Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_144371114520020010392e-145
PYIR_21169836652002009134e-126
PYU1_G013641836652002009031e-124
PHYSO_501475111452002008927e-123
PYU1_G0059881001312002008822e-121
PYU1_G005989111452002008822e-121
PHYCA_508469111452002008813e-121
PYAP_21524945412002008804e-121
PYU1_G005987945412002008711e-119
PPTG_09250111452002008701e-119
PYU1_G005990111662002008641e-118
PHYRA_96097111662002008622e-118
PYIW_16204836652002008571e-117
PYAP_24850945452002008553e-117
PHYSO_285976836652002008553e-117
PHYSO_5001081001312002008553e-117
PHYSO_503540111662002008535e-117
PHYCA_118176111662002008535e-117
PPTG_09275111662002008536e-117
PITG_13737111451991998502e-116
PYU1_G005991945452002008492e-116
PHYCA_512169111672002008467e-116
PHYCA_5084911001312002008467e-116
PITG_13763111682002008459e-116
PHYSO_285972111672002008451e-115
PITG_13761111662002008414e-115
PHYKE_5842111455502008727e-115
PHYRA_71949111672002008389e-115
PHYRA_71950111682002008362e-114
PHYKE_4827111662002008336e-114
HYAP_08503111452802008391e-113
PYIW_266101658952002008181e-111
PYVX_14995111672002008181e-111
PHYRA_51797111451991998171e-111
PYAP_251481017342002008163e-111
PYAP_245291013341992008136e-111
PPTG_20266111672132008018e-109
PITG_13762111672002007954e-108
PYAP_245301013352581937971e-107
PPTG_17005435872002007851e-106
PYAP_251491017352002007851e-106
PPTG_17006435862002007842e-106
CCI42280111452002007642e-103
PHYCA_132728435862001987624e-103
PHYCA_124158426492001987624e-103
PHYCA_19840376012001987624e-103
PHYCA_132729435872001987582e-102
PHYKE_1631748182002007572e-102
PHYSO_285975473762001997554e-102
PHYSO_285974111682001997554e-102
PHYRA_71996693812002007512e-101
CCA15845111452002007503e-101
CCA274111579022002007503e-101
PHYRA_81696473762002007485e-101
PPTG_03020748182002007485e-101
PHYCA_118207473762002007442e-100
PHYCA_553014693812002007416e-100
PYVX_13848748182002007321e-98
PYIR_25908860551992007312e-98
PYU1_G002524860551992007216e-97
PYU1_G001466748182021997191e-96
PYAP_215251001311911917121e-95
PPTG_00540180062011987131e-95
PHYSO_491760576692011987033e-94
PHYSO_492858180062011987009e-94
PYAR_19739945412042006991e-93
PHYKE_35111671601606943e-93
PHYRA_71993508412011986973e-93
PYVX_220781116512672707582e-92
PHALS_11795111451831836814e-91
PHYSO_327921508412092006811e-90
PHYCA_121985511031991986757e-90
PHYRA_72407511031991986661e-88
PHYKE_8238771941991986566e-87
PITG_12444101492001646513e-86
PYAR_24476111452131486369e-84
PYAR_22252111672012026341e-83
PHYCA_553010452482002006262e-82
PHYCA_508489836651562006082e-80
PPTG_03053452482252006118e-80
PHYRA_82142748182002006036e-79
PYVX_245031013351131134792e-61
PYIW_26124748181391394743e-60
PITG_19721748181471994753e-60
PYAR_176241031272152184771e-59
PYIW_24901860551231243926e-48
PYVX_245418124382823817e-47
PPTG_202651116889893741e-45
PYIR_2530985567103783732e-45
PYIW_2566616517675753424e-41
PYIW_2681716610580973113e-36
PYAR_177319454563632991e-34
PYIR_1643374818102883021e-34
PITG_224621723764642625e-29
PHYSO_5259257481873742462e-26
PYVX_220818366545452084e-21
PHYKE_521910013138381595e-14
PHYKE_48268124338381482e-12
PHYSO_32987751103115711369e-10
PHALS_054313186448179770.40
SDRG_16426133753162857741.3
PITG_11840970410626691.4
PHYRA_723096943014783675.0
PHYCA_11520113865405106685.7
H257_03966148411667906710.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.12.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_14437

Length=200
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYIR_14437                                                            404     2e-145
PYIR_21169                                                            356     4e-126
PYU1_G013641                                                          352     1e-124
PHYSO_501475                                                          348     7e-123
PYU1_G005988                                                          344     2e-121
PYU1_G005989                                                          344     2e-121
PHYCA_508469                                                          343     3e-121
PYAP_21524                                                            343     4e-121
PYU1_G005987                                                          340     1e-119
PPTG_09250                                                            339     1e-119
PYU1_G005990                                                          337     1e-118
PHYRA_96097                                                           336     2e-118
PYIW_16204                                                            334     1e-117
PYAP_24850                                                            333     3e-117
PHYSO_285976                                                          333     3e-117
PHYSO_500108                                                          333     3e-117
PHYSO_503540                                                          333     5e-117
PHYCA_118176                                                          333     5e-117
PPTG_09275                                                            333     6e-117
PITG_13737                                                            332     2e-116
PYU1_G005991                                                          331     2e-116
PHYCA_512169                                                          330     7e-116
PHYCA_508491                                                          330     7e-116
PITG_13763                                                            330     9e-116
PHYSO_285972                                                          330     1e-115
PITG_13761                                                            328     4e-115
PHYKE_5842                                                            340     7e-115
PHYRA_71949                                                           327     9e-115
PHYRA_71950                                                           326     2e-114
PHYKE_4827                                                            325     6e-114
HYAP_08503                                                            327     1e-113
PYIW_26610                                                            319     1e-111
PYVX_14995                                                            319     1e-111
PHYRA_51797                                                           319     1e-111
PYAP_25148                                                            318     3e-111
PYAP_24529                                                            317     6e-111
PPTG_20266                                                            313     8e-109
PITG_13762                                                            310     4e-108
PYAP_24530                                                            311     1e-107
PPTG_17005                                                            306     1e-106
PYAP_25149                                                            306     1e-106
PPTG_17006                                                            306     2e-106
CCI42280                                                              298     2e-103
PHYCA_132728                                                          298     4e-103
PHYCA_124158                                                          298     4e-103
PHYCA_19840                                                           298     4e-103
PHYCA_132729                                                          296     2e-102
PHYKE_1631                                                            296     2e-102
PHYSO_285975                                                          295     4e-102
PHYSO_285974                                                          295     4e-102
PHYRA_71996                                                           293     2e-101
CCA15845                                                              293     3e-101
CCA27411                                                              293     3e-101
PHYRA_81696                                                           292     5e-101
PPTG_03020                                                            292     5e-101
PHYCA_118207                                                          291     2e-100
PHYCA_553014                                                          290     6e-100
PYVX_13848                                                            286     1e-98 
PYIR_25908                                                            286     2e-98 
PYU1_G002524                                                          282     6e-97 
PYU1_G001466                                                          281     1e-96 
PYAP_21525                                                            278     1e-95 
PPTG_00540                                                            279     1e-95 
PHYSO_491760                                                          275     3e-94 
PHYSO_492858                                                          274     9e-94 
PYAR_19739                                                            273     1e-93 
PHYKE_35                                                              271     3e-93 
PHYRA_71993                                                           273     3e-93 
PYVX_22078                                                            296     2e-92 
PHALS_11795                                                           266     4e-91 
PHYSO_327921                                                          266     1e-90 
PHYCA_121985                                                          264     7e-90 
PHYRA_72407                                                           261     1e-88 
PHYKE_8238                                                            257     6e-87 
PITG_12444                                                            255     3e-86 
PYAR_24476                                                            249     9e-84 
PYAR_22252                                                            248     1e-83 
PHYCA_553010                                                          245     2e-82 
PHYCA_508489                                                          238     2e-80 
PPTG_03053                                                            239     8e-80 
PHYRA_82142                                                           236     6e-79 
PYVX_24503                                                            189     2e-61 
PYIW_26124                                                            187     3e-60 
PITG_19721                                                            187     3e-60 
PYAR_17624                                                            188     1e-59 
PYIW_24901                                                            155     6e-48 
PYVX_24541                                                            151     7e-47 
PPTG_20265                                                            148     1e-45 
PYIR_25309                                                            148     2e-45 
PYIW_25666                                                            136     4e-41 
PYIW_26817                                                            124     3e-36 
PYAR_17731                                                            119     1e-34 
PYIR_16433                                                            120     1e-34 
PITG_22462                                                            105     5e-29 
PHYSO_525925                                                          99.4    2e-26 
PYVX_22081                                                            84.7    4e-21 
PHYKE_5219                                                            65.9    5e-14 
PHYKE_4826                                                            61.6    2e-12 
PHYSO_329877                                                          57.0    9e-10 
PHALS_05431                                                           34.3    0.40  
SDRG_16426                                                            33.1    1.3   
PITG_11840                                                            31.2    1.4   
PHYRA_72309                                                           30.4    5.0   
PHYCA_115201                                                          30.8    5.7   
H257_03966                                                            30.4    10.0  

>PYIR_14437
Length=200

 Score = 404 bits (1039),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP
Sbjct  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS
Sbjct  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE
Sbjct  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQIAKKLAA
Sbjct  181  LDVAKVQGESFAQIAKKLAA  200

>PYIR_21169
Length=200

 Score = 356 bits (913),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 188/200 (94%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHIA +AE +KEGVESV+GVTA IYQ+ ETLPE +LA +HAAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAEAIKEGVESVDGVTAEIYQIAETLPEEVLAKMHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFGFPTRFGS+P+QVKALFDSTGGLW +G L+GKPAGIFFSTG QG 
Sbjct  61   IATPDVLKEADGILFGFPTRFGSMPAQVKALFDSTGGLWQSGGLVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA+T+LTFLAHQG+T+VPLGYRSPLLF+FEEIHGGSPWGAG+ AGPDGSRQPSKLE
Sbjct  121  GQETTAYTALTFLAHQGLTFVPLGYRSPLLFSFEEIHGGSPWGAGSYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+AKKL+A
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PYU1_G013641
Length=200

 Score = 352 bits (903),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIA +AE+VKEGVESV GVTATIYQV ETL + +LA +HAAPKKDHP
Sbjct  1    MTNVAIIYYSTYGHIAKMAEKVKEGVESVAGVTATIYQVPETLSDEILAKMHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLK ADG+LFGFPTRFG+ P+QVKALFD+TGGLWSTGAL+GKPAG FFSTG QG 
Sbjct  61   IATPDVLKNADGILFGFPTRFGTFPAQVKALFDATGGLWSTGALVGKPAGFFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFL HQG+T+VPLGYRSPLLF+F+EIHGGSPWGAGT AGPDGSRQPS LE
Sbjct  121  GQETTAFTAVTFLTHQGLTFVPLGYRSPLLFSFDEIHGGSPWGAGTYAGPDGSRQPSTLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+AKKL+A
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PHYSO_501475
Length=200

 Score = 348 bits (892),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 181/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIAT+AE VKEGVESVEGVTA IYQVQETL E +L  +HA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATMAESVKEGVESVEGVTAEIYQVQETLSEEILGKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPDVLK ADGVL G PTRFGS+P+QVKALFD+ GGLW+ GAL+GKP GIFFSTG QG 
Sbjct  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPVGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFTS+TFL HQGMT+VPLGYRSPLLFN EEIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  181  LDVAKVQGESFAGVAKKLSA  200

