V ++  +  A   L     +  V V    L
Sbjct  887   DDD------------VDAAPDVVSTNDTATVHDDHSSELAAPALANVPALRDVIV---IL  931

Query  1072  EIPVSVMEHMLTTMRDAFVSRYDCDGK---KTTNVTAETREQRVADSNFLLEDRLRMHWP  1128
              IP   +  +L  +R+A ++ ++   K   K+ N  AET  +  A   FLLE+ LRMHWP
Sbjct  932   TIPKPHLLSLLDRLRNAMLAAFESKSKLHVKSANRDAETHVEEYA---FLLEECLRMHWP  988

Query  1129  RSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQ  1188
             R GR  VQIYQPR GEL+SHRQR  R  +++LKK   QET F      A+  +       
Sbjct  989   RKGRTDVQIYQPRAGELVSHRQRHGRHIKNILKKLSVQETAFLELHASALACVRDQENAL  1048

Query  1189  ISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANV-LRAMIEADLSSLISSLQDF  1247
             +  QAQL MQTSLAALQGLE +SK     FK    +  +  +R  +  + ++L +  ++ 
Sbjct  1049  LGLQAQLLMQTSLAALQGLESRSKTTYVEFKSAWADLLSTKMRVYLTDEPAALAAMCREL  1108

Query  1248  LRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVEAQ  1307
             +  C+  +FPDL S +VISGCDYHPDE+  ++  +   E  +++ ++ R + I+ +   +
Sbjct  1109  VTTCSHHIFPDLNSVEVISGCDYHPDEVKYVQSLVGETEATIQKAVAHRREMIEALEGLE  1168

Query  1308  NQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELL  1367
               ++ L  +FK RYQ C+QNLS+K+G GQKYG+PRR AQER RSE++R DE +  ID LL
Sbjct  1169  QGILSLLATFKTRYQTCIQNLSIKEGLGQKYGMPRRNAQERLRSEMSRSDEMAHSIDSLL  1228

Query  1368  ASLNAMVETNE  1378
             ++L  M  + E
Sbjct  1229  STLTVMTTSRE  1239

 Score = 305 bits (781),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 194/519 (37%), Positives = 287/519 (55%), Gaps = 20/519 (4%)

Query  57   QQHKQQS----KSHRLKQGDLAQFRKENRKDVRPVREEDELVAQVRQLQDNFYIVGasdn  112
            + HK+ S    K+  +   D+  +R E+R     V +ED +V +VR+LQ        +  
Sbjct  20   EYHKKDSSKTLKTLNISDADMRSYRIEHRG----VTDED-MVTEVRELQHQRNTTSEAPT  74

Query  113  snnddasscanGPKSHIEVNAIARRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDA  172
                            I+ NA+ RR++H AAQ  Y  Q+K ISE +E  I++ +D +KD 
Sbjct  75   EKK----------NDKIQANAMRRRERHTAAQSLYQVQLKTISEQLEGDILRISDTIKDD  124

Query  173  LAQFDSRLKATSNSLADDVLLLKASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIEL  232
            L    +        L     L+ AS+D V   W R +E +  QRT  I AF + L+ IE 
Sbjct  125  LLLVKTTTDEHFGRLRSKPWLIAASHDLVNDAW-RALEQLWIQRTLTIVAFGESLEAIEQ  183

Query  233  TRTKRVRKGLMKLTEVLMDTAHALPPEVERIIESEAYELNVVVTSNRKVYADLVARMATA  292
            +R++ V   L  LTE  +  A+ LPPEVER+IE EA+ELNVV+ +NR+ ++ L++RM   
Sbjct  184  SRSELVGAELRTLTETCVAAAYVLPPEVERLIEVEAHELNVVLITNRRSHSHLLSRMLKE  243

Query  293  DVDVFVNARLAWEKGQRHWRQLRHKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQESI  352
            DV  FV+ R AWE  +R+WR L H  AI  FQ  L+S L+  P      L ++   Q+ +
Sbjct  244  DVHKFVDVRTAWEACERNWRALNHDHAIEVFQETLSSPLYMAPPSLHATLSQLRDAQQRV  303