>PYU1_G005988
Length=200

 Score = 344 bits (882),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHIA +AE VKEGVESVEGVTA IYQVQETL E +LA ++AAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFGFPTRFGS P+QVKALFDSTGGLWSTGAL+GKPAGIFFSTG QG 
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+TYVPLGYRSPLLFNFEEIHGGSPWGAGT AGPDGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+AKKL+A
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PYU1_G005989
Length=200

 Score = 344 bits (882),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHIA +AE VKEGVESVEGVTA IYQVQETL E +LA ++AAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQVQETLSEDVLAKLYAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFGFPTRFGS P+QVKALFDSTGGLWSTGAL+GKPAGIFFSTG QG 
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKALFDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+TYVPLGYRSPLLFNFEEIHGGSPWGAGT AGPDGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+AKKL+A
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PHYCA_508469
Length=200

 Score = 343 bits (881),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 182/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTN+AIIYYSTYGHIAT+AE VK+GVESV+GVTA IYQVQETL E +L  +HAAPK+D+P
Sbjct  1    MTNIAIIYYSTYGHIATMAESVKKGVESVDGVTAEIYQVQETLSEEILTKMHAAPKRDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPD+LK ADGVL G PTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G 
Sbjct  61   VATPDILKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTIGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFTS+TFL HQGMT+VPLGYRSPLLFN EEIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNMEEIHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  181  LDVAKVQGESFATVAKKLSA  200

>PYAP_21524
Length=200

 Score = 343 bits (880),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGHI  LAE +KEGVE VEGV ATIYQV ETLPE +L+ IHA PKKD+P
Sbjct  1    MTKIAIIYYSTYGHIVQLAESIKEGVEKVEGVEATIYQVPETLPEDILSAIHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP+ LKEADG+LFGFPTRFG++PSQ+KA FDSTGGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATPETLKEADGILFGFPTRFGTMPSQIKAFFDSTGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAH GMTYVPLGYRSPLLFN EE+HGGS WG GTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHHGMTYVPLGYRSPLLFNMEEVHGGSAWGTGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  181  LDVAKVQGESFANVAKKLSA  200

>PYU1_G005987
Length=200

 Score = 340 bits (871),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGH+  LA  +KEGV SVEGVTA +YQV ETLPE +LA +HA PKKDHP
Sbjct  1    MTKIAIVYYSTYGHVVQLANVIKEGVGSVEGVTAELYQVAETLPEEVLAKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFG PTRFGS P+Q+KA FDSTGGLW  GAL+GKPAG+FF+TG QG 
Sbjct  61   IATPDVLKEADGILFGLPTRFGSFPAQIKAFFDSTGGLWQVGALVGKPAGVFFTTGVQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA+T+LTFL+  GMTYVPLGYRSPLLFNFEEIHGGSPWGAGT AG DGSRQPSKLE
Sbjct  121  GQETTAYTALTFLSQHGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTYAGSDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+AKKL+A
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PPTG_09250
Length=200

 Score = 339 bits (870),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 181/200 (91%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGHIAT+AE VK+GVESV+GVTA +YQVQETL E +L  +HA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHIATMAESVKKGVESVDGVTAEVYQVQETLSEEILTKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPD+LK ADGVL GFPTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G 
Sbjct  61   VATPDILKNADGVLLGFPTRFGSMPAQVKALFDACGGLWAGGALVGKPAGIFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFTS+TFL HQGMT+VPLGYRSPLLFN EEIHGGSPWGAGT+AG DGSRQPS+LE
Sbjct  121  GQETTAFTSVTFLTHQGMTFVPLGYRSPLLFNLEEIHGGSPWGAGTIAGGDGSRQPSQLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  181  LDVAKVQGESFAGVAKKLSA  200

>PYU1_G005990
Length=200

 Score = 337 bits (864),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 186/200 (93%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHIA +AE VKEGVESVEGVTA IYQ+ ETLPE +LA +HAAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHIAKMAESVKEGVESVEGVTAEIYQIAETLPEEVLAKLHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFGFPTRFGS P+QVK+  DSTGGLWSTGAL+GKPAGIFFSTG QG 
Sbjct  61   IATPDVLKEADGILFGFPTRFGSFPAQVKSFLDSTGGLWSTGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+TYVPLG RSPLLFNFEEIHGGSPWGAGT AGPDGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLAHQGLTYVPLGCRSPLLFNFEEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+AKKL+A
Sbjct  181  LDVAKVQGESFAQVAKKLSA  200

>PHYRA_96097
Length=200

 Score = 336 bits (862),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 177/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGH+A LAE  KEG+ESV+GVTA IYQV ETLPE LL  IHAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHVAKLAEAAKEGIESVDGVTAEIYQVAETLPEELLTQIHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT DVLKEADG+LFGFPTRFGSLPSQVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATVDVLKEADGILFGFPTRFGSLPSQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +EIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA++AKKLAA
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PYIW_16204
Length=200

 Score = 334 bits (857),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 183/200 (92%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  VAI+YYSTYGHIA +AEQVKEGVESVEGVTA IYQ+ ETLPE +LA +HA PKKDHP
Sbjct  1    MAKVAIVYYSTYGHIAKMAEQVKEGVESVEGVTAEIYQISETLPEEVLAMMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPD LKEADG+LFGFPTRFGS P+QVKALFDSTGGLW TG L+GKPAG+FFSTG QG 
Sbjct  61   IATPDALKEADGILFGFPTRFGSFPAQVKALFDSTGGLWQTGGLVGKPAGVFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTF AHQG+TYVPLGYRSPLLF+F+EIHGGSPWGAGT AGPDGSRQPSKLE
Sbjct  121  GQETTAFTTLTFFAHQGLTYVPLGYRSPLLFSFDEIHGGSPWGAGTYAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFAQ+ KKLAA
Sbjct  181  LDVAKVQGESFAQVTKKLAA  200

>PYAP_24850
Length=200

 Score = 333 bits (855),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGHI  +AE VK GVE V GVTA IYQV ETLPE +L+ +HAAPKKD+P
Sbjct  1    MTKIAIIYYSTYGHIVQMAEAVKAGVELVTGVTAEIYQVAETLPEEVLSKMHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATP+ LKEADG+LFGFPTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   VATPETLKEADGILFGFPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFL HQGMT+VPLGYR PLLFN +E+HGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTAITFLTHQGMTFVPLGYRCPLLFNLDEVHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAK QGESFA +AKKL+A
Sbjct  181  LDVAKAQGESFANVAKKLSA  200

>PHYSO_285976
Length=200

 Score = 333 bits (855),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGHIA LAE  KEG ESVEGVTA IYQ+QETLPE +L  +HA PKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT DVLKEADG+LFGFPTRFGSLP+QVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +EIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYSO_500108
Length=200

 Score = 333 bits (855),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGHIA LAE  KEG ESVEGVTA IYQ+QETLPE +L  +HA PKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT DVLKEADG+LFGFPTRFGSLP+QVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +EIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYSO_503540
Length=200

 Score = 333 bits (853),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGHIA LAE  KEG ESVEGVTA IYQ+QETLPE +L  +HA PKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAKLAESAKEGAESVEGVTAEIYQIQETLPEEVLTKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT DVLKEADG+LFGFPTRFGSLP+QVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   VATTDVLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +EIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA++AKKLAA
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PHYCA_118176
Length=200

 Score = 333 bits (853),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGH+A LAE  KEG+ESV GVTA IYQV ETLPE LL  IHAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHVAKLAEAAKEGIESVAGVTAEIYQVAETLPEELLTAIHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT DVLKEADG+LFGFPTRFGSLPSQVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATVDVLKEADGILFGFPTRFGSLPSQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +EIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG++FA++ KKLAA
Sbjct  181  LTVATTQGKTFAEVTKKLAA  200

>PPTG_09275
Length=200

 Score = 333 bits (853),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGHIA LAE  K+GVESV+GVTA IYQVQETL + +L  +HAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHIAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFPTRFGSLP+QVKALFDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATVDTLKEADGILFGFPTRFGSLPAQVKALFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +EIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDEIHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA++AKKLAA
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PITG_13737
Length=199

 Score = 332 bits (850),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 177/199 (89%), Gaps = 0/199 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGHIAT+AE +K+GVESV+GVTA IYQVQETL E +L  +HA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHIATMAESIKKGVESVDGVTAEIYQVQETLSEEILTKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPD +K ADGVLFG PTRFGS P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G 
Sbjct  61   VATPDTIKNADGVLFGIPTRFGSFPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFL HQGM++VPLGYRSPLLFN +EIHGGSPWGAGT+AG DGSRQPSKLE
Sbjct  121  GQETTAFTAVTFLTHQGMSFVPLGYRSPLLFNLDEIHGGSPWGAGTIAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLA  199
            LDVAK QGESFA +AKKL+
Sbjct  181  LDVAKAQGESFAGVAKKLS  199

>PYU1_G005991
Length=200

 Score = 331 bits (849),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHIA +AE++KEGVE V GV+A IYQV ETL + +L  +HA PKKDHP
Sbjct  1    MTRIAIVYYSTYGHIAKMAEKIKEGVELVTGVSAEIYQVAETLSDEVLTKMHAVPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT DVLKEADG+LFG PTRFGS+P+QVKALFDSTGGLW TGALIGKPAGIFFSTG QG 
Sbjct  61   IATADVLKEADGILFGIPTRFGSMPAQVKALFDSTGGLWGTGALIGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFTS+TFL HQG+T+VPLGYR+PL+F+ +EIHGGSPWGAGT AGPDGSRQP+ LE
Sbjct  121  GQETTAFTSITFLTHQGLTFVPLGYRTPLMFSMDEIHGGSPWGAGTYAGPDGSRQPTDLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            + VAKVQGESFA++AKKL+A
Sbjct  181  MTVAKVQGESFAEVAKKLSA  200

>PHYCA_512169
Length=200

 Score = 330 bits (846),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYS Y HI+T+AE VK+G+ESVEGVTA IYQV ETLPE LL  IHAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGIESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP+ LKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQGMTYVPLGYR+P L N EEIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYCA_508491
Length=200

 Score = 330 bits (846),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYS Y HI+T+AE VK+G+ESVEGVTA IYQV ETLPE LL  IHAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGIESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP+ LKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQGMTYVPLGYR+P L N EEIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PITG_13763
Length=200

 Score = 330 bits (845),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 177/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGHIA LAE  K+GVESV+GVTA IYQVQETL + +L  +HAAPKKDHP
Sbjct  1    MATIAIIYYSTYGHIAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFPTRFGSLP+QVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATLDTLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P LFN +E+HGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA++AKKLAA
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PHYSO_285972
Length=200

 Score = 330 bits (845),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYS Y HI+T+AE VK+GVESV+GVTA IYQV ETLPE LL  IHAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKKGVESVDGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATPDVLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+T+VPLGYR+P L N EEIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTFVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PITG_13761
Length=200

 Score = 328 bits (841),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGH+A LAE  K+GVESV+GVTA IYQVQETL + +L  +HAAPKKDHP
Sbjct  1    MAKIAIIYYSTYGHVAQLAEAAKKGVESVDGVTAEIYQVQETLSDEILGKMHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFPTRFGSLP+QVKA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   IATLDTLKEADGILFGFPTRFGSLPAQVKAFFDSAGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+T+VPLGYR+P LFN +E+HGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTAVTFLAHQGLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA++AKKLAA
Sbjct  181  LTVATTQGKSFAEVAKKLAA  200

>PHYKE_5842
Length=550

 Score = 340 bits (872),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTY HIA +AE +KEGVESV G TA +YQ+QETLPE +LA +HA PKKDHP
Sbjct  351  MTKIAIIYYSTYSHIAKMAESIKEGVESVSGTTAEVYQIQETLPEEILAKMHAPPKKDHP  410

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPD+LK ADGVLFG PTRFGS+P+QVKALFD+ GGLW++G L+GKPAGIFFSTG  G 
Sbjct  411  VATPDILKNADGVLFGIPTRFGSMPAQVKALFDACGGLWASGGLVGKPAGIFFSTGTMGG  470

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFL HQGMT+VPLGYRSPLLFN +EIHGGSPWGAGTLAG DGSRQPS LE
Sbjct  471  GQETTAFTTITFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSTLE  530

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAK QGESFA++AKKL+A
Sbjct  531  LDVAKKQGESFAEVAKKLSA  550

>PHYRA_71949
Length=200

 Score = 327 bits (838),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 173/200 (87%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYS Y HI+T+AE VK GVESVEGVTA IYQV ETLPE LL  IHAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAETVKAGVESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP+ LKEADG+LFGFPTRFGSLP+Q+KA FDS GGLW+TGAL GKPAGIFFSTG QG 
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPAQMKAFFDSCGGLWATGALTGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFL HQGMTYVPLGYR+P L N EEIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLTHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYRA_71950
Length=200

 Score = 326 bits (836),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 173/200 (87%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYS Y HI+T+AE VK GVESVEGVTA IYQV ETLPE LL  IHAAPKKD+P
Sbjct  1    MAKIAIVYYSCYNHISTMAEIVKAGVESVEGVTAEIYQVAETLPEELLTAIHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP+ LKEADG+LFGFPTRFGSLP+Q+KA FDS GGLW+TGAL GKPAGIFFSTG QG 
Sbjct  61   IATPETLKEADGILFGFPTRFGSLPAQMKAFFDSCGGLWATGALTGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFL HQGMTYVPLGYR+P L N EEIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLTHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LTVATTQGKSFAEIAKKLAA  200

>PHYKE_4827
Length=200

 Score = 325 bits (833),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 174/200 (87%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIATLA  VK GVESV GV A +YQVQETL E +L  +HA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLANSVKAGVESVPGVKANVYQVQETLSEEILTKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT + LKEAD +LFGFPTRFGS P+QVKALFDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   VATAETLKEADAILFGFPTRFGSFPAQVKALFDSCGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQG+TYVPLGYR+P LFN +EIHGGSPWGAGTLA  DGSRQPSKLE
Sbjct  121  GQETTAFTALTFLAHQGLTYVPLGYRAPELFNMDEIHGGSPWGAGTLANGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA++AKKL+A
Sbjct  181  LTVATTQGKSFAEVAKKLSA  200

>HYAP_08503
Length=280

 Score = 327 bits (839),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 176/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGHIA +AE +K GVESV G TA +YQVQETL + +L+ +HA  K+DHP
Sbjct  80   MTKIAIIYYSTYGHIAKMAESIKAGVESVAGATADVYQVQETLSDEVLSKMHAPSKQDHP  139

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPDVLK ADGVL G PTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  140  VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWTAGALVGKPAGIFFSTGTQGG  199

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFL HQGMT+VPLGYRSPLLFN +EIHGGSPWGAG LAG DGSRQPS+LE
Sbjct  200  GQETTAFTTVTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGNLAGTDGSRQPSQLE  259

Query  181  LDVAKVQGESFAQIAKKLAA  200
             DVAKVQGESFAQ+AKKL++
Sbjct  260  KDVAKVQGESFAQVAKKLSS  279

>PYIW_26610
Length=200

 Score = 319 bits (818),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 173/200 (87%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  VAI+YYSTYGHIA +AE+VKEGV+SVEGVT  IYQV ETLP+ +L+ +H  PKKD+P
Sbjct  1    MVKVAIVYYSTYGHIAAMAEKVKEGVDSVEGVTGKIYQVAETLPQDVLSKMHTPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP+VLKEADG+LFG PTRFGS P+Q+K LFD+TGGLW TG L+GKP G+FFST  Q  
Sbjct  61   IATPEVLKEADGILFGMPTRFGSFPAQMKTLFDATGGLWQTGGLVGKPIGVFFSTAAQNG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTF AH G+TYVPLG+RS LL +F+EIHGGSPWG GTLAG DGSRQPS+LE
Sbjct  121  GQETTAFTALTFFAHHGLTYVPLGFRSRLLLDFKEIHGGSPWGVGTLAGIDGSRQPSQLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
             DVAKVQGESFAQIAKKLAA
Sbjct  181  PDVAKVQGESFAQIAKKLAA  200

>PYVX_14995
Length=200

 Score = 319 bits (818),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 170/200 (85%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYS YGH+ATLAE +KEGVE VEGVTATIYQV ETLPE +L  IHAAPKKDHP
Sbjct  1    MTKIAIVYYSCYGHVATLAESIKEGVEKVEGVTATIYQVPETLPESILTAIHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFPTRFGS PSQ+KA FD  GGLW+TGALIGK AGIFFSTG QG 
Sbjct  61   IATVDTLKEADGILFGFPTRFGSAPSQIKAFFDGCGGLWATGALIGKTAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQE TAF++L F AHQG+TYVPLGYR+  L N EEIHGGS WGAG+ AG DGSR PSKLE
Sbjct  121  GQEVTAFSTLPFFAHQGLTYVPLGYRTQNLANMEEIHGGSAWGAGSFAGSDGSRLPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++A VQGESFAQ+ KKL+A
Sbjct  181  LEIAVVQGESFAQVTKKLSA  200

>PHYRA_51797
Length=199

 Score = 319 bits (817),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTN+AIIYYSTYGHIA +AE VK GVE+V+GVTA IYQV+ETL E +L  +HAAPKKDHP
Sbjct  1    MTNIAIIYYSTYGHIAKMAESVKAGVEAVDGVTAEIYQVEETLSEEILGKMHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPDVLK ADGVL G PTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G 
Sbjct  61   VATPDVLKNADGVLLGIPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTPGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFL HQGMT+VPLGYRSPLLFN +EIHGGSPWGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLTHQGMTFVPLGYRSPLLFNMDEIHGGSPWGAGTLAGADGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLA  199
            LDVAKVQGESFA +AKKL+
Sbjct  181  LDVAKVQGESFAGVAKKLS  199

>PYAP_25148
Length=200

 Score = 318 bits (816),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHI  LAE +KEGVE V GV ATIYQV ETLPE +L+ +HAAPKKD+P
Sbjct  1    MTKIAIVYYSTYGHIVQLAESIKEGVEKVAGVEATIYQVAETLPEEVLSKMHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATP+ LKEADG+LFGFPTRFGS+P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   VATPETLKEADGILFGFPTRFGSMPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFL H GMT+VPLGYRSPLLFN EE+HGGSPWG GTLAG DGSRQPSKLE
Sbjct  121  GQETTAFTTLTFLTHHGMTFVPLGYRSPLLFNMEEVHGGSPWGTGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  181  LDVAKVQGESFANVAKKLSA  200

>PYAP_24529
Length=199

 Score = 317 bits (813),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 170/200 (85%), Gaps = 1/200 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +A+IY+STYGHI  +AE +KEG+E  +G   T+YQV ETLPE +L  +HA PKKDHP
Sbjct  1    MTKIAVIYFSTYGHIVKMAEAIKEGIEKADGTQVTLYQVAETLPEEVLTKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +A  D LK+AD +LFGFPTRFG+ PSQVKA FDSTG  W+TGAL+GKPAGIFFSTG QG 
Sbjct  61   VANLDTLKDADAILFGFPTRFGTFPSQVKAFFDSTGSFWATGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFL H GMTYVPLGYRSPL+FN  E+HGGSPWGAGTLAG DGSRQPS+LE
Sbjct  121  GQETTAFTALTFLTHHGMTYVPLGYRSPLVFNL-EVHGGSPWGAGTLAGKDGSRQPSELE  179

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA +AKKL+A
Sbjct  180  LDVAKVQGESFAMVAKKLSA  199

>PPTG_20266
Length=213

 Score = 313 bits (801),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYSTY H++T+AE +K+G+ESVEGVTA IYQV ETLPE LLA IHAAPKKD+P
Sbjct  14   MAKIAIVYYSTYNHVSTMAETIKKGIESVEGVTAEIYQVAETLPEELLAQIHAAPKKDYP  73

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPD LKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW+TGAL+GKPAGIFFSTG QG 
Sbjct  74   IATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWATGALVGKPAGIFFSTGTQGG  133

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFL HQGMTYVPLGYR+  L N +EIHGGSPWG+GTLAG DGSRQPSKLE
Sbjct  134  GQETTAFTTLTFLTHQGMTYVPLGYRASELSNMDEIHGGSPWGSGTLAGGDGSRQPSKLE  193

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  194  LAVATTQGKSFAEIAKKLAA  213

>PITG_13762
Length=200

 Score = 310 bits (795),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYSTY H++TLAE +KEGVESV+GVTA IYQV ETLPE LL  IHAAPKKD+P
Sbjct  1    MAKIAIVYYSTYNHVSTLAETIKEGVESVDGVTAEIYQVAETLPEELLTQIHAAPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPD LKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW  GAL+GKPAGIFFSTG QG 
Sbjct  61   IATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWGAGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA T+LTFLAHQG+TYVPLGYR+P L N EEIHGGS WGAGTLAG DGSRQPSKLE
Sbjct  121  GQETTALTTLTFLAHQGLTYVPLGYRAPELANMEEIHGGSAWGAGTLAGGDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  181  LSVATTQGKSFAEIAKKLAA  200

>PYAP_24530
Length=258

 Score = 311 bits (797),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 1/193 (1%)

Query  6    IIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIATPD  65
            I+YYSTYGHI  LAE VK GV+ V+ V ATIYQVQETLP  +L  +HA PKKD+PIATP+
Sbjct  67   IVYYSTYGHIVHLAEAVKRGVDKVD-VEATIYQVQETLPADVLEKMHAPPKKDYPIATPE  125

Query  66   VLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETT  125
             L EAD +LFG PTRFGS PSQ+KALFDSTGGLW+ GAL+GKPAG+FFSTG  G GQETT
Sbjct  126  TLAEADAILFGIPTRFGSFPSQMKALFDSTGGLWAKGALVGKPAGLFFSTGTPGGGQETT  185

Query  126  AFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAK  185
            A+T++TFLAH G+ YVPLGYRSPLLFN EE+HGGSPWG GT+AGPDGSRQPSKLELDVA+
Sbjct  186  AYTTVTFLAHHGLIYVPLGYRSPLLFNMEEVHGGSPWGTGTIAGPDGSRQPSKLELDVAE  245