Query  353  HNGKRLAYLKQLEDakaelssekakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEA  412
            H  +RL  LKQL +  A L S+  + ++ S +    +EE +N  +FE L        ++A
Sbjct  304  HETERLVVLKQLGERGATLPSDAIQKLVVSFAEMYKKEEERNATYFEMLFRCQASIVADA  363

Query  413  QHLREALRLEIHGFGAMAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRL  472
              LRE LR   H  GA A EG +    ++LA  L +   ++FFR+ GGLR EL S+ +RL
Sbjct  364  VGLREQLRATCHRVGAKADEGCLGQHAAQLAAFLGNKEFDDFFRIAGGLRSELASIEERL  423

Query  473  DISELIYLCNLQPLTTSLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILP  532
               E+IY  N+  L   + +L+ ALPLE +++ QGK  ERK LQ TLE++RKA K+EIL 
Sbjct  424  ASPEMIYQANVISLEPRVGLLVHALPLESILDAQGKSNERKTLQGTLERLRKAPKNEILG  483

Query  533  LLPSLQTQMVGLSNLNDMSEEFKNELEEIAFQLDQLVQE  571
            +LP L  Q V L+ +  +    ++ELEEIA +LD L+ +
Sbjct  484  ILPLLHAQTVSLATIQGLHPMLQSELEEIAKRLDGLMHD  522

>PITG_21066
Length=472

 Score = 236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 180/252 (71%), Gaps = 5/252 (2%)

Query  664  NFIDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECEEL  723
            N +DLQAIRK+QRRL  LLYASEL+ P Q+HL  IAEQL LQ NAN++VD++I+ EC+  
Sbjct  153  NAVDLQAIRKMQRRLGMLLYASELDVPWQEHLHFIAEQLELQTNANRIVDEIISRECDPQ  212

Query  724  LDSRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVMd  783
            +D+R Q+ +I ++ MG+ MEQQSA L++  EKLAKF L V  C+E+SVDKV+Y++LSVMD
Sbjct  213  IDTRQQKGRILVDEMGKRMEQQSAQLYDHVEKLAKFFLRVVRCLEESVDKVQYVNLSVMD  272

Query  784  lldalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHRK  843
            LLD LK+DDE+ LA  E ++ QSC RLRH P   VL++EFQ SS LL  IE EYR Y ++
Sbjct  273  LLDTLKEDDEDTLADLETKFTQSCTRLRHLPTTNVLREEFQRSSDLLLLIEGEYRTYDKR  332

Query  844  NGLATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVNPPP  903
              LA  ++V AI  QR ++L +LC  F L       + E L+VD FLSA++IE+++ P  
Sbjct  333  VSLAAGNNVAAIATQRLLYLERLCDLFGLKQLHQTKSDEVLNVDHFLSAQHIEEMLKPIS  392

Query  904  PASEIEEEGERV  915
                 +E+G+R+
Sbjct  393  -----QEKGKRI  399

 Score = 157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 111/145 (77%), Gaps = 0/145 (0%)

Query  429  MAKEGEIELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQPLTT  488
            MAKEG I+  ++ L  LL+D S+E+ FR  GGL+ ELD++ K+L+ ++LIY  NL+P+ +
Sbjct  1    MAKEGAIQEAKAALVMLLSDDSMEDLFRAAGGLKSELDTLAKQLNTADLIYNTNLEPVVS  60

Query  489  SLQVLLSALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGLSNLN  548
            S+ VLLSALPL  VME QGK A RKA+Q+TLEK+RKA K EI+ LLPSLQ+Q+  L+NL 
Sbjct  61   SVGVLLSALPLTNVMEKQGKEAGRKAVQSTLEKVRKATKGEIMSLLPSLQSQISMLTNLE  120

Query  549  DMSEEFKNELEEIAFQLDQLVQEYG  573
             MS++F+ EL +I+ QLD +++E G
Sbjct  121  GMSDKFQAELGDISVQLDTILRENG  145

>CCA18900
Length=1564

 Score = 192 bits (487),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 200/773 (26%), Positives = 325/773 (42%), Gaps = 88/773 (11%)

Query  136  RRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKATSNSLADDVLLLK  195
            RR +H  AQ  Y E V   S+D+E  II   + +K  L   D +L +   +  D   L  
Sbjct  27   RRTQHTKAQENYNEAVTLSSKDLEHLIIDECNKLKSKLQSLDEKLVSGFLAFEDTSFLSS  86

Query  196  ASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLMKLTEVLMDTAHA  255
            A  +D+L  WE E EA C +R  +I  F+  L+  E  R++ + K +   TE+L+DT + 
Sbjct  87   AKYEDILNAWE-EWEATCQKRENEIEEFSTILERTEHRRSRLLSKEIQTYTEILLDTEYI  145

Query  256  LPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLAWEKGQRHWRQLR  315
            LPP  ERI+E E+++LNVVV SN   Y  L+ ++   +VD   NAR  WE G++ WRQ  
Sbjct  146  LPPVTERIVEKESHKLNVVVLSNLHQYTGLINKLLVTNVDFLQNARKHWEDGRQRWRQGH  205

Query  316  HKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQ-ESIHNGKRLAYLKQLEDakaelsse  374
            H   I   +  L S  F    E  +    +W    E IHN  RL  L  +++  A L+ E
Sbjct  206  HNKQIDELKASLMSLNFVFTREMEQTFG-LWRADLERIHNDNRLRVLSDMQNDGANLTVE  264

Query  375  kakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEIHGFGAMAKEGE  434
            K +AI   +++  A+E     + F  + S+   +        E  R  +H F  +    E
Sbjct  265  KIRAIRAQVASCDADENEITTRCFNTIRSIQDQQKRALSKHCENTRQALHEFTGLFHSTE  324

Query  435  IELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQPLTTSLQVLL  494
            +  C+ KL   L D  L EFF M  GL+  LD V   L   +LI       L   L V+ 
Sbjct  325  LLQCKQKLEMYLQDTLLAEFFLMADGLKIALDFVSNSLRSPQLIPHPEFTCLVDVLDVIT  384

Query  495  SA---LPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGLSNLNDMS  551
            +A   L LE     Q      ++++++LEK+R   K +++  L  LQT +  L  L D+ 
Sbjct  385  NASTRLILE-----QDHDNLSQSIKSSLEKLRGNDKSDLMENLLVLQTFLTSLQKLPDL-  438

Query  552  EEFKNELEEIAFQLDQLVQEYGLAAAASTDIEDSSTSPSDSGAVAPTNVSAGAVSGKALP  611
                                +G      + I++      DS  +A T  S    S K   
Sbjct  439  --------------------HGTVIKELSQIQNDLNDLLDSNKLAETENSLVTDSSK---  475

Query  612  SRSSASRSGLVTTASSAGPTPTMEtslsstsfsssnsppksktsEFSQTAAYNFIDLQAI  671
                    G++    + G                                      L +I
Sbjct  476  --------GVIANEVAMG--------------------------------------LNSI  489

Query  672  RKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECEELLDSRHQES  731
              ++RRL+ L+++S L     + L  I  QL+    A   +++ I      +L S  + +
Sbjct  490  SDIRRRLTILVHSSGLQDDFCKLLIHIRHQLLHHRRAGATLNEAIQPYENSMLLSIEELN  549

Query  732  KIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVMdlldalkdd  791
            +  ++      E Q   +  + E+   F  N+  C E   + + +I+ S   LL  + D 
Sbjct  550  RA-IQTFILAAENQKIRMQAKLERYLCFIGNIVDCKEAMQEDIEWINTSASTLLHTILDS  608

Query  792  deeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHRKNGLATDHH  851
                L   E+   +S   LR AP+  +L+ + +  + +  Q++ EY +Y  +   AT   
Sbjct  609  SARDLQVLESDLDKSSQLLRRAPDPYILEIKSRAITDMYLQLKNEYVLYDSRIKCATPLQ  668

Query  852  VIAIEKQRQMFLGKLCKYFRL------SVTSTDANQEALDVDKFLSAKYIEDI  898
              A       +L  L K+FRL       + + +++     ++K  +   IEDI
Sbjct  669  YRASRLILHRYLLCLVKHFRLVGKPEYDIENIESSASRSSLEKIFTPSGIEDI  721

 Score = 190 bits (483),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 190/749 (25%), Positives = 333/749 (44%), Gaps = 64/749 (9%)

Query  1076  SVMEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRLRMHWPRSGRLGV  1135
             +V   ML   R+    + D    +T         +R A+   LL+ RL +H  +      
Sbjct  847   TVFLTMLQKYREDLFVQLDAFSNRTFQSIRLLGMERAAEGQQLLDVRLSIHCIQKSTGDA  906