Query  186  VQGESFAQIAKKL  198
            VQGESFA +AKKL
Sbjct  246  VQGESFANVAKKL  258

>PPTG_17005
Length=200

 Score = 306 bits (785),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 168/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGH+A LA   K+G+ESV GVTATIYQVQETLPE +L  +HA PK DHP
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIESVGGVTATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFP RFGS+P+QVKA FDS G LW+TGAL+GK  G+FFSTG QG 
Sbjct  61   IATIDTLKEADGILFGFPCRFGSMPAQVKAFFDSCGSLWATGALVGKTGGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+TYVPLGYR   L N +E+HGGSPWGAGTLA  DGSRQPS+LE
Sbjct  121  GQETTAFTAVTFLAHQGLTYVPLGYRGKELLNMDEMHGGSPWGAGTLAKSDGSRQPSELE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L +A  QG+SFA++ KKLAA
Sbjct  181  LALATTQGKSFAEVTKKLAA  200

>PYAP_25149
Length=200

 Score = 306 bits (785),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 171/200 (86%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AII+YSTYGH+A LAE +K+GV++V G +ATIYQV ETLPE +L  IHA PK D+P
Sbjct  1    MTKIAIIHYSTYGHVAKLAEALKQGVKNVPGASATIYQVPETLPEEVLKMIHAPPKPDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
             AT D LK+ADG+LFGFPTRFGS+PSQ+K+  DSTGGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  61   FATVDTLKDADGILFGFPTRFGSMPSQMKSYLDSTGGLWAKGALVGKPAGIFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAF++L FLAH GMTYVPLGYR+P   N EEIHGGS WG GT AG DG+RQPSKLE
Sbjct  121  GQETTAFSTLPFLAHHGMTYVPLGYRAPQQANMEEIHGGSAWGVGTFAGSDGARQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++A+VQGESFAQIAKKL+A
Sbjct  181  LEIAEVQGESFAQIAKKLSA  200

>PPTG_17006
Length=200

 Score = 306 bits (784),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 168/200 (84%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGH+A LA   K+G+ESV GVTATIYQVQETLPE +L  +HA PK DHP
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIESVGGVTATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFP RFGS+P+QVKA FDS G LW+TGAL+GK  G+FFSTG QG 
Sbjct  61   IATIDTLKEADGILFGFPCRFGSMPAQVKAFFDSCGSLWATGALVGKTGGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+TY+PLGYR   L N +E+HGGSPWGAGTLA  DGSRQPS+LE
Sbjct  121  GQETTAFTAVTFLAHQGLTYIPLGYRGKELLNMDEMHGGSPWGAGTLAKSDGSRQPSELE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L +A  QG+SFA++ KKLAA
Sbjct  181  LALATTQGKSFAEVTKKLAA  200

>CCI42280
Length=200

 Score = 298 bits (764),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 165/200 (83%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGH+A LAE VKEG E V GV+A IYQV ETL + +L+ +HA PKK++P
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVSADIYQVAETLTDDVLSKMHAPPKKEYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT DVLK+ADG+LFGFPTRFG +P+Q+KA FD  G LW +G  IGKPAG+FFSTG  G 
Sbjct  61   IATMDVLKDADGILFGFPTRFGLVPAQMKAYFDMAGQLWQSGCTIGKPAGLFFSTGTPGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT + FL H GM +VPLGYRSPLL N +E+HGGS WGAGTLAGPDGSRQPSKLE
Sbjct  121  GQETTAFTCIPFLTHLGMVFVPLGYRSPLLGNLDEVHGGSAWGAGTLAGPDGSRQPSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            LDVAKVQGESFA + +KLAA
Sbjct  181  LDVAKVQGESFAAVTRKLAA  200

>PHYCA_132728
Length=200

 Score = 298 bits (762),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGH+A LA+  K+G+ESV GVTATIYQV+ETLPE +L  +HA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT + L+EADG+LFGFP RFG++P+Q+KA FDS G LW+TGAL GK  G+FFSTG QG 
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+TYVPLGYRS  L N +E+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAQIAKKL  198
            L +A  QG+SFA++ KKL
Sbjct  181  LGLATTQGQSFAEVTKKL  198

>PHYCA_124158
Length=200

 Score = 298 bits (762),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGH+A LA+  K+G+ESV GVTATIYQV+ETLPE +L  +HA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT + L+EADG+LFGFP RFG++P+Q+KA FDS G LW+TGAL GK  G+FFSTG QG 
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+TYVPLGYRS  L N +E+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAQIAKKL  198
            L +A  QG+SFA++ KKL
Sbjct  181  LGLATTQGQSFAEVTKKL  198

>PHYCA_19840
Length=200

 Score = 298 bits (762),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGH+A LA+  K+G+ESV GVTATIYQV+ETLPE +L  +HA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT + L+EADG+LFGFP RFG++P+Q+KA FDS G LW+TGAL GK  G+FFSTG QG 
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKAFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+TYVPLGYRS  L N +E+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAQIAKKL  198
            L +A  QG+SFA++ KKL
Sbjct  181  LGLATTQGQSFAEVTKKL  198

>PHYCA_132729
Length=200

 Score = 296 bits (758),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 166/198 (84%), Gaps = 0/198 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AIIYYSTYGH+A LA+  K+G+ESV GVTATIYQV+ETLPE +L  +HA PKKDHP
Sbjct  1    MTKIAIIYYSTYGHVAKLADAAKKGIESVAGVTATIYQVKETLPEEVLIKMHAPPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT + L+EADG+LFGFP RFG++P+Q+K  FDS G LW+TGAL GK  G+FFSTG QG 
Sbjct  61   IATIETLREADGILFGFPCRFGTMPAQIKVFFDSCGSLWATGALTGKTGGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT++TFLAHQG+TYVPLGYRS  L N +E+HGGSPWGAGT +  DGSRQP++LE
Sbjct  121  GQETTAFTAVTFLAHQGITYVPLGYRSKDLLNMDEMHGGSPWGAGTFSKGDGSRQPTELE  180

Query  181  LDVAKVQGESFAQIAKKL  198
            L +A  QG+SFA++ KKL
Sbjct  181  LGLATTQGQSFAEVTKKL  198

>PHYKE_1631
Length=200

 Score = 296 bits (757),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 164/200 (82%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYS YGH+A LA  +K GV SV GV A++YQ+QETL + LL  +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKTGVTSVPGVKASVYQIQETLNDDLLKALHAPPKSDLP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLK ADG+L GFPTRFG LPSQVK LFD+ GGLW+ G LIGKP GIFFSTG  G 
Sbjct  61   IATPDVLKNADGILLGFPTRFGMLPSQVKGLFDACGGLWANGGLIGKPCGIFFSTGSLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA +   F+AH GMT+VPLGYR+PL+ + EEIHGGSPWGAGTLA  DGSRQP+ LE
Sbjct  121  GQETTAMSMTPFIAHHGMTFVPLGYRTPLIGSNEEIHGGSPWGAGTLANADGSRQPTPLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++AK+QG+SFA++AKKL++
Sbjct  181  LEIAKIQGQSFAEVAKKLSS  200

>PHYSO_285975
Length=200

 Score = 295 bits (755),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIATLAE VK GVESV GV AT+YQV ETL E +L  +HA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLAESVKAGVESVSGVKATVYQVAETLSEEILTKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATP+ LKEAD +LFGFPTRFG+ P+QVKALFDS GGLW+ GALIGKPAGIFFSTG  G 
Sbjct  61   VATPETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGALIGKPAGIFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETT+FT++TFL HQGMT+VPLG+R+P +FN EE+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLTHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAQIAKKLA  199
              +A  QG+SFA+IAKKL+
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PHYSO_285974
Length=200

 Score = 295 bits (755),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 0/199 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIATLAE VK GVESV GV AT+YQV ETL E +L  +HA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLAESVKAGVESVSGVKATVYQVAETLSEEILTKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATP+ LKEAD +LFGFPTRFG+ P+QVKALFDS GGLW+ GALIGKPAGIFFSTG  G 
Sbjct  61   VATPETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGALIGKPAGIFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETT+FT++TFL HQGMT+VPLG+R+P +FN EE+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLTHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAQIAKKLA  199
              +A  QG+SFA+IAKKL+
Sbjct  181  KAIATTQGKSFAEIAKKLS  199

>PHYRA_71996
Length=200

 Score = 293 bits (751),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 163/200 (82%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYS YGH+A LA  +K GV SV GV A++YQVQETL + L   +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVQASVYQVQETLSDDLRKVLHAPPKSDLP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPDVLK ADG+L GFPTRFG LP+QVK LFD+ GGLW+ GALIGKP G+FFSTG  G 
Sbjct  61   VATPDVLKNADGILLGFPTRFGMLPAQVKGLFDACGGLWANGALIGKPCGVFFSTGSLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA +   F+AH GMT+VPLGYRSPL+   EE+HGGSPWGAGTLA  DGSRQP++LE
Sbjct  121  GQETTAMSMTPFMAHHGMTFVPLGYRSPLIGTNEEVHGGSPWGAGTLANGDGSRQPTELE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++AK+QG+SFA+I KKL++
Sbjct  181  LEIAKIQGQSFAEITKKLSS  200

>CCA15845
Length=200

 Score = 293 bits (750),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 160/200 (80%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGH+A LAE VKEG E V GVTA IYQV ETL + +LA +HA PKK+HP
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IA+ DVLK+ADG+LFG PTRFG +P+Q+KA FD  G LW  G  IGKPAG+FFST   G 
Sbjct  61   IASMDVLKDADGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT L FL H GM +VPLGYRSPLL N +E+HGGS WGAGTLAG DGSRQ SKLE
Sbjct  121  GQETTAFTCLPFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L+VAKVQGESFA + +KLAA
Sbjct  181  LEVAKVQGESFASVTRKLAA  200

>CCA27411
Length=200

 Score = 293 bits (750),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 160/200 (80%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AIIYYSTYGH+A LAE VKEG E V GVTA IYQV ETL + +LA +HA PKK+HP
Sbjct  1    MVKIAIIYYSTYGHVARLAETVKEGCELVTGVTAEIYQVAETLSDDVLAKMHAPPKKEHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IA+ DVLK+ADG+LFG PTRFG +P+Q+KA FD  G LW  G  IGKPAG+FFST   G 
Sbjct  61   IASMDVLKDADGILFGMPTRFGLVPAQMKAYFDMAGQLWQNGCTIGKPAGVFFSTATPGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT L FL H GM +VPLGYRSPLL N +E+HGGS WGAGTLAG DGSRQ SKLE
Sbjct  121  GQETTAFTCLPFLTHLGMVFVPLGYRSPLLSNLDEVHGGSAWGAGTLAGADGSRQASKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L+VAKVQGESFA + +KLAA
Sbjct  181  LEVAKVQGESFASVTRKLAA  200

>PHYRA_81696
Length=200

 Score = 292 bits (748),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 172/200 (86%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHI+TLAE VK GVESV GVTAT+YQV ETL E +L  +HAAPKKD P
Sbjct  1    MTNVAIIYYSTYGHISTLAESVKAGVESVPGVTATVYQVAETLSEEILTKMHAAPKKDLP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT + LK+AD +LFGFPTRFG+ P+QVKALFDS GGLW+ G L+GKPAGIFFSTG  G 
Sbjct  61   VATAETLKQADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGELVGKPAGIFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETT+FT++TFLAHQGMT+VPLG+R+P +FN EE+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLAHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
              +A  QG+SFA+IAKKL+A
Sbjct  181  KAIATTQGKSFAEIAKKLSA  200