Query  1136  QIYQPRMGELMSHRQRQERQFRSVLKKADAQETTFASQVKLAIDHIEQVRVKQISCQAQL  1195
             + YQ R  EL  H+ + ER    + KK    +  F++         E+ R+ Q+S Q  L
Sbjct  907   EFYQTRKTELAKHKNQLERLHSRISKKLQLLQERFSTSSSGIQCQFEKHRILQLSLQTCL  966

Query  1196  PMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVLRAMIEADLSSLISSLQDFLRACTSQL  1255
             P+QT LA+L+ ++ K KK    FK++  +  +  +   E ++  + S L++++  C  ++
Sbjct  967   PLQTKLASLRSIQIKYKKNAAVFKIDSRKSLDNFKLRNEEEIMGMDSMLKNYINDCRKRV  1026

Query  1256  FPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQLRERISEREQKIKEIVE-AQNQVVQLA  1314
             F D T+ D+ S  DYH +E+  ++ ++ AF  ++      +   + + +E  + +++   
Sbjct  1027  FQDNTTEDIASHRDYHKNEVDTIEVELAAFAQKVDNEFHHQRLLLLDTMEQTREELLGKE  1086

Query  1315  QSFKARYQACMQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMV  1374
               F+ RY+    +L +K+G G K+G P+R AQ ++ SEV R D     ID LL   +  +
Sbjct  1087  GKFEERYRQAYHDLELKEGLGPKFGHPKRKAQMKFWSEVHRTDRDFDDIDHLLQDTSKKL  1146

Query  1375  ETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLLQLRAKMYNRGRCFGLLKNLSQLELTP  1434
                   K          ++       +   R +  LR+K Y+RG  F  LK   QL+ TP
Sbjct  1147  HLYFVSK---------EMETEALAFVADTFRSICTLRSKFYHRGVFFQFLKFKMQLKPTP  1197

Query  1435  VEFdpsggggadgsgdsVLRDRDVVDE--QDMspssslssNALFLNFVQEVSAKCREDTR  1492
             V         +  +   V       DE  Q          N+ F    +E+ +K  E+T+
Sbjct  1198  VSLLLLYPNESSNAQVEVYNTVKFADEACQKQDDECMYPPNSTFALVFEEIKSKLVEETQ  1257

Query  1493  QIYQQEG---KLEELPNGSVPPSLEEYLHGLSEKARVYVVHQEIKYREQVHFFGELLALA  1549
             ++   E     L E P+G  P SL +YL    +K +  +  ++ +Y+EQ++ F  +L LA
Sbjct  1258  KMLHDESGSTNLSEYPDG-CPTSLNKYLRETQQKFQAVLRDRKAQYQEQINEFRNILELA  1316

Query  1550  PESALGDFLKRSKELLGCSNERLSNELEAEFAAFMEQKNRHSVELRPELCSPNNKLQLQA  1609
               +     L  S     C+  R++NE +A    F   +   S                  
Sbjct  1317  IGAIFQIVLAES-----CA--RITNEEKAYSQQFQSVRMDDS------------------  1351

Query  1610  LSDREVSRSQQTVARLQHFRAQVMITQAQASFAFEKELVAMFRCFMTILDTCVTTLDDLK  1669
                ++  ++ + V     F A  +    +A+  FE  + A+   F+++LD+CV    DL 
Sbjct  1352  ---QKTGQTMEYVETTHGFYASGVQALYKAALVFEHNVSAVSEAFLSLLDSCVLDEHDLI  1408

Query  1670  PFSGEELPklkrkslkrlrkVARIQEFGDVCEVKRTDAELQKLTQLGEVPRFPKRSWPSI  1729
             P   +   + KRKSL++L+K+    E GD  EV  +  +L    + GE  R+PKR+ P I
Sbjct  1409  PMQDDPQSERKRKSLRKLQKLVNKAECGDKREVPHSAQDLDLWKKAGESARYPKRANPPI  1468

Query  1730  KAFGAHAIWEAQQVQILNHDGQHQLPTDE---AIKALD--CSKFATADD---GACVALLT  1781
             +        EA   Q L+      +P +E    ++ +D    KF    D    ACV L T
Sbjct  1469  Q--------EATPRQSLD----KHIPPEELGGILEGIDEEFYKFTGTKDLRARACVILST  1516

Query  1782  HAHRSLVSARDTAYAAYMAFCDAQNKQLV  1810
               HR ++  RD  ++++  +  A  ++LV
Sbjct  1517  SIHRKVIKCRDECHSSFKPYASAAAERLV  1545

>CCI45128
Length=1831

 Score = 189 bits (480),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 191/729 (26%), Positives = 326/729 (45%), Gaps = 69/729 (9%)

Query  1110  QRVADSNFLLEDRLRMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKADAQETT  1169
             +R  +   LL+  L  +  R  +   ++YQ R+ EL  H+   E     + KK    + +
Sbjct  904   ERANECKILLDAMLNENCRRKAKAETEMYQTRIAELAKHQDHFENFMLRISKKLGELQKS  963

Query  1170  FASQVKLAIDHIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKANVL  1229
             F +      D  E+ RV Q+S Q  LP+QT+L++L+ ++ K  K   AFK +  +  +  
Sbjct  964   FLATSHEIHDQFEKYRVLQLSLQTCLPLQTNLSSLKSVKVKYNKNAAAFKADTRKILDSF  1023

Query  1230  RAMIEADLSSLISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEISGLKEKMVAFEGQL  1289
             +   E ++  + + L+D++  C  + F + T   + S  DYH  EI+ L+  +VAF  ++
Sbjct  1024  KQRNEKEVMRMDTMLRDYIDHCRKRAFQEDTITGIASDHDYHLHEINNLEIALVAFAKKV  1083

Query  1290  RERISEREQKIKEIVE-AQNQVVQLAQSFKARYQACMQNLSMKDGFGQKYGLPRRTAQER  1348
                  ++   + + +E  + +++  + +F+ RY+A  QNL +K G G K+G P+R AQ +
Sbjct  1084  DTGFHQQRLFLLDTLEQTREEILSKSSNFEERYRAVYQNLELKGGLGLKFGHPKRNAQIK  1143

Query  1349  YRSEVTRCDERSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRKNYLSSAILRKLL  1408
             + SEV R D     ID LL + N         K +  LK+  +  +   ++S    RK+ 
Sbjct  1144  FWSEVHRTDRDVDDIDNLLQNTNT--------KLSFYLKSEQTESEGFVFISDT-FRKMC  1194

Query  1409  QLRAKMYNRGRCFGLLKNLSQLELTPVEFdpsggggadgsgdsV--LRDRDVVDEQDMsp  1466
              LR+K Y RG  F LLK   QL+   V F              V        VDE     
Sbjct  1195  ILRSKFYYRGVYFHLLKCKVQLKPKSVHFLLLYPNEQYLMNTEVEMFNTVKFVDETSSIQ  1254

Query  1467  ss--slssNALFLNFVQEVSAKCREDTRQIYQQEGK---LEELPNGSVPPSLEEYLHGLS  1521
                     N+ F    +E+ A   E+TR++Y  EG+   L E P+G  PPSL EYL    
Sbjct  1255  DDDCMYPLNSSFSLLFEEIKANLVEETRKMYHDEGRSADLSEYPDG-CPPSLNEYLSETQ  1313

Query  1522  EKARVYVVHQEIKYREQVHFFGELLALAPESALGDFLKRSKELLGCSNERLSNELEAEFA  1581
              K +  + H++ +Y+++++ F  +L LA ++     L+ S+  +    E  + +++    
Sbjct  1314  LKFQAVIRHRKAQYQQEINTFRNILELAIDAIFQIVLENSRAWMSNVEEVYTQQVQ----  1369

Query  1582  AFMEQKNRHSVELRPELCSPNNKLQLQALSDREVSRSQQTVARLQHFRAQVMITQAQASF  1641
                               S N+ L           ++  +V  + +   Q + T  +   
Sbjct  1370  ------------------STNDSL-----------KTVDSVETVHNADNQAVRTFYRVFL  1400

Query  1642  AFEKELVAMFRCFMTILDTCVTTLDDLKPFSGEELPklkrkslkrlrkVARIQEFGDVCE  1701
              FE  + A+   F+++LD+CV    DL     +   + KRKSL++L+K+A+I E GD  E
Sbjct  1401  VFEHNVSAVSEAFLSLLDSCVLDEHDLVIAQDDPPIERKRKSLRKLQKLAQIAECGDKRE  1460