>PPTG_03020
Length=200

 Score = 292 bits (748),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 161/200 (81%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYS YGH+A LA  +K GV SV GV A++YQ+QETL + LL  +HA PK D P
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVKASVYQIQETLNDDLLKKLHAPPKPDLP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPDVLK ADG+L GFPTRFG LP+QVK LFD+ GGLW  G LIGKP GIFFS+   G 
Sbjct  61   VATPDVLKNADGILLGFPTRFGMLPTQVKGLFDACGGLWVNGGLIGKPCGIFFSSASLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA +   F+AHQGMT+VPLGYRSPL+   EEIHGGSPWGAGTLA  DGSRQP+ LE
Sbjct  121  GQETTAMSMTPFIAHQGMTFVPLGYRSPLVGTNEEIHGGSPWGAGTLANSDGSRQPTDLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++AK+QG+SFA+I KKL+A
Sbjct  181  LEIAKIQGQSFAEITKKLSA  200

>PHYCA_118207
Length=200

 Score = 291 bits (744),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 172/200 (86%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYSTYGHIATL + +K GVESV GVTAT+YQV ETL E +L+ +HA PKKD+P
Sbjct  1    MTNVAIIYYSTYGHIATLVDSIKAGVESVPGVTATVYQVAETLSEEILSKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT + LKEAD +LFGFPTRFG+ P+QVKALFDS GGLW+ G L+GKPAGIFFSTG  G 
Sbjct  61   VATAETLKEADAILFGFPTRFGAFPAQVKALFDSCGGLWAKGELVGKPAGIFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETT+FT++TFLAHQGMT+VPLG+R+P +FN EE+HGGSPWGAG +AG DGSRQ SKLE
Sbjct  121  GQETTSFTAVTFLAHQGMTFVPLGFRAPEMFNVEEVHGGSPWGAGAIAGGDGSRQVSKLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
              +A  QG+SFA+IAKKL+A
Sbjct  181  KAIATTQGKSFAEIAKKLSA  200

>PHYCA_553014
Length=200

 Score = 290 bits (741),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 162/200 (81%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M NVAIIYYS YGH+A LA  +K GV SV GV A++YQVQETL + LL  +HA PK D P
Sbjct  1    MANVAIIYYSMYGHVAKLASSIKAGVTSVPGVKASVYQVQETLNDELLQKLHAPPKPDLP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLK ADG+L GFPTRFG LP+QVK LFD+ GGLW+ G LIGKP G+FFSTG  G 
Sbjct  61   IATPDVLKNADGILLGFPTRFGMLPAQVKGLFDACGGLWAKGDLIGKPCGVFFSTGSLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA +   F+AH GM +VPLGYRSPL+ + +E+HGGSPWGAGTLA  DGSRQP++LE
Sbjct  121  GQETTAMSMTPFIAHHGMNFVPLGYRSPLVGSNDEVHGGSPWGAGTLANGDGSRQPTELE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++AK+QG+SFA+IAKKL A
Sbjct  181  LEIAKIQGQSFAEIAKKLKA  200

>PYVX_13848
Length=200

 Score = 286 bits (732),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 161/200 (81%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYS YGH+A LA  +K GV SV GV A++YQV ETLPE LL  +HA PK D P
Sbjct  1    MTKIAIVYYSMYGHVAKLAASIKAGVTSVPGVQASLYQVSETLPEDLLKALHAPPKPDMP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP  LK+ADG+L GFPTRFG LPSQVK LFD+ GGLW+ GAL GK  GIFFST   G 
Sbjct  61   IATPQTLKDADGILLGFPTRFGMLPSQVKGLFDACGGLWANGALTGKTCGIFFSTASIGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA T+  F+AHQGMT+VPLGYRSPL+ + EE+HGGSPWGAGT+A  DGSRQP+ +E
Sbjct  121  GQETTAMTTTPFIAHQGMTFVPLGYRSPLIGSNEELHGGSPWGAGTIANSDGSRQPTDIE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++A+VQG+SFA+I KKL++
Sbjct  181  LEIARVQGQSFAEITKKLSS  200

>PYIR_25908
Length=199

 Score = 286 bits (731),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 162/200 (81%), Gaps = 1/200 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  VAI+YYS YGH+ATLAE +K G+ESVEGVTATIYQV+ETLP G+L  +HA PKKD+P
Sbjct  1    MAKVAIVYYSMYGHVATLAETIKAGIESVEGVTATIYQVEETLPAGVLEKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLKEADG+LFG PTRFG++P+Q+K LFD+TGGLW +GALIGKPAG+FFS   QG 
Sbjct  61   IATPDVLKEADGILFGMPTRFGTVPAQIKNLFDATGGLWQSGALIGKPAGVFFSCASQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            G ETTA  ++ FL H GM Y+PLG R+      +E+ GG  WGAGT AG DGSRQPS+ E
Sbjct  121  GNETTALMTIPFLTHHGMLYIPLGTRAKKFGTLDEVVGGGKWGAGTYAG-DGSRQPSERE  179

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L +A+VQGESFA+I KKLAA
Sbjct  180  LGIARVQGESFAEITKKLAA  199

>PYU1_G002524
Length=199

 Score = 282 bits (721),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 162/200 (81%), Gaps = 1/200 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  VAIIYYSTYGH+ATLAE +KEGVES+EGVTATIYQV+ETLPEG+L  +HA PKK++P
Sbjct  1    MAKVAIIYYSTYGHVATLAETIKEGVESIEGVTATIYQVRETLPEGVLEKMHAPPKKEYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +AT DVLKEADG+LFG PTRFG++P+Q+KA FD+ GGLW  GALIGKPAG+FFS+  QG 
Sbjct  61   VATNDVLKEADGILFGMPTRFGAVPAQMKAFFDAAGGLWQEGALIGKPAGVFFSSASQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            G ETT   +L FL H GM +VPLG R+      +E+ GG  WGAGT AG DGSR+PS+ E
Sbjct  121  GNETTVLMTLPFLTHMGMLFVPLGTRAKKFGTLDEVVGGGKWGAGTYAG-DGSRKPSERE  179

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L +A+VQGESFA+I KKLAA
Sbjct  180  LGIARVQGESFAEITKKLAA  199

>PYU1_G001466
Length=202

 Score = 281 bits (719),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 157/199 (79%), Gaps = 1/199 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPK-KDH  59
            MT +AI+YYS YGH+  LA  +K G + V GV A +YQVQETLP+ LL  I AAPK +DH
Sbjct  1    MTKIAIVYYSMYGHVGKLASAIKAGAKKVPGVDAQLYQVQETLPQELLTRIGAAPKPQDH  60

Query  60   PIATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQG  119
             +ATPD LK+ADG+L G PTRFG LPSQ+KAL D+ GGLW  G LIGKP G+FFSTG  G
Sbjct  61   AVATPDTLKDADGILLGLPTRFGMLPSQMKALMDACGGLWVGGGLIGKPCGLFFSTGTLG  120

Query  120  SGQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKL  179
             GQETTA  +  FL H GMT+VPLGYR+PLL N +EIHGGSPWGAGT+AG DGSRQPS L
Sbjct  121  GGQETTAMATTPFLTHHGMTFVPLGYRTPLLSNLDEIHGGSPWGAGTIAGADGSRQPSDL  180

Query  180  ELDVAKVQGESFAQIAKKL  198
            EL++A+VQGESFA+I KK+
Sbjct  181  ELEIARVQGESFAEITKKM  199

>PYAP_21525
Length=191

 Score = 278 bits (712),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 160/191 (84%), Gaps = 0/191 (0%)

Query  10   STYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIATPDVLKE  69
            ST+GH+  LA+ +K+GVE V G T TIYQV ETL E +LA +HAAPK+D PIATP++L +
Sbjct  1    STHGHVVQLAKALKQGVEKVAGATGTIYQVPETLDEDVLAKVHAAPKEDFPIATPEILTD  60

Query  70   ADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTS  129
             DG+LFGFPTRFGS P+Q+K+ +D+TGGLW+ GAL GK AG+FFSTG QG GQE+TAFT+
Sbjct  61   FDGILFGFPTRFGSFPAQMKSFWDATGGLWARGALTGKTAGLFFSTGIQGDGQESTAFTA  120

Query  130  LTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGE  189
            LTFLA+ GMTYVPLGYRSP LFN EEIHGGS WG GTLAG DG RQ +KLEL++A VQG+
Sbjct  121  LTFLANYGMTYVPLGYRSPHLFNMEEIHGGSCWGTGTLAGADGKRQATKLELEIADVQGQ  180

Query  190  SFAQIAKKLAA  200
            SFA++ KKLAA
Sbjct  181  SFAEVTKKLAA  191

>PPTG_00540
Length=201

 Score = 279 bits (713),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 156/198 (79%), Gaps = 0/198 (0%)

Query  3    NVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIA  62
            NVAIIYYS YGH  TLAE VKEGV+SV+GV ATIYQV ETL E +L  +HA PK+D+P+A
Sbjct  4    NVAIIYYSIYGHAVTLAEAVKEGVDSVQGVKATIYQVPETLSEEILTKMHAPPKRDYPVA  63

Query  63   TPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQ  122
            TP  LKEADG+LFG+PTRFG  P+Q K LFD+TG LW+ G LIGKP G F ST   G+GQ
Sbjct  64   TPQTLKEADGILFGYPTRFGDFPAQAKNLFDATGQLWAAGDLIGKPGGCFVSTSLMGAGQ  123

Query  123  ETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELD  182
            ETT   ++ F+   GMT+VPLGYR+  LFN +E+HGGSPWGAGT+AGPD SRQ SKLE D
Sbjct  124  ETTQLMTMAFMTSHGMTFVPLGYRAKQLFNVDEVHGGSPWGAGTIAGPDNSRQVSKLEKD  183

Query  183  VAKVQGESFAQIAKKLAA  200
            +A  QG+SFA++ KKL++
Sbjct  184  IAMEQGKSFAEVTKKLSS  201

>PHYSO_491760
Length=201

 Score = 275 bits (703),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 155/198 (78%), Gaps = 0/198 (0%)

Query  3    NVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIA  62
            NVAI+YYSTYGH ATLAE +KEGVE+V GVTATIYQ+ E L + +LA +HA   +D+P+A
Sbjct  4    NVAIVYYSTYGHTATLAESIKEGVEAVPGVTATIYQIAEALSDEILAKMHAPSNRDNPVA  63

Query  63   TPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQ  122
            TP  LKEADG+L GFPTRFG  P Q KAL D+TG LW  GAL+GKPAG FFST   G+GQ
Sbjct  64   TPATLKEADGILVGFPTRFGVFPQQAKALIDATGQLWFGGALVGKPAGTFFSTSLLGAGQ  123

Query  123  ETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELD  182
            ETTA +++TF+A  GMTYVPLGYR+  LFN EEIHGG PWGAG +AGP   RQ SKLE D
Sbjct  124  ETTALSAVTFMASHGMTYVPLGYRAKELFNVEEIHGGFPWGAGAIAGPQSDRQVSKLEKD  183

Query  183  VAKVQGESFAQIAKKLAA  200
            +A  QG+SFA++ KK+ A
Sbjct  184  IAVTQGKSFAEVVKKMTA  201

>PHYSO_492858
Length=201

 Score = 274 bits (700),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 155/198 (78%), Gaps = 0/198 (0%)

Query  3    NVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIA  62
            NVAI+YYSTYGH ATLAE +KEGVE+V GVTATIYQ+ E L + +LA +HA   +D+P+A
Sbjct  4    NVAIVYYSTYGHTATLAESIKEGVEAVPGVTATIYQIAEALSDEILAKMHAPSNRDNPVA  63