Query  1702  VKRTDAELQKLTQLGEVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLP--TDEA  1759
             V  +  EL    + GE PRF KR+   I         E           +H  P   D  
Sbjct  1461  VPHSLQELDMWKKAGESPRFSKRAISPIPVSVPRQSLE-----------KHIQPEHLDSI  1509

Query  1760  IKALD--CSKFATADD---GACVALLTHAHRSLVSARDTAYAAYMAFCDAQNKQLVDTIQ  1814
             ++ +D    K   A D   G    L T  HR ++  R+ ++  + A   A   +L ++I 
Sbjct  1510  LEGIDQEILKLPGARDHGSGTSAILSTPLHRKVIKCRNESHFFFTAHASAIIARLSNSIL  1569

Query  1815  EKLRDELKW  1823
             +     L W
Sbjct  1570  DLTSQGLFW  1578

 Score = 167 bits (424),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 131/432 (30%), Positives = 215/432 (50%), Gaps = 5/432 (1%)

Query  136  RRDKHMAAQHEYTEQVKRISEDIESAIIKCADAVKDALAQFDSRLKATSNSLADDVLLLK  195
            RR +H  AQ  + E V+  + D E  II      KD L  FD RL A   +  D   +  
Sbjct  48   RRIQHTEAQETFYEAVRLSNHDFEELIISECTKSKDKLEGFDERLSAEFLAFEDTSFIFS  107

Query  196  ASNDDVLRMWEREMEAICTQRTRQIAAFAQELDDIELTRTKRVRKGLMKLTEVLMDTAHA  255
            A+ +DVL  W  E EA   +R+ +I   +  L+  E  R++ V K L + TE+L++  + 
Sbjct  108  ANYEDVLSAWA-ECEATYQKRSNEIENLSTILESTEHRRSRVVSKELQRYTEILLEIEYV  166

Query  256  LPPEVERIIESEAYELNVVVTSNRKVYADLVARMATADVDVFVNARLAWEKGQRHWRQLR  315
            LP  +ERI+E EAY+ NVVV  N + Y  L+ ++ +A+VD   NAR+ WE G+R WRQ  
Sbjct  167  LPSAIERIVEKEAYKSNVVVLRNLQQYTSLIEKLLSANVDALRNARVLWEGGRRRWRQSY  226

Query  316  HKDAIYRFQGILNSTLFTDPDERRKILKEIWMYQ-ESIHNGKRLAYLKQLEDakaelsse  374
            H   I + +  L S+      E ++ L EIW    E+IH+  RL  L ++    A L+ +
Sbjct  227  HNRQIDQLKTSLMSSDLLFSREMQQTL-EIWRADVETIHSDNRLLALSEMRKDGAYLTVD  285

Query  375  kakaILHSISTTQAEEEAKNHQFFEQLMSVHVDKTSEAQHLREALRLEIHGFGAMAKEGE  434
            K +A+   +++ + +E     + F+ +  +   +        E  R  +H    +    E
Sbjct  286  KIQAVRTQMASFEVDENRLTERCFKSIRLIQDQQKRALTKHCENTRQALHQCTGIFHSTE  345

Query  435  IELCQSKLATLLNDPSLEEFFRMTGGLRGELDSVVKRLDISELIYLCNLQPLTTSLQVLL  494
            +  C+ +L   L D +  EFF+M G LR  LD+V   L+ S++I    L  LT  L V+ 
Sbjct  346  LSKCKQRLEVYLQDKTFAEFFQMAGDLRLVLDTVSNSLEDSKVISHAELLRLTDLLDVIA  405

Query  495  SALPLEEVMETQGKGAERKALQATLEKIRKAGKHEILPLLPSLQTQMVGLSNLNDMSEEF  554
            +AL    ++E   +    ++++  LE +R+   ++ +  L +L T +  L  L D+    
Sbjct  406  NALT-SLILEKDHENI-LQSVKCLLETLRENEGNDSMEDLLTLGTHLDSLQKLPDLHISS  463

Query  555  KNELEEIAFQLD  566
              EL +I   L+
Sbjct  464  SRELSQIQNDLN  475