Query  63   TPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQ  122
            TP  LKEADG+L GFPTRFG  P Q KAL D+TG LW  GAL+GKPAG FFST   G+GQ
Sbjct  64   TPATLKEADGILVGFPTRFGVFPQQAKALIDATGQLWFGGALVGKPAGTFFSTSLLGAGQ  123

Query  123  ETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELD  182
            ETTA +++TF+   GMTYVPLGYR+  LFN EEIHGG PWGAG +AGP   RQ SKLE D
Sbjct  124  ETTALSAVTFMVSHGMTYVPLGYRAKELFNVEEIHGGFPWGAGAIAGPQSDRQVSKLEKD  183

Query  183  VAKVQGESFAQIAKKLAA  200
            +A  QG+SFA++ KK++A
Sbjct  184  IAVTQGKSFAEVVKKMSA  201

>PYAR_19739
Length=204

 Score = 273 bits (699),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 157/200 (79%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGHI  LAE +K+GV+ V GV A+IYQ+Q TL     A+I A PK ++P
Sbjct  1    MTKIAIVYYSTYGHIVPLAEAIKQGVDQVVGVDASIYQIQPTLRGDAHASIRAPPKTEYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
              TP +L  ADG+LFGFPTRFG+ P+QVKA FDS G LW    L GKPAG FFSTG  G 
Sbjct  61   TITPAILAAADGILFGFPTRFGAFPAQVKAFFDSCGSLWPQRVLEGKPAGFFFSTGTLGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETT  TSLTFLAHQGM +VPLGYR+P LFN +E+HGGSPWG GT+AG +G+RQP+ LE
Sbjct  121  GQETTPMTSLTFLAHQGMLFVPLGYRTPHLFNLDEVHGGSPWGTGTIAGANGARQPTDLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L++A+VQG SFA+IAKKLA+
Sbjct  181  LEIARVQGSSFAEIAKKLAS  200

>PHYKE_35
Length=160

 Score = 271 bits (694),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)

Query  41   ETLPEGLLATIHAAPKKDHPIATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWS  100
            ETL E LL TIHAAPKKDHPIATPD LKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW+
Sbjct  1    ETLSEELLTTIHAAPKKDHPIATPDTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWA  60

Query  101  TGALIGKPAGIFFSTGCQGSGQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGS  160
             GAL+GKPAGIFFSTG QG GQETTAFT+LTFLAHQG+TYVPLGYR+P L N +EIHGGS
Sbjct  61   AGALVGKPAGIFFSTGTQGGGQETTAFTALTFLAHQGLTYVPLGYRAPELANMDEIHGGS  120

Query  161  PWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAKKLAA  200
             WGAGTLAG DGSRQPSKLEL VA  QG+SFA++AKKLAA
Sbjct  121  AWGAGTLAGGDGSRQPSKLELTVATTQGKSFAEVAKKLAA  160

>PHYRA_71993
Length=201

 Score = 273 bits (697),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 157/198 (79%), Gaps = 0/198 (0%)

Query  3    NVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIA  62
            NVA+IYYS YGH ATLAE +KEGV+SV GV ATIYQV ETL + +L  +HA PK+D+PIA
Sbjct  4    NVAVIYYSIYGHAATLAESIKEGVDSVPGVKATIYQVPETLSDEILTKMHAPPKRDYPIA  63

Query  63   TPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQ  122
            +P+ LKEADG+L G+PTRFG  P+Q K+LFD+TG LW+ GALIGKP G F ST   G+GQ
Sbjct  64   SPETLKEADGILLGYPTRFGDFPAQAKSLFDATGQLWAAGALIGKPGGAFVSTSLMGAGQ  123

Query  123  ETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELD  182
            ETT   ++ F+   GMT+VPLGYR+  LF+ +E+HGGSPWGAG +AGPD SRQ SKLE +
Sbjct  124  ETTQLMTMAFMVSHGMTFVPLGYRAKQLFDVDEVHGGSPWGAGAIAGPDNSRQVSKLEKE  183

Query  183  VAKVQGESFAQIAKKLAA  200
            +A  QG+SFA++ KKL+A
Sbjct  184  IAMEQGKSFAEVTKKLSA  201

>PYVX_22078
Length=1267

 Score = 296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/270 (59%), Positives = 173/270 (64%), Gaps = 78/270 (29%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGH+A LAE VKEGVESVEGVTATIYQV ETLPE LLA IHAAPKKDHP
Sbjct  1    MTKIAIVYYSTYGHVAKLAESVKEGVESVEGVTATIYQVPETLPEELLAQIHAAPKKDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAG----------  110
            IAT D LKEADG+LFGFPTRFG+ P+QV+ALFD+TGGLW +GAL+GKPAG          
Sbjct  61   IATVDTLKEADGILFGFPTRFGAAPAQVRALFDATGGLWGSGALVGKPAGFFFSTGTLGG  120

Query  111  ---------------------IFFSTGCQGSGQETTAFTSLTFLAHQGMTYVPLGYRSPL  149
                                 IFFSTG QG GQE TAF++L F AHQG+T+VPLGYRSPL
Sbjct  121  GQETTALTTLTFLTHQGLTAGIFFSTGTQGGGQEVTAFSTLPFFAHQGLTFVPLGYRSPL  180

Query  150  LFNFEEIHGGSP-----------------------------------------------W  162
            LFN EEIHGGSP                                               W
Sbjct  181  LFNMEEIHGGSPTGSQGGGQEVTAFTTLPFFAHQGLTYVPLGYRSQLLANMEEIHGGSAW  240

Query  163  GAGTLAGPDGSRQPSKLELDVAKVQGESFA  192
            GAGT AG DGSRQPS+LEL VAKVQGESFA
Sbjct  241  GAGTFAGSDGSRQPSELELGVAKVQGESFA  270

>PHALS_11795
Length=183

 Score = 266 bits (681),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)

Query  18   LAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIATPDVLKEADGVLFGF  77
            +AE VK GVESV+GVTA IYQV+ETL +  L+ +HA  KKDHPIATPDVLKEA+G+LFG 
Sbjct  1    MAESVKSGVESVDGVTAEIYQVEETLSDETLSKMHAPSKKDHPIATPDVLKEANGILFGI  60

Query  78   PTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTSLTFLAHQG  137
            PTRFG +P+QVKALFD+ GGLW+ GAL+GKPAGIFFSTG  G GQETTAFT+LTFL HQG
Sbjct  61   PTRFGLVPAQVKALFDACGGLWAAGALVGKPAGIFFSTGTMGGGQETTAFTTLTFLTHQG  120

Query  138  MTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAKK  197
            MT+VPLGYRS  L N +EIHGGSPWGAGT AGP G+RQP++LELDVAK QGESFA +AKK
Sbjct  121  MTFVPLGYRSKHLLNMDEIHGGSPWGAGTFAGPSGARQPTQLELDVAKAQGESFAVVAKK  180

Query  198  LAA  200
            L+A
Sbjct  181  LSA  183

>PHYSO_327921
Length=209

 Score = 266 bits (681),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 154/200 (77%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            +TNVAIIYYS +GH ATLA+ +K+GV+SV GV  TIYQV ETL E +LA +HA PK DHP
Sbjct  10   VTNVAIIYYSIHGHAATLAKAIKKGVDSVPGVKGTIYQVAETLSEDILAKMHAPPKLDHP  69

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATP  LKEADG+LFG+PTRFG  P+Q K LFDSTG LW+ G LIGK  G F ST   G+
Sbjct  70   IATPQTLKEADGILFGYPTRFGDFPAQAKTLFDSTGQLWAAGDLIGKLGGAFVSTSLLGA  129

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETT   ++ F+   GMT+VP GYR+  LFN +E+HGGSPWGAGT+AGPD SRQ S LE
Sbjct  130  GQETTQLMTMAFMVSHGMTFVPPGYRAKQLFNVDEVHGGSPWGAGTIAGPDNSRQVSALE  189

Query  181  LDVAKVQGESFAQIAKKLAA  200
             +VA  QG+SFA++ KKL+A
Sbjct  190  KEVAVEQGKSFAEVTKKLSA  209

>PHYCA_121985
Length=199

 Score = 264 bits (675),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 152/198 (77%), Gaps = 1/198 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT VAII YS YGH+ATLAE VK GVESVEGV ATI QVQETLPE +L  +HA PK+D+P
Sbjct  1    MTKVAIIIYSMYGHVATLAETVKSGVESVEGVEATILQVQETLPELVLEKMHAPPKRDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPD+L E DG+L+G PTRFG +P+Q+KA FD  GGLW+ GALIGK  GIFFS G QG 
Sbjct  61   IATPDMLTEYDGILWGMPTRFGMMPAQIKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            G ETTAF +  F AHQGMT+VPLG R+  L   +E+ GG  WGAGT AG  G RQP++ E
Sbjct  121  GNETTAFNTAPFFAHQGMTFVPLGVRARHLHTLDEVIGGGKWGAGTYAG-TGDRQPTERE  179

Query  181  LDVAKVQGESFAQIAKKL  198
            L  AK+QGESFA+I KKL
Sbjct  180  LGTAKIQGESFAEITKKL  197

>PHYRA_72407
Length=199

 Score = 261 bits (666),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 151/198 (76%), Gaps = 1/198 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT VAII YS YGH+ATLAE VK GVESVEGV ATI QV ETLP+ +L  +HA PKKD+P
Sbjct  1    MTKVAIIIYSMYGHVATLAETVKSGVESVEGVEATILQVPETLPDVVLEKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVL + DG+L+G PTRFG +P+QVKA FD  GGLW+ GALIGK  GIFFS G QG 
Sbjct  61   IATPDVLTDFDGILWGMPTRFGMMPAQVKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            G ETTAF +  F AHQGMT+VPLG R+  L   +E+ GG  WGAGT AG  G RQP++ E
Sbjct  121  GNETTAFNTAPFFAHQGMTFVPLGVRARHLHTLDEVVGGGKWGAGTYAGA-GDRQPTERE  179

Query  181  LDVAKVQGESFAQIAKKL  198
            L  AK+QGESFA+I KKL
Sbjct  180  LGTAKIQGESFAEITKKL  197

>PHYKE_8238
Length=199

 Score = 257 bits (656),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 150/198 (76%), Gaps = 1/198 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT VAI+ YS YGH+ATLAE +K GVESVEGVTATI QVQETLPE +L  +HA PKKD+P
Sbjct  1    MTKVAIVIYSMYGHVATLAETIKAGVESVEGVTATILQVQETLPELVLEKMHAPPKKDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            I TP+ L + DG+L+G PTRFG +P+QVKA FD  GGLW+ GALIGK  GIFFS G QG 
Sbjct  61   IITPEQLTDFDGILWGMPTRFGMMPAQVKAFFDGCGGLWAKGALIGKTTGIFFSCGSQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            G E+TA  + TF AHQGMT+VPLG R+  L   +E+ GG  WGAGT AG  G RQP++ E
Sbjct  121  GNESTAMNTATFFAHQGMTFVPLGVRARHLHTLDEVVGGGKWGAGTYAG-TGDRQPTERE  179