 Score = 45.4 bits (106),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 59/251 (24%), Positives = 109/251 (43%), Gaps = 8/251 (3%)

Query  666  IDLQAIRKVQRRLSTLLYASELNQPIQQHLSLIAEQLILQANANKVVDQVITAECEELLD  725
            +D + I  ++RRLS  +Y+S L +  Q+ L  I  QL+ Q  A ++ +  I      +L 
Sbjct  506  MDPKIIYDIRRRLSIFVYSSGLEEEFQKLLLYIRHQLLQQQRALELSNDAILPYETSILS  565

Query  726  SRHQESKIFLEAMGREMEQQSALLHNQTEKLAKFCLNVALCMEQSVDKVRYIDLSVMdll  785
            +  ++ K  ++      + ++  +    E+   F  ++A   E   + + ++  SV  LL
Sbjct  566  TSEEDGKA-IQTFIVATQTKNKAIQIGLERYICFIHDIAASKEAMQEDIEWVSSSVASLL  624

Query  786  dalkdddeeklaaFEAQYLQSCARLRHAPNDAVLQDEFQVSSTLLQQIEAEYRMYHRKNG  845
             +  + +   L   E  + ++   LRHAP+   L  E Q  + +    E  YR Y  +  
Sbjct  625  RSTMEGNARDLQILENNFNKASLLLRHAPDACSLDRELQEVTDINTHFEDAYRSYDFRIK  684

Query  846  LATDHHVIAIEKQRQMFLGKLCKYFRLSVTSTDANQEALDVDKFLSAKYIEDIVNPPPPA  905
                    A +     +L  L K+ RL V   +A  E  +++   S   +E +  P    
Sbjct  685  CVAPIQYQASQAILHRYLQFLVKHIRLVV---EAGLEVENIEISASRSSLEKLFLP----  737

Query  906  SEIEEEGERVE  916
            SEIEE   R++
Sbjct  738  SEIEEMVARIQ  748

>PYIR_21979
Length=228

 Score = 36.2 bits (82),  Expect = 1.4, Method: Composition-based stats.
 Identities = 32/101 (32%), Positives = 40/101 (40%), Gaps = 9/101 (9%)

Query  1712  LTQLGEVPRFPKRSWPSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATA  1771
             L QL   P F     PS+    AHA W A ++QI  H G    P D+        K A  
Sbjct  19    LQQLQSSPDFLPSISPSVVYSTAHAAWSALEMQIF-HKGLVDYPVDKYDNVTRYIKIAAM  77

Query  1772  DDGAC-------VALLTHAHRSLVSARDTAYAAYMAFCDAQ  1805
               G C       V +L+ +H S+   RD  YA  M     Q
Sbjct  78    LPGKCVRDVAFKVKVLSLSHESMSMNRDQ-YAKRMKIVPYQ  117

>H310_15242
Length=74

 Score = 33.5 bits (75),  Expect = 1.5, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 34/73 (47%), Gaps = 2/73 (3%)

Query  1304  VEAQNQVVQLAQSFKARYQAC-MQNLSMKDGFGQKYGLPRRTAQERYRSEVTRCDERSAK  1362
             V+ Q   V  A+SF AR+ AC + N+   D  G  Y +P R    R   E  + D +   
Sbjct  3     VDLQATRVDYARSFWARFSACDLGNIINIDEIGVHYDMPPRRTWARV-GETAKVDSQQKY  61

Query  1363  IDELLASLNAMVE  1375
              D + A+L   V+
Sbjct  62    SDRITAALTVRVD  74

>SDRG_00462
Length=190

 Score = 34.3 bits (77),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (43%), Gaps = 9/115 (8%)

Query  1727  PSIKAF---GAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACVALLTHA  1783
             PS KA+    AHA W AQ++ +L H G  Q P  E        K A    G C+  +   
Sbjct  21    PSPKAYVYSSAHATWSAQELHLL-HKGLTQYPAAEYDNVTRYIKIAATIPGKCIRDVAVK  79

Query  1784  HRSLVS-----ARDTAYAAYMAFCDAQNKQLVDTIQEKLRDELKWVQSWQQGIAT  1833
              RS+ +     A   +    M   DA +    + I++ L+  +  + + +  +AT
Sbjct  80    VRSMQASHEKMAEPPSKRPKMEHADAHDVSCEEQIKQSLQTNVSVINTMRANLAT  134

>PYIW_19954
Length=172

 Score = 33.5 bits (75),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 1/51 (2%)

Query  1727  PSIKAFGAHAIWEAQQVQILNHDGQHQLPTDEAIKALDCSKFATADDGACV  1777
             PS+    AHA+W +Q+ Q+  H G    P D+        K A    G CV
Sbjct  20    PSVMYSTAHAVWSSQETQLF-HQGLSDYPADKYDNVTRYIKIAALLPGKCV  69

>PYIW_16870
Length=898

 Score = 34.7 bits (78),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 58/276 (21%), Positives = 115/276 (42%), Gaps = 24/276 (9%)

Query  1167  ETTFASQVKLAIDHIEQVRVKQISCQAQLPMQTSLAALQGLEGKSKKLLKAFKVEGCEKA  1226
             ETT   +  +  D  E +RV++      LP    + AL G++G+ +KLLK+  +      
Sbjct  519   ETTKQLRAFMMADTFEHIRVQK----KDLP---EILALCGIQGQEEKLLKSVDLAADVVV  571

Query  1227  NVLRAMIEAD---LSSLISSLQDFLRACTSQLFPDLTSCDVISGCDYHPDEI-------S  1276
               L  ++      + SL+  + D+ R      + D    D I       D +       S
Sbjct  572   LPLTDVVVKSCRVVDSLVQMMYDYERYLNINDWGDAVRDDTIEALGSLNDVLNEVIDQRS  631

Query  1277  GLKEKMVAFEGQLRERISEREQKIKEIVEAQNQVVQLAQSFKARYQACMQNLSMKDGFGQ  1336
              L+  M    G     ++    + +++V+ Q +  + A+++       ++N  +      
Sbjct  632   DLQVSMAVMMGCNASFLACACDRFEQVVKVQTEAWE-ARTYGYSVNNTLRNHQLAKPNSN  690

Query  1337  KYGLPRRTAQERYRSEVTRCDERSAKIDELLASLNAMVETNEPKKSNDNLKTRSSLDDRK  1396
             +  L +  A++++ S +TR  +   KIDELL+S   +        +  +L+   S+ D  
Sbjct  691   RMLLSKAGAKKKFESTMTRAQDMLKKIDELLSSFYYLNWV----PAEVSLQPDPSMWDLI  746

Query  1397  NYLSSAI--LRKLLQLRAKMYNRGRCFGLLKNLSQL  1430
             NYL      L +L  +  +  +   C  + K++ QL
Sbjct  747   NYLKVTFSHLTQLPTVVREAIHFASCIHISKSMEQL  782

>PYVX_23137
Length=485

 Score = 34.3 bits (77),  Expect = 8.6, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query  577  AASTDIEDSSTSPSDSGAVAPTNVSAGAVSGKALPS-RSSASRSGLVTTASSAGPTPT  633
            A STD  D +T PS +GA + +  +  A +G    S  S+ S +G   T+   GP+PT
Sbjct  234  ADSTDTSDHAT-PSPTGATSTSEQTTPAPTGSTDTSDHSTPSPTGSTDTSDHGGPSPT  290

>PHYKE_10649
Length=356

 Score = 33.9 bits (76),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 50/122 (41%), Gaps = 31/122 (25%)

Query  1070  RLEIPVSV------MEHMLTTMRDAFVSRYDCDGKKTTNVTAETREQRVADSNFLLEDRL  1123
             +++IP+ V      M H   T+R  F+   D      T +     EQR+ D+     D+ 
Sbjct  155   KVDIPIIVVRYEDLMMHRAETLRRVFLFLTDL-----TTLEGTEWEQRIHDAMTTGGDKA  209

Query  1124  RMHWPRSGRLGVQIYQPRMGELMSHRQRQERQFRSVLKKA---------DAQETTFASQV  1174
               + PRSG++G            S R   E QF+ +LK A         D +   F +Q+
Sbjct  210   GPYKPRSGKIGA-----------SFRHYSEEQFQYILKTANLPLRGFGYDPETQDFPNQI  258

Query  1175  KL  1176
              L
Sbjct  259   SL  260

Lambda      K        H        a         alpha
   0.316    0.130    0.359    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 160406907606

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40