Query  181  LDVAKVQGESFAQIAKKL  198
            L  AK+QGESFA I KK+
Sbjct  180  LGTAKIQGESFAVITKKI  197

>PITG_12444
Length=200

 Score = 255 bits (651),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 0/164 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYSTYGH+A LA   K+G+E V GV ATIYQVQETLPE +L  +HA PK DHP
Sbjct  1    MTKIAIVYYSTYGHVAKLANAAKKGIEFVGGVAATIYQVQETLPEEVLTKMHAPPKGDHP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IAT D LKEADG+LFGFP R GS+P+QVKA FDS GGLW++GAL+GK AG+FFSTG QG 
Sbjct  61   IATIDTLKEADGILFGFPCRSGSMPAQVKAFFDSCGGLWASGALVGKTAGLFFSTGTQGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGA  164
            GQETTAFT++TFLAHQGMTYVPLGYR   L N +E+HGGSPWGA
Sbjct  121  GQETTAFTAVTFLAHQGMTYVPLGYRGKELLNMDEMHGGSPWGA  164

>PYAR_24476
Length=213

 Score = 249 bits (636),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)

Query  51   IHAAPKKDHPIATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAG  110
            +HAAPKKDHPI TP++L  ADGVLFG PTRFGS+P+QVKA FDS GGLW+ G L+GKPAG
Sbjct  1    MHAAPKKDHPIITPEILAAADGVLFGIPTRFGSMPAQVKAFFDSCGGLWAKGGLVGKPAG  60

Query  111  IFFSTGCQGSGQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGP  170
            +FFSTG  G GQETT  +SLTFL H GM++VPLGYRSPLLFN EEIHGGSPWGAGTLAG 
Sbjct  61   MFFSTGTLGGGQETTVMSSLTFLTHHGMSFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGA  120

Query  171  DGSRQPSKLELDVAKVQGESFAQIAKKL  198
            DGSRQPS LELDVAKVQGE+FAQ+A+KL
Sbjct  121  DGSRQPSTLELDVAKVQGETFAQVAQKL  148

>PYAR_22252
Length=201

 Score = 248 bits (634),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 153/202 (76%), Gaps = 3/202 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  VAI+YYST+GH   LAE + EGVE+VEGV   IYQV ETL +  L    AAPK+D+P
Sbjct  1    MAKVAIVYYSTFGHTTVLAEAMLEGVENVEGVEGAIYQVAETLSKDALEQRKAAPKQDYP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            + TP++L E DGVLFGFPT+FG++P Q+ A FDS G LW+ GAL+GKPAG+F S+G  G 
Sbjct  61   LITPEILAEYDGVLFGFPTQFGAMPPQMAAFFDSCGSLWAKGALVGKPAGVFVSSGIMGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAG--PDGSRQPSK  178
            G E++ FT+L FLAHQGM +VPLGYR+ L+    E+HGGS WGAGTL+G  PD  RQP+ 
Sbjct  121  GVESSPFTTLPFLAHQGMLFVPLGYRTKLVSTKHEVHGGSSWGAGTLSGITPD-MRQPTF  179

Query  179  LELDVAKVQGESFAQIAKKLAA  200
            LEL+ A VQG+SFA+I KKLAA
Sbjct  180  LELECAMVQGQSFAEITKKLAA  201

>PHYCA_553010
Length=200

 Score = 245 bits (626),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 150/200 (75%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI++YST+GH+  +A  ++ G++SV  V A +YQV+ETL E +LA +HA PK D P
Sbjct  1    MTKIAIVFYSTFGHVTKMAAAIQAGIQSVPNVEAELYQVKETLNEQVLAKLHAPPKLDFP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATPDVLK ADG++ GFPT FG +P+Q+KALFDS G LW  G LIGKP G+FFS G +G 
Sbjct  61   VATPDVLKNADGIMLGFPTHFGMVPAQMKALFDSCGALWMKGELIGKPCGVFFSCGSRGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQE +A ++  ++AH GM +VPL  R  ++   +E+HG S WG+GT+AG D SRQPS LE
Sbjct  121  GQEVSAMSTTPYIAHLGMLFVPLALRGNVIEATDELHGCSLWGSGTVAGSDRSRQPSDLE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA++QGE FA+I KKL+A
Sbjct  181  LKVAQMQGEKFAEITKKLSA  200

>PHYCA_508489
Length=156

 Score = 238 bits (608),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 136/200 (68%), Gaps = 44/200 (22%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            M  +AI+YYS Y HI+T+AE                                        
Sbjct  1    MAKIAIVYYSCYNHISTMAE----------------------------------------  20

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
                  LKEADG+LFGFPTRFGSLPSQ+KA FDS GGLW+ GAL+GKPAGIFFSTG QG 
Sbjct  21   ----TTLKEADGILFGFPTRFGSLPSQMKAFFDSCGGLWAAGALVGKPAGIFFSTGTQGG  76

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTAFT+LTFLAHQGMTYVPLGYR+P L N EEIHGGS WGAGTLA  DGSRQPSKLE
Sbjct  77   GQETTAFTALTFLAHQGMTYVPLGYRAPELANMEEIHGGSAWGAGTLANGDGSRQPSKLE  136

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA  QG+SFA+IAKKLAA
Sbjct  137  LTVATTQGKSFAEIAKKLAA  156

>PPTG_03053
Length=225

 Score = 239 bits (611),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 150/200 (75%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT VAI++YST+GH+  +A  +++G+++V GV A +YQV+ETL E +LA +HA PK D P
Sbjct  26   MTKVAIVFYSTFGHVTKMASAIQKGIQTVPGVQAQLYQVKETLNEEVLAKLHAPPKPDFP  85

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            IATPDVLK ADG++ GFPT FG +P+Q+KALFD++  LW  G LIGKP GIFFS G +G 
Sbjct  86   IATPDVLKNADGIMLGFPTHFGMVPAQMKALFDASVALWVKGELIGKPCGIFFSCGSRGG  145

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQE +A ++  ++AH GM +VPL      +   +E+HG S WG+GT+AG D SRQPS LE
Sbjct  146  GQEVSAMSTTPYIAHLGMLFVPLALNGKTIEGSDEMHGCSLWGSGTVAGHDRSRQPSALE  205

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA++QG+ FA+I KKLAA
Sbjct  206  LKVAEMQGKKFAEITKKLAA  225

>PHYRA_82142
Length=200

 Score = 236 bits (603),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 150/200 (75%), Gaps = 0/200 (0%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT VAI++YST+GH+  LA+ ++ GV++V GV A +YQV+ETL E +LA + A PK++  
Sbjct  1    MTKVAIVFYSTFGHVTKLAKSIQAGVQAVPGVEAELYQVKETLSEEVLAKLRAPPKQEFS  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            +ATP VLKEADG++ GFPT FG +P+Q+KALFDS G LW  G LIGKP G+FFS G +G 
Sbjct  61   VATPAVLKEADGIMLGFPTHFGMVPAQMKALFDSCGMLWMKGELIGKPCGVFFSCGSRGG  120

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQE +A ++  ++AH GM +VPL  R  ++   +E+HG S WG+GT+A  D SRQPS LE
Sbjct  121  GQEVSAMSTTPYIAHLGMMFVPLSLRGSVIEGNDELHGCSLWGSGTVANSDRSRQPSALE  180

Query  181  LDVAKVQGESFAQIAKKLAA  200
            L VA++QG+ FA+I KKL++
Sbjct  181  LSVAEMQGKKFAEITKKLSS  200

>PYVX_24503
Length=113

 Score = 189 bits (479),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)

Query  88   VKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTSLTFLAHQGMTYVPLGYRS  147
            V+ALFD+TGGLW +GAL+GKPAG FFSTG  G GQETTA+++LTFL H G+ YVPLGY++
Sbjct  1    VRALFDATGGLWGSGALVGKPAGFFFSTGTLGGGQETTAYSTLTFLTHHGLVYVPLGYQT  60

Query  148  PLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAKKLAA  200
            PLLFN +E+HGGSPWGAGTLAGPDGSRQPSKLELDVA+VQGE FA IAKKL+A
Sbjct  61   PLLFNLDEVHGGSPWGAGTLAGPDGSRQPSKLELDVAEVQGEKFAGIAKKLSA  113

>PYIW_26124
Length=139

 Score = 187 bits (474),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 104/139 (75%), Gaps = 1/139 (1%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKK-DH  59
            MT +A++YYS YGHI  LA  +K G   V GV   ++QVQETLP+ LL  +HAAPK  DH
Sbjct  1    MTKIAVVYYSMYGHIGKLASAIKAGTSRVAGVETQLFQVQETLPDALLTKMHAAPKAADH  60

Query  60   PIATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQG  119
            P+ATP+ L++AD +L G PTRFG LPSQVK LFD+ GGLW+TG LIGKP GIFFSTG  G
Sbjct  61   PVATPETLRDADAILLGLPTRFGMLPSQVKGLFDACGGLWATGGLIGKPCGIFFSTGSLG  120

Query  120  SGQETTAFTSLTFLAHQGM  138
             GQETTA ++  FLAH GM
Sbjct  121  GGQETTAMSTTPFLAHHGM  139

>PITG_19721
Length=147

 Score = 187 bits (475),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 119/199 (60%), Gaps = 53/199 (27%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MTNVAIIYYS YGH+A LA  +K GV SV GV A+                         
Sbjct  1    MTNVAIIYYSMYGHVAKLASSIKAGVTSVPGVKAS-------------------------  35

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
                    +ADG L GFPTRFG                     LIGKP GIFFS+   G 
Sbjct  36   --------DADGTLLGFPTRFG--------------------GLIGKPCGIFFSSASLGG  67

Query  121  GQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLE  180
            GQETTA +   F+AHQGMT+VPLGYRSPL+   EEIHGGSPWGAGTLA  DGSRQP+ +E
Sbjct  68   GQETTAMSMTPFIAHQGMTFVPLGYRSPLVGTNEEIHGGSPWGAGTLANADGSRQPTDVE  127

Query  181  LDVAKVQGESFAQIAKKLA  199
            L++AK+QG+SFA+I KKL+
Sbjct  128  LEIAKIQGQSFAEITKKLS  146

>PYAR_17624
Length=215

 Score = 188 bits (477),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 129/218 (59%), Gaps = 25/218 (11%)

Query  1    MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
            MT +AI+YYS YGH+  LAE VK G + V GV A +YQV ETLP  +L  + A PK D P
Sbjct  1    MTRIAIVYYSLYGHVGKLAEAVKVGAKRVPGVDAQLYQVAETLPSDILQKMGAPPKPDLP  60

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQ---------------VKALFDST-----GGLWS  100
            +ATPDVLK +     G      +L S                   + +S      G  W 
Sbjct  61   VATPDVLKNSXXXXIGGGQETTALTSTPILAHHGMMYVPLGYRSPMLESNDHVHGGSDWG  120

Query  101  TGALIGKPAGIFFSTGCQGSGQETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGS  160
            TG +              G GQETTA TS+ FLAH GM YVPLGYR+PLL + +++HGGS
Sbjct  121  TGTITNGDXXXXI-----GGGQETTALTSMPFLAHHGMMYVPLGYRTPLLASNDQVHGGS  175

Query  161  PWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAKKL  198
            PWG GT+A  DGSRQPS+L L++AKVQGESFA IAKKL
Sbjct  176  PWGTGTIANGDGSRQPSELGLEIAKVQGESFAAIAKKL  213

>PYIW_24901
Length=123

 Score = 155 bits (392),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 1/124 (1%)

Query  77   FPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTSLTFLAHQ  136
             PTRFGS+P+Q+K  FD+TG LW  GALIGKPAG+FFS G QG G ETTA  ++ FL HQ
Sbjct  1    MPTRFGSVPAQLKNFFDATGSLWQKGALIGKPAGVFFSCGSQGGGNETTALMTIPFLTHQ  60

Query  137  GMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAK  196
            GM +VPLG R+      +E+ GG  WG GT AG DGSR+PS+ EL  AKVQG SFA+I K
Sbjct  61   GMLFVPLGTRAKQFGTLDEVVGGGKWGTGTYAG-DGSRKPSERELSTAKVQGVSFAEITK  119

Query  197  KLAA  200
            KLAA
Sbjct  120  KLAA  123

>PYVX_24541
Length=82

 Score = 151 bits (381),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
           MT +AI+YYSTYGH+A LAE VKEGVESVEGVTATIYQV ETLPE LLA IHAAPKKDHP
Sbjct  1   MTKIAIVYYSTYGHVAKLAESVKEGVESVEGVTATIYQVPETLPEELLAQIHAAPKKDHP  60

Query  61  IATPDVLKEADGVLFGFPTRFG  82
           IATPDVLKEADG+LFGFPTRFG
Sbjct  61  IATPDVLKEADGILFGFPTRFG  82

>PPTG_20265
Length=89

 Score = 148 bits (374),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 0/89 (0%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
           M  +AI+YYSTYGHIA LAE VK+GVES+ GVTA IYQVQETLP+ +LA ++AAPKKDHP
Sbjct  1   MAKIAIVYYSTYGHIAQLAEAVKKGVESIAGVTADIYQVQETLPDEILAKMYAAPKKDHP  60

Query  61  IATPDVLKEADGVLFGFPTRFGSLPSQVK  89
           IATP+ LKEADG+LFGFPTRFGSLP+Q+K
Sbjct  61  IATPETLKEADGILFGFPTRFGSLPAQMK  89

>PYIR_25309
Length=103

 Score = 148 bits (373),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 75/78 (96%), Gaps = 0/78 (0%)

Query  123  ETTAFTSLTFLAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELD  182
            ETTA+T+LTFLAH GMTYVPLGYRS L+F+FEEIHGGSPWGAG+ AGPDGSRQPSKLELD
Sbjct  26   ETTAYTTLTFLAHHGMTYVPLGYRSKLVFSFEEIHGGSPWGAGSYAGPDGSRQPSKLELD  85

Query  183  VAKVQGESFAQIAKKLAA  200
            VAKVQGESFAQIAKKL+A
Sbjct  86   VAKVQGESFAQIAKKLSA  103

 Score = 41.2 bits (95),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEG  25
           MT +AI+YYSTYGHI  LAE +K G
Sbjct  1   MTKIAIVYYSTYGHIVKLAETIKAG  25

>PYIW_25666
Length=75

 Score = 136 bits (342),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 72/75 (96%), Gaps = 0/75 (0%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
           MTNVAI+YYSTYGHIATLAE++K G+ESVEGVTATIYQ+QETLPE +LA ++AAPKKDHP
Sbjct  1   MTNVAIVYYSTYGHIATLAEEIKAGIESVEGVTATIYQIQETLPEDVLAKMYAAPKKDHP  60

Query  61  IATPDVLKEADGVLF  75
           +ATPDVLKEADG+LF
Sbjct  61  VATPDVLKEADGILF  75

>PYIW_26817
Length=80

 Score = 124 bits (311),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 70/97 (72%), Gaps = 17/97 (18%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
           MTN+AI                 EGVE   GVTA IYQ+ ETLPE +LA +HA PKKDHP
Sbjct  1   MTNIAI-----------------EGVEQATGVTAEIYQIAETLPEEVLAKMHAPPKKDHP  43

Query  61  IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGG  97
           IATPDVLK ADG+LFG PTRFGS+P+QVKALFDSTGG
Sbjct  44  IATPDVLKAADGILFGIPTRFGSMPAQVKALFDSTGG  80

>PYAR_17731
Length=63

 Score = 119 bits (299),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)

Query  138  MTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAKK  197
            MT+VPLGYRSPLLFN EEIHGGSPWGAGTLAG DGSRQPSKLELDVAK QGESF Q+AKK
Sbjct  1    MTFVPLGYRSPLLFNLEEIHGGSPWGAGTLAGGDGSRQPSKLELDVAKAQGESFTQVAKK  60

Query  198  LAA  200
            L+A
Sbjct  61   LSA  63

>PYIR_16433
Length=102

 Score = 120 bits (302),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 65/88 (74%), Gaps = 1/88 (1%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPK-KDH  59
           MT +A++YYS YGHI  LA  +K G   V GV   ++QVQETLP+ LL  +HAAPK  DH
Sbjct  1   MTKIAVVYYSMYGHIGKLASAIKAGTSRVPGVETQLFQVQETLPDDLLQRMHAAPKATDH  60

Query  60  PIATPDVLKEADGVLFGFPTRFGSLPSQ  87
           PIATPD LKEADG+L G PTRFG LPSQ
Sbjct  61  PIATPDTLKEADGILLGLPTRFGMLPSQ  88

>PITG_22462
Length=64

 Score = 105 bits (262),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)

Query  137  GMTYVPLGYRSPLLFNFEEIHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAK  196
            G+T+VPLGYR+P LFN +E+HGGSPWGAGTLAG DGSRQPSK EL VA  QG+SFA++AK
Sbjct  1    GLTFVPLGYRAPELFNMDELHGGSPWGAGTLAGGDGSRQPSKPELTVATTQGKSFAEVAK  60

Query  197  KLAA  200
            KLAA
Sbjct  61   KLAA  64

>PHYSO_525925
Length=73

 Score = 99.4 bits (246),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHP  60
           MTNVAI YYS YGH+A LA  +K GV SV GV A++YQVQ+TL + LL  +HA PK D P
Sbjct  1   MTNVAI-YYSMYGHVAKLANSLKAGVTSVPGVKASVYQVQKTLNDDLLKALHAPPKPDLP  59

Query  61  IATPDVLKEADGVL  74
           IATPDVLK ADG+L
Sbjct  60  IATPDVLKNADGIL  73

>PYVX_22081
Length=45

 Score = 84.7 bits (208),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)

Query  156  IHGGSPWGAGTLAGPDGSRQPSKLELDVAKVQGESFAQIAKKLAA  200
            +HGGSPWGAGTLAGPDGSRQPSKLELDVA+VQGE FA IAKKL+A
Sbjct  1    VHGGSPWGAGTLAGPDGSRQPSKLELDVAEVQGEKFAGIAKKLSA  45

>PHYKE_5219
Length=38

 Score = 65.9 bits (159),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQ  38
           M N+AI+YYS Y HIAT+A+ +KEG+ESV+GVTATIYQ
Sbjct  1   MVNIAIVYYSCYNHIATMADSIKEGIESVDGVTATIYQ  38

>PHYKE_4826
Length=38

 Score = 61.6 bits (148),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)

Query  1   MTNVAIIYYSTYGHIATLAEQVKEGVESVEGVTATIYQ  38
           MT +AI+YYSTYGHIA LAE  KEG+ES  GVTATIYQ
Sbjct  1   MTKIAIVYYSTYGHIAKLAEAAKEGIESTPGVTATIYQ  38

>PHYSO_329877
Length=115

 Score = 57.0 bits (136),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query  76   GFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSGQETTAFTSLTFLAH  135
            G PTR   +P+Q+   FD  GGLW+ GALIG    + FS G QG G ET A  +   L  
Sbjct  48   GLPTRLDVMPAQITEFFDCCGGLWAKGALIGN---VIFSYGSQGGGNETIALPADARLDE  104

Query  136  QGMTYVPLGYR  146
               T VP   R
Sbjct  105  MFGTGVPASGR  115

>PHALS_05431
Length=481

 Score = 34.3 bits (77),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 29/79 (37%), Gaps = 16/79 (20%)

Query  61   IATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGS  120
            I  P+ +K+   +LFG   R G   S     FD    +W+    + KP            
Sbjct  232  IKNPNSVKDVRRILFGTKERIGLDDSNFWVWFDYLHFVWNYSVTVSKP------------  279

Query  121  GQETTAFTSLTFLAHQGMT  139
                  F  + FL H G+T
Sbjct  280  ----NYFEFIDFLLHNGLT  294

>SDRG_16426
Length=1628

 Score = 33.1 bits (74),  Expect = 1.3, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 30/57 (53%), Gaps = 2/57 (4%)

Query  14    HIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDH--PIATPDVLK  68
             HIA L ++++E V +V   TA+  Q  E L    +   H A  +DH   I +PDV K
Sbjct  1329  HIAGLKQELREIVSAVAQPTASTAQKPELLRRRSVVKEHLAAAQDHLAQITSPDVEK  1385

>PITG_11840
Length=106

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 2/26 (8%)

Query  74  LFGFPTRFGSLPSQVKALFDSTGGLW  99
           + G  TR   +P+Q+KALFD+ G +W
Sbjct  1   MLGLSTRM--MPAQMKALFDARGDMW  24

>PHYRA_72309
Length=147

 Score = 30.4 bits (67),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (46%), Gaps = 2/83 (2%)

Query  49   ATIHAAPKKDHPIATPDVLKEADGVLFGFPTRFGSLPSQVKALFDSTGGLWSTGALIGKP  108
            ATI A  ++ H +  P ++  +DG +  FP R       ++  F  T    + G  + + 
Sbjct  33   ATIMAGDRQGHHVLIPRIVFISDGDIRDFPFRLRRRQFPIQTAFAMTIN-KAQGQTV-QY  90

Query  109  AGIFFSTGCQGSGQETTAFTSLT  131
             G++ +T C   GQ   A + +T
Sbjct  91   LGLYLATPCFSHGQLYVAMSRVT  113

>PHYCA_115201
Length=405

 Score = 30.8 bits (68),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 41/106 (39%), Gaps = 6/106 (6%)

Query  63   TPDVLKEADGVLFGF-PTRFGSLPSQVKALFDSTGGLWSTGALIGKPAGIFFSTGCQGSG  121
             P   +EAD V  GF P     +  Q  A  D T   W+T   IG P      T  +G+ 
Sbjct  198  VPWTAREADQVPEGFNPDALAIIDYQSGATADPTTSAWATEVAIGDPP---LFTIAKGAN  254

Query  122  QETTAFTSLTF-LAHQGMTYVPLGYRSPLLFNFEEIHGGSPWGAGT  166
             E    T+    L H     V +   +P    F  +H  SPW  G+
Sbjct  255  TEDLPITANAIKLKHNDHVEVVVVNETPDQHPF-HLHAHSPWIVGS  299

>H257_03966
Length=1667

 Score = 30.4 bits (67),  Expect = 10.0, Method: Composition-based stats.
 Identities = 23/90 (26%), Positives = 35/90 (39%), Gaps = 6/90 (7%)

Query  10    STYGHIATLAEQVKEGVESVEGVTATIYQVQETLPEGLLATIHAAPKKDHPIATPDVLKE  69
             ST  H AT+  +V   +ES+      I Q+QE L    L         D      DV+ E
Sbjct  1154  STNAHCATVEAKVGALLESLADKDGQIVQLQEELQTAELTNAQTQAGLD------DVVAE  1207

Query  70    ADGVLFGFPTRFGSLPSQVKALFDSTGGLW  99
                 L     R G +  +++   D +  +W
Sbjct  1208  RTKALADEAKRMGLVNKELRVGVDESNAMW  1237

Lambda      K        H        a         alpha
   0.316    0.134    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9038049390

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